Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
3 AAA AAA
4 AAA BBB JABBALPUR, KATHMANDU,
5 AAA SOCIETY A AA AAAAAAAAAAAAAA
6 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
7 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
8 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
9 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
10 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
11 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
12 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
13 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
14 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
15 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
16 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
17 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
18 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
19 AARAV MEDISHINE PRIVATE LIMITED 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.- DURG (C.G.)
20 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
21 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
22 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
23 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
24 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
25 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
26 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
27 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
28 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
29 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
30 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
31 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
32 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
33 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
34 AASTHA EDUCATION AND WELFARE SOCIETY C/O, ABHAYKUMAR DANDAGE, SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
35 AASTHA EDUCATION AND WELFARE SOCIETY C/O ABAHYKUMAR DANDAGE F-5 SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
36 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
37 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO.1, SUMSUL AARIFFA NAGAR, PERIYAR SALAI ROAD, KEELAVASAL, THANJAVUR
38 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
39 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
40 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
41 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
42 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
43 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
44 ABC BHOPAL
45 ABC JKLJLJK
46 ABC KALARA BURDWAN
47 ABC JHSDJHDFKLJDFKJHJKGD
48 ABCD ABCD
49 ABCD ABCDEFGHIJKLMNOP
50 ABC FIRM LTD PATNA
51 ABC PVT LTD PUNE
52 ABC TRUST LKCNSDKAJD
53 ABDIN EDUCATINAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
54 ABD PVT LTD XYZ
55 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
56 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
57 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
58 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
59 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
60 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
61 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
62 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
63 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
64 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
65 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
66 ABHYUDAY VEDANT SOCIETY VANDE MATARAM BHAVAN, CHURCH ROAD KUNKURI, DIST. - JASHPUR
67 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
68 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
69 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
70 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
71 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
72 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
73 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
74 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
75 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
76 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
77 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
78 ACCURATE EDUCATION AND RESEARCH SOCIETY C-187,SURYANAGAR, GHAZIABAD, UP
79 ACE CONSULTING PRIVATE LIMITED NO.309 2ND FLOOR DEEP PLAZA OPPOSITE GURGAON COURT SOHNA ROAD GURGAON HARYANA 122001
80 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
81 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
82 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
83 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
84 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
85 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
86 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
87 ACTION FOR ADVANCEMENT OF SOCIETY A-30, MADHAV RAO SAPARE NAGAR, BIRGAON, RAIPUR, CHHATTISGARH
88 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
89 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
90 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
91 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
92 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
93 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
94 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
95 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
96 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
97 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
98 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
99 ADARSH FOODS CITY STATION ROAD KHURJA
100 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
101 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
102 ADARSH VIDHYA SAMITI 87 UTTAMGIRI COLONY,NEAR DOUBLE CROSSING, SHASTRIPURAM AGRA
103 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
104 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
105 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
106 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
107 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
108 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
109 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
110 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
111 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
112 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
113 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
114 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
115 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
116 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
117 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
118 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
119 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
120 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
121 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
122 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
123 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
124 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
125 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
126 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
127 ADVANCED LIFE CARE MULTIDESCIPLINARY HOSPITAL PRIVATE LIMITED 26-KASIA ROAD CANTT CROSSING DAUDPUR GORAKHPUR U.P
128 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
129 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
130 ADVANCE INFORMATION AND MULTIMEDIA EDUCATION SOCIETY 53 A, MAIN ROAD KARRAHI, BARRA, KANPUR
131 ADVENT CHEMBIO PRIVATE LIMITED 21, QUEEN VIEWS, JUHU ROAD, MUMBAI
132 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
133 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
134 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
135 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
136 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
137 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
138 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
139 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
140 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
141 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
142 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
143 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
144 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
145 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
146 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
147 AIFA INFOTECH PVT LTD 572/2D, ADRSH NAGAR, NEW RAILWAY ROAD, OPP, AUTO STAND, GURUGRAM, HARYANA-122001
148 AIFA INFOTECH PVT LTD 572/2, AADRSH NAGAR, NEW RAILWAY ROAD, OPP. AUTO STAND, GURUGRAM HR
149 AIFA INFOTECH PVT LTD 572/2,ADARSH NAFAR, NEW RAILWAY ROAD, OPP. AUTO STAND,GURUGRAM HARYANA-122001
150 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
151 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
152 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
153 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
154 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
155 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
156 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
157 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
158 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
159 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
160 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
161 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
162 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
163 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
164 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
165 A K SAMANTARAY AND COMPANY PRIVATE LIMITED PLOT NO. 309/1801, SUB PLOT NO.1, SBI CAMPUS, SAILASHREE VIHAR, BHUBANESWAR
166 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
167 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
168 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
169 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
170 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
171 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
172 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
173 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
174 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
175 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
176 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
177 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
178 ALIGN SKILLS EDUTECH W.NO. 6, NEAR CHUNA FATAK, HANUMANGARH
179 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
180 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
181 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
182 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
183 ALL INDIA COUNCIL OF TECHNICAL EDUCATION AND TECHNOLOGY UTTRA KOWGACHI, VIVEKANANDA LANE, NEAR – SHAKTI SANGHA CLUB, P.O. - SHYAMNAGAR, P.S.- JAGATDDAL
184 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
185 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
186 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
187 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
188 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
189 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
190 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
191 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
192 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
193 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
194 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
195 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
196 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
197 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
198 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
199 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
200 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
201 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
202 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
203 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
204 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
205 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
206 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
207 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
208 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
209 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
210 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
211 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
212 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
213 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
214 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
215 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
216 AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-686/K/15, 4TH FLOOR, BANJARA HILLS, ROAD NO12,HYDERABAD.
217 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
218 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
219 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
220 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
221 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
222 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
223 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
224 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
225 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
226 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
227 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
228 AMRUTHA FOUNDATION NO.306, D.B. ROAD, R.S..PURAM, COIMBATORE - 641002 TAMILNADU - INDIA
229 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
230 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
231 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
232 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
233 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
234 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
235 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
236 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
237 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
238 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
239 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
240 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
241 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
242 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
243 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
244 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
245 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
246 ANFAR FOUNDATION 2ND FLOOR, ANFAR SHOPPING CENTRE, J.K. KEDIA ROAD, HOJAI, P.O. HOJAI, P.S. HOJAI, DISTRICT- NAGAON, ASSAM, INDIA
247 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
248 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
249 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
250 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
251 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
252 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
253 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
254 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE
255 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
256 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
257 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
258 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
259 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
260 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
261 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
262 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO 3,DIGDOH HILLS ,HINGNA MIDC,NAGPUR
263 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO.3, DIGDOH HILLS,HINGNA MIDC, NAGPUR
264 ANKUSH SHIKSHAN SANSTHA ANKUSH SHIKSHAN SANSTHA, CRPF GATE, DIGDOH HILLS, HINGNA MIDC, NAGPUR, 440016
265 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
266 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
267 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
268 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
269 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
270 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
271 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
272 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
273 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
274 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
275 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
276 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
277 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
278 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
279 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
280 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
281 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
282 ANNAMALAI ASDJFKL ADF ASDF AS F
283 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
284 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
285 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
286 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
287 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
288 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
289 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
290 ANTOYODAYA SAI KRIPA SEWA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA DISTT SAGAR
291 ANTYODAYA SAI KRIPA SEVA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA
292 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
293 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
294 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
295 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
296 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
297 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
298 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
299 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
300 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
301 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
302 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
303 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
304 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
305 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
306 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
307 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
308 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
309 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
310 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
311 APLOMB ABHILASHA BHAWAN MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA
312 APNA TELE LINK PRIVATE LIMITED SCO 1-12, 4TH FLOOR, PPR MALL, MITHAPUR ROAD JALANDHAR CITY
313 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
314 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
315 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
316 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
317 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
318 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
319 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
320 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
321 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
322 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
323 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
324 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
325 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
326 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
327 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
328 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
329 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
330 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
331 ARCEUS INFOTECH PVT LTD 508, 5TH FLOOR, THE SUMMIT BUSINESS BAY (OMKAR), ANDHERI-KURLA ROAD, ANDHERI (EAST), MUMBAI - 400093
332 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
333 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
334 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
335 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR SHREE RAM BHAWAN PICNIC SPOT ROAD KHURAM NAGAR LUCKNOW
336 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
337 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
338 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
339 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
340 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
341 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
342 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
343 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
344 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
345 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
346 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
347 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
348 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
349 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
350 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
351 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
352 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
353 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
354 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
355 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
356 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
357 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
358 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
359 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
360 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
361 ARUNACHAL UNIVERSITY OF STUDIES NH-52, NAMSAI DISTRICT NAMSAI
362 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
363 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
364 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
365 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
366 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
367 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
368 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
369 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
370 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
371 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
372 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
373 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
374 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
375 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
376 ASFSDA ASDF
377 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
378 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
379 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
380 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
381 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
382 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
383 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
384 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
385 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
386 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
387 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
388 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
389 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
390 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
391 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
392 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
393 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
394 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
395 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
396 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
397 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
398 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
399 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
400 ASIAN INFOTECH EDUCATIONAL DEVELOPMENT SOCIETY ASIAN INFOTECH ZOOROAD TINIALI APURBA SINHA PATH BY LANE-05
401 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
402 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
403 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
404 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
405 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
406 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
407 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
408 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
409 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
410 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
411 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
412 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
413 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
414 ASSIST G. T. ROAD CHILAKALURIPET GUNTUR DISTRICT ANDHRA PRADESH
415 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
416 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
417 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
418 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
419 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
420 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
421 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
422 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
423 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
424 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
425 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
426 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
427 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
428 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
429 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
430 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
431 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
432 ATMIY MANAGEMENT LLP AT,GADHADA MOHANNAGAR SOCIETY OPP.NEW BUSSTATION DIST.BOTAD TALUKO - GADHADA
433 ATMIY MANAGEMENT LLP AT GADHADA MOHANNAGAR SOCIETY OPP NEW BUS STATION DIST BOTAD
434 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
435 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
436 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
437 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
438 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
439 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
440 AVJ INFOTECH PVT LTD AMIYO NIKETAN NAITY ROAD,BAGAN PARA,2ND FLOOR,P.O-NABAGRAM, PIN: 712246
441 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
442 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
443 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
444 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
445 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
446 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, JHANSI UP 284001
447 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
448 AVTAR WELFARE SOCIETY 538/5-C BANKER COLONY, JHANSI
449 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
450 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
451 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
452 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
453 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
454 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
455 BABA JAKJDAS JHAKJB KNKDCKDN KJBSKBDSKN BSKBDKCB
456 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
457 BABA SAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE , PLOT NO 59/471 , P.S - SECTOR 12. BOKARO (JHARKHAND)
458 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
459 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
460 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
461 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
462 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
463 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
464 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
465 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
466 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
467 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
468 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
469 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
470 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
471 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
472 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
473 BALAGH EDUCATION AND WELFARE SOCIETY 3RD FLOOR KHALID APARTMENT BADI OMTI JABALPUR M.P.
474 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
475 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
476 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
477 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
478 BALAJ TRUST CO LTD DGHDGGHDGDGGD
479 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
480 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
481 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
482 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
483 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
484 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
485 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
486 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
487 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
488 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
489 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
490 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
491 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
492 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
493 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
494 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
495 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
496 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
497 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
498 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
499 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
500 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
501 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
502 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
503 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
504 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
505 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
506 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
507 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
508 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
509 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
510 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
511 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
512 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
513 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
514 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
515 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
516 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
517 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80, SITE-5, UDYOG KUNJ, PANKI, KANPUR-208022,PH. NO.0512-2212083
518 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
519 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
520 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
521 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
522 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
523 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
524 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
525 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
526 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
527 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
528 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
529 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
530 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
531 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
532 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
533 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
534 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
535 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
536 BHANSALI TRUST BHANSALI TRUST AND HOSPITAL, HIGHWAY CROSS ROAD, NEAR GAYATRI TEMPLE
537 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
538 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
539 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
540 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
541 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
542 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
543 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
544 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
545 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
546 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
547 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
548 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
549 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
550 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
551 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
552 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
553 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
554 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
555 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
556 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
557 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
558 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
559 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
560 BHARAT VEERANGNA AWANTIBAI EDUCATIONAL SANTHAN D-16 SECTOR-9 VIJAY NAGAR GHAZIABAD
561 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
562 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
563 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
564 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
565 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
566 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
567 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
568 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
569 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
570 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
571 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
572 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
573 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
574 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
575 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
576 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
577 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
578 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
579 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
580 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
581 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
582 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
583 BHUPINDRA SOCIETY REGISTERED OFFICE : SCF-34, DUKHNIWARAN SAHIB GURUDWARA MARKET, PATIALA, PUNJAB- 147001 CORPORATE OFFICE : SCO-19, 2ND FLOOR, SECTOR 26, MADHYA MARG, CHANDIGARH , 160019
584 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
585 BILASPUR FULE STATION VILLAGE-PARSADA DISTRICT-BILASPUR RAIPUR ROAD BILASPUR
586 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
587 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
588 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
589 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
590 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
591 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
592 BISWAAS BAHARANA.NIALI,CUTTACK
593 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
594 BIYANI SHIKSHAN SAMITI BIYANI SHIKSHAN SAMITI, R-4, SECTOR 3, VIDYADHAR NAGAR, JAIPUR
595 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
596 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
597 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
598 BLUEBLOOD VENTURES LIMITED ROOM NO. 101, P-27, MALVIYA NAGAR, NEW DELHI
599 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED NO.18 SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR BANGALORE - 560043
600 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED #18, SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR, BANGALORE 560043
601 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
602 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
603 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
604 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
605 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
606 BORAL NUTANHAT YOUTH COMPUTER TRAINING CENTRE C/6 RAJNARAYAN PARK,RANGKAL MORE, BORAL MAIN ROAD , P.O. BORAL,P.S. SONARPUR ,PIN -700154 REGISTERED OFFICE 58/3 MADHYAPARA , ROYNAGAR, P.O.& P.S. BANSDRONI,KOLKATA-700070
607 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
608 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR
609 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
610 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED D-17,THACKER INDUSTRIAL ESTATE,N.M JOSHI MARG,CHINCHPOKALI MUMBAI - 400011
611 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
612 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
613 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
614 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
615 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
616 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
617 BRIGHT FUTURE ACADEMY SHYAM JI MARG ,KETKA ROAD SURAJPUR(CG)
618 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
619 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
620 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
621 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
622 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
623 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
624 BRIGHT STAR MUSLIM ASSOCIATION 42, INDIRA NAGAR, B.N.P. ROAD, DEWAS
625 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
626 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
627 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
628 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
629 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
630 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
631 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
632 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
633 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
634 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
635 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
636 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
637 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
638 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
639 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
640 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
641 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
642 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
643 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
644 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
645 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
646 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
647 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
648 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
649 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
650 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
651 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
652 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
653 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
654 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
655 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
656 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
657 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
658 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
659 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
660 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
661 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
662 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
663 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
664 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
665 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
666 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
667 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
668 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
669 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
670 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
671 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
672 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
673 CAREER EDUCOM ACADEMY 70, JALVIAHAR COLONY, RAIPUR
674 CAREER EDUCOM ACADEMY 70, JALVIHAR COLONY, RAIPUR, CG, 492001
675 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
676 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
677 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
678 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR CHHATTISGARH
679 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
680 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
681 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
682 CARE WORLD BAGHI MEHTAB NEAR BYPASS BRIDGE
683 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
684 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
685 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
686 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
687 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
688 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
689 CDHU EEHDG
690 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMMEDI HOUSE MOHAMMED ALI ROAD MOHARASHTRA MUMBAI
691 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMADI HOUSE, MOHAMADALI ROAD, P.O. BOX, 13097, MASJID BUNDER (WEST), MUMBAI
692 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
693 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
694 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
695 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
696 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
697 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
698 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
699 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
700 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
701 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
702 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
703 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
704 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
705 CENTRAL FOOTWEAR TRAINING INSTITUTE CFTI AGRA C-41 & 42, SITE-C, INDUSTRIAL AREA, SIKANDRA, AGRA
706 CENTRAL INSTITUTE OF DESIGN CENTRAL INSTITUTE OF TOOL DESIGN (A GOVERNMENT OF INDIA SOCIETY MINISTRY OF MSME) BALANAGAR, HYDERABAD
707 CENTRAL INSTITUTE OF TOOL DESIGN CENTRAL INSTITUTE OF TOOL DESIGN, NARASPUR CROSS ROADS, BALANAGAR, HYDERABAD
708 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
709 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
710 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
711 CENTRE FOR COMMUNITY SERVICE AND ALTRUISM NO.14,NEW STREET MANALIESTATE, PUDUPALAYAM MAIN ROAD, CUDDALORE.
712 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
713 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
714 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
715 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
716 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
717 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A1/1, INDUSTRIAL AREA, P.O-MUIDDINPUR JALESHER ROAD FIROZABAD
718 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1,INDUSTRIAL AREA, P.O:MUIDDINPUR,JALESHER ROAD FIROZABAD
719 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
720 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A
721 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH SAS NAGAR PUNJAB YUVA BHAWAN SECTOR 42A
722 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
723 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
724 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
725 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
726 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
727 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
728 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
729 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
730 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
731 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
732 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
733 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
734 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
735 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
736 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
737 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
738 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
739 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
740 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
741 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
742 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
743 CH CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1N-3 MIA, ALWAR
744 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
745 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
746 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
747 CHETNA ALLAHABAD ROAD, KARWI
748 CHETNA ALLAHABAD ROAD KARWI
749 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
750 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
751 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
752 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
753 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
754 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
755 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
756 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
757 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
758 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
759 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
760 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
761 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
762 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
763 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
764 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
765 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
766 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
767 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
768 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
769 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
770 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
771 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
772 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
773 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
774 CHOUHAN HOUSING PRIVATE LIMITED CHOUHAN RESIDENCY, RAJEEV NAGAR, MUKTIDHAM ROAD, AZAD CHOWK, SUPELA, BHILAI-490023, CHHATTISGARH
775 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
776 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
777 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
778 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
779 CITY MAKERS PRIVATE LIMITED CITY MAKERS PVT.LTD G-1,VASUDEO CITY,OPP-RAJHANSH GUEST HOUSE, BENIBABU BAGICHA, RAJENDRA PATH,PATNA.
780 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
781 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
782 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
783 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
784 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
785 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
786 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
787 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
788 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
789 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
790 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
791 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
792 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
793 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
794 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
795 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
796 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
797 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
798 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
799 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
800 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
801 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
802 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
803 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
804 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
805 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
806 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
807 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
808 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
809 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
810 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
811 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
812 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
813 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
814 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
815 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
816 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
817 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
818 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
819 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
820 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
821 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
822 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
823 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
824 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
825 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
826 COODU TRUST H.83.R M.COLONY DINDIGUL
827 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
828 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
829 COREMAGE ACADEMY 518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD JAMNAGAR
830 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
831 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
832 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
833 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
834 COUNCIL FOR SKILL UTILITY TRAINING ASSOCIATION 5FT FLOOR O2 BUSSINESS CENTER, RING ROAD NO 2, NEAR RELIANCE PETROL PUMP,GONDWARA, RAIPUR C.G.
835 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
836 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
837 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
838 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
839 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
840 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
841 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
842 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
843 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
844 CRYSTAL NETWORK SOLUTIONS B-30 , KAPIL VASTU COLONY JHALAWAR , RAJASTHAN
845 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
846 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
847 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
848 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
849 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
850 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
851 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
852 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
853 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
854 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
855 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
856 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
857 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
858 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
859 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
860 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
861 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
862 CYBOTECH EDUSERVE PVT LTD GOLA ROAD, NEAR IMAMBARA, NAWADA, BIHAR
863 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
864 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
865 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
866 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
867 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
868 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
869 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
870 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
871 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
872 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
873 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
874 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
875 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
876 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
877 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
878 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
879 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
880 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
881 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
882 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
883 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
884 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
885 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
886 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
887 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
888 DARYAV ELECTRICAL AND H C E COMAPNY DARYAV MANJIL PHASE 3 INDRAPURI COLOY TIKAMGARH
889 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
890 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
891 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
892 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
893 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
894 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
895 DDUGKY MORD C TEST ALJBSDFLQJHF
896 DDUGKY MORD C TEST1 LJHWDF
897 DDUGKY MORD INC TEST2 NEW DELHI
898 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
899 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
900 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
901 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
902 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
903 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
904 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
905 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
906 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
907 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
908 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
909 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
910 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
911 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
912 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
913 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
914 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
915 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
916 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
917 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
918 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
919 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
920 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
921 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
922 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
923 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
924 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
925 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
926 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
927 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
928 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
929 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
930 DFHDFHFH KJDVNMDV,M DV
931 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
932 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
933 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
934 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
935 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
936 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
937 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
938 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
939 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
940 DHANVI CHARITABLE AND EDUCATIONAL TRUST SHOP NO 39 ADITYA COMPLEX NEAR KASAK CIRCLE BHARUCH
941 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
942 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
943 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
944 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
945 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
946 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
947 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
948 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
949 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
950 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR MILAK RAMPUR UP
951 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK DISTT RAMPUR UP
952 DIKSHA SAMAJ SEWA SOCITY MOH NAI BASTI ASDULLAPUR MILAK RAMPUR
953 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
954 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
955 DISHA DISHA LANE, HISAR ROAD, SIRSA
956 DISHA DISHA SIRSA ,DISHA LEN, FRINDES COLONY,BIHAIND PREETAM PALECE ,SIRSA PIN NO. 125055
957 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
958 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
959 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
960 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
961 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
962 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
963 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
964 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
965 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
966 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
967 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
968 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
969 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
970 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
971 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
972 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
973 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
974 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
975 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
976 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
977 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
978 DIVYSAGAR SOCIETY 108, SR. MIG,NEAR ALLAHABAD BANK, KOTRASULTANABAD,
979 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
980 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
981 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
982 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
983 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
984 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
985 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
986 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
987 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
988 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
989 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
990 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
991 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
992 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
993 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
994 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
995 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
996 DR AMBEDKAR MEMORIAL SOCIAL WELFARE AND EDUCATIONAL TRUST AT/PO-JAGDA, ROURKELA, PS-JHIRPANI, DIST-SUNDARGARH
997 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
998 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
999 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
1000 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
1001 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1002 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1003 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
1004 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
1005 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1006 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1007 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
1008 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
1009 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
1010 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
1011 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
1012 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
1013 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1014 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1015 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
1016 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1017 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1018 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1019 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
1020 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1021 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
1022 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
1023 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
1024 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
1025 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
1026 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
1027 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
1028 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
1029 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
1030 DUPATI SRI EDUCATIONAL SOCIETY H NO 87-1345-10-1, ENGINEERS COLONY,KURNOOL,AP
1031 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
1032 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1033 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1034 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1035 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1036 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
1037 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
1038 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
1039 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
1040 DURJAN SAL EDUCATIONAL TRUST RAM SINGH COLLEGE OF ENGG.AND TECHNOLOGY,NAGLA SIKANDAR TUNDLA-ETAH ROAD,FIROZABAD
1041 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
1042 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
1043 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
1044 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
1045 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
1046 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
1047 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
1048 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
1049 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
1050 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1051 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1052 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
1053 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
1054 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
1055 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
1056 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
1057 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
1058 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
1059 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
1060 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
1061 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
1062 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
1063 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
1064 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
1065 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
1066 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
1067 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
1068 EDS GADEPAN KOTA
1069 EDUCATIONAL SYSTEM AND WELFARE SOCIETY 61 CIVIL LINES NEAR ISLAMIYA GIRLS INTER COLLEGE BAREILLY 243001
1070 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
1071 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
1072 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
1073 EDU INSTITUTE ADDRESS
1074 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
1075 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
1076 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
1077 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
1078 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
1079 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
1080 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
1081 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
1082 EKLAVYA DEVELOPMENT SOCIETY VILLAGE POST-KANTOLI TEHSIL- MALPURA DISTRICT-TONK RAJASTHAN 304502
1083 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
1084 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
1085 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
1086 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
1087 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
1088 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
1089 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
1090 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
1091 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
1092 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
1093 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
1094 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
1095 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1096 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1097 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
1098 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
1099 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
1100 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
1101 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
1102 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
1103 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
1104 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
1105 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
1106 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
1107 ERAM TECHNOLOGIES PVT LTD III FLOOR, INKEL TOWER, ANGAMALY
1108 ERAM TECHNOLOGIES PVT LTD III FLOOR INKEL TOWER, ANGAMALY SOUTH PO, NEAR TELK ANGAMALY
1109 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1110 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1111 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1112 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1113 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1114 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1115 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1116 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1117 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1118 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1119 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1120 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1121 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1122 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1123 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1124 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1125 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1126 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1127 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1128 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1129 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1130 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1131 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1132 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1133 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1134 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY SHOP 1 NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1135 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1136 EXPERT SKILL DEVELOPMENT PRIVATE LIMITED 163 C BLOCK NEW MANDI SIRSA ( HARYANA )
1137 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1138 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1139 FAANS CONSULTANTS PVT LTD C#6,LIGHT HOUSE HILL ROAD,OPPOSITE KASTHURBA MEDICAL COLLEGE,HAMPANKATTA
1140 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1141 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1142 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1143 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1144 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1145 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1146 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1147 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1148 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1149 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1150 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1151 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1152 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1153 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1154 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1155 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1156 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1157 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1158 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1159 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1160 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1161 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1162 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1163 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1164 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1165 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1166 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1167 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1168 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1169 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1170 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1171 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1172 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1173 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1174 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1175 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1176 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1177 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1178 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1179 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1180 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1181 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1182 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1183 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1184 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1185 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1186 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1187 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1188 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1189 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1190 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1191 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1192 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1193 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1194 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1195 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1196 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1197 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1198 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1199 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1200 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1201 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1202 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1203 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1204 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1205 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1206 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1207 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1208 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1209 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1210 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1211 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1212 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1213 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1214 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1215 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1216 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1217 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1218 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1219 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1220 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1221 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1222 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1223 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1224 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1225 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1226 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1227 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1228 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1229 GARV SHIKSHAN SANSTHA PURAI BHILAI
1230 GARV SHIKSHAN SANSTHA MALVIYA NAGAR DURG PURAI, UTAI, BHILAI
1231 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1232 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1233 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1234 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1235 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1236 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1237 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1238 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1239 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1240 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1241 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1242 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1243 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1244 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1245 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1246 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1247 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1248 GENUINESOFT ST.HINDUCOLLEGE ROAD
1249 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1250 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1251 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1252 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1253 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1254 GET SOURCE EDUCATION PRIVATE LIMITED 324-C,MODEL TOWN
1255 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1256 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1257 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1258 GFHDYHDBAH VSGYCGDHFGSDY
1259 GFHDYHDBAH QSDWEFWE
1260 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1261 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1262 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1263 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1264 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1265 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1266 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1267 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1268 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1269 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1270 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1271 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1272 GK FOUNDATION 36/B KALKAJI NEW DELHI
1273 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1274 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1275 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1276 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1277 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1278 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1279 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1280 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1281 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1282 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1283 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1284 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1285 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1286 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1287 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX, DAKBANGLOW CHOWK, OPP.PUNJAB & SINDH BANK, PATNA - 1
1288 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX,DAKBANGLOW CHOWK,OPP. PUNJAB & SINDH BANK, PATNA - 1
1289 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY PARIJAT COMPKEX, 1ST FLOOR,OPP - PUNJAB & SINDH BANK, DAKBUNGLOW CHOWK, PATNA, BIHAR
1290 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1291 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1292 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1293 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1294 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1295 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1296 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE, RAMBAGH ROAD, MUZAFFARPUR BO: 2ND FLOOR, MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1297 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1298 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1299 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1300 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1301 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1302 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1303 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1304 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1305 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1306 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1307 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101,
1308 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1309 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1310 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1311 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1312 GLOWDOWN SERVICES PRIVATE LIMITED MADHUKUNI, 2 FLOOR, BANK COLONEY, NEAR UNION BANK OF INDIA
1313 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1314 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1315 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1316 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1317 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1318 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1319 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1320 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1321 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1322 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1323 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1324 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1325 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1326 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1327 GOPAL KIRAN SIKSHA AVAM SANSKRITIK SAMITI NIMRAJE SADAN, NEW MOHAN NAGAR, THATIPUR
1328 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1329 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1330 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1331 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1332 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1333 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1334 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1335 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1336 GOYAL CREATION PVT LTD OFFICE A-150(B),AMBAJI INDUSTRIAL AREA.SANTPUR,ABUROAD
1337 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1338 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1339 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1340 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1341 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1342 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1343 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1344 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1345 GRAMDEEP MADHUBANI GOSAITOLA, PO - RAGHOPUR BLAT, VIA- RAMPATTI, DIST.- MADHUBANI, BIHAR
1346 GRAMDEEP MADHUBANI VILL - GOSAITOL, POST - RAGHOPURBALAT,VIA - RAMPATTI, DIST. - MADHUBANI, BIHAR.
1347 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1348 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1349 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1350 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1351 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR
1352 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR, GUJARAT-384315
1353 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1354 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1355 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1356 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1357 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1358 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1359 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1360 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1361 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD, NEAR KOTWALI, SAHARA INDIA 02ND FLOOR, MOHALLA- MULIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1362 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD NEAR KOTWALI SAHARA INDIA OFFICE 02ND FLOOR, MOHALLA- MURLIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1363 GRAMIN VIKAS SEWA SAMITI MOHALLA- SHAKITI NAGAR POST- GANDHI NAGAR DISTRICT- BASTI, UTTAR PRADESH
1364 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1365 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1366 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1367 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1368 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1369 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1370 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1371 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1372 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1373 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1374 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1375 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1376 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1377 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1378 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1379 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1380 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1381 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1382 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1383 GREEN INDIA FOUNDATIONAL TRUST 4/66-1 SUMANGALINAGAR, PURATHAUDI, TRICHY.
1384 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1385 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1386 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1387 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1388 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1389 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1390 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1391 GROWTH FOUNDATION OF INDIA L-46A, MALVIYA NAGAR NEW DELHI-110017
1392 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1393 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1394 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1395 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1396 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1397 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1398 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1399 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1400 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1401 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1402 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1403 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1404 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1405 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1406 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1407 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1408 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1409 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1410 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1411 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1412 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1413 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1414 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1415 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1416 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1417 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1418 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1419 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1420 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1421 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
1422 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1423 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1424 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
1425 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1426 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1427 GYAN KALP CHARITABLE TRUST INDIC HEIGHTS, AT/PO-MUKTAPUR, KHORDHA
1428 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1429 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1430 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1431 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1432 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1433 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1434 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
1435 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1436 HANKER SOLUTIONS PVT LTD B610, LOGIX TECHNOVA, SECTOR 132, NOIDA
1437 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1438 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1439 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1440 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1441 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1442 HARIBALA TRUST 2/173,HARIBALA ILLAM, T PUDUR, SIVAGANGAI TAMILNADU
1443 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1444 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1445 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1446 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1447 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1448 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1449 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1450 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1451 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1452 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1453 HARSH PVT LTD SDFAAFDSSDF
1454 HARYANA ESTATE SOLUTIONS HARYANA ESTATE SOLUTIONS,SHOP NO.-1,GROUND FLOOR,NEAR FOOD HUB SEC 37,MAIN SECTOR ROAD,BASAI ENCLAVE EXTN. ,GURGAON 122001
1455 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1456 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1457 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1458 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1459 HEAD HELD HIGH FOUNDATION VILLA 21-22, PALM MEADOWS, PHASE-1, RAMAGONDANAHALLI, WHITEFILED ROAD, BANGALORE
1460 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
1461 HEAD HELD HIGH FOUNDATION NO.22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1462 HEAD HELD HIGH FOUNDATION 22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1463 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1464 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1465 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1466 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1467 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1468 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1469 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1470 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
1471 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1472 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1473 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1474 HELPING HAND WELFARE SOCIETY REG.OFFICE VILL SARSOPAR POST BHUSWAL BU DIST GORAKHPUR 273403 HEAD OFFICE- BHITAHA, KAURIRAM GORAKHPUR-273413
1475 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
1476 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1477 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1478 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1479 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1480 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1481 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
1482 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
1483 HEWTECH SYSTEM C-2, JAIPRAKASH NAGAR ASHIYANA, PATNA, BIHAR
1484 HGXDNG CBGNCBNMCNFMHXFVM
1485 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1486 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1487 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1488 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1489 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1490 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1491 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1492 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1493 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1494 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1495 HINDUSTANI TANZEEM FROGHE ILMOFUN FLAT NO. 202, KALYANI COMPLEX, LANGERTOLI CHAURAHA, PATNA - 800004
1496 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1497 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
1498 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1499 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1500 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1501 HIREEX CAREER SOLUTIONS SHOP NO 1 AND 2 KAPEESH MALL, M G ROAD MULUND WEST MUMBAI 400080
1502 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1503 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1504 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1505 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1506 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
1507 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1508 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1509 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1510 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1511 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1512 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1513 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1514 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1515 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1516 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1517 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1518 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1519 HSADALO FFSE
1520 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1521 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1522 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1523 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1524 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
1525 HUMANITY WELFARE SOCIETY 860/22, LANE NO. 2 AMBA VIHAR MUZAFFARNAGAR
1526 HUMANITY WELFARE SOCIETY 860/22, LANE NO.2, AMBA VIHAR MUZAFFARNAGAR
1527 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1528 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1529 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1530 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1531 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
1532 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1533 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1534 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1535 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1536 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1537 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1538 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1539 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1540 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1541 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1542 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1543 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1544 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
1545 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1546 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1547 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
1548 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
1549 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1550 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1551 ICTPMU DDUGKY TEST NEW DELHI
1552 ICTPMU TEST11 NEW DELHI110001
1553 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1554 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1555 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1556 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1557 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1558 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1559 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1560 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1561 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1562 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1563 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1564 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1565 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1566 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1567 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1568 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1569 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1570 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1571 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1572 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1573 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1574 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1575 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1576 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1577 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1578 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1579 IMPULSIVE SOCIAL AWARENESS COMMITTEE WARD NO 02 JAWALAMUKHI MOHLLA SIHORA DIST.JABALPUR M.P.
1580 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1581 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1582 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1583 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1584 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1585 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1586 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1587 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1588 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1589 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1590 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1591 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1592 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1593 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1594 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1595 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1596 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1597 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1598 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1599 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1600 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1601 INDIAN MEDICAL TRUST NIMS UNIVERSITY DELHI JAIPUR HIGHWAY JAIPUR
1602 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
1603 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1604 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
1605 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
1606 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1607 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1608 INDO AMERICAN FRIENDS GROUP TEHSIL ROAD , SALON , RAEBARELI , UTTERPRADESH
1609 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1610 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1611 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1612 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1613 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5003 PHASE-4,GIDC,VATVA MEHMDABAD ROAD,AHMEDABAD-382445 GUJARAT
1614 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5000/ PHASE - 4 GIDC, VATVA, MEHMEDABAD ROAD, AHMEDABAD, GUJARAT
1615 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1616 INDOSYS WELFARE SOCIETY OPP. UNIVERSITY CAMPUS, TALWANDI SABO
1617 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1618 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1619 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1620 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1621 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1622 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1623 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1624 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1625 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1626 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1627 INDUS FOUNDATION 156-GA, UMAR PUR NIWA, NEAE NEHRU PARK,DHOOMANGANJ, ALLAHABAD,U.P.-211001, INDIA
1628 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1629 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1630 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1631 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1632 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1633 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
1634 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1635 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
1636 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1637 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1638 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1639 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1640 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1641 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1642 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED, 21-1-60, 3RD FLOOR JANDYALA VAARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA, TENALI - 522201, GURNTUR DISTRICT, ANDHRA PRADESH, INDIA
1643 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED 21-1-60,3RD FLOOR JANDYALA VARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA,TENALI
1644 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR, 21ST. CENTURY PLAZA, SECTOR 8 COMM. CENTRE, ROHINI, DELHI
1645 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR 21ST. CENTURY PLAZA, SECTOR 8 COMM CENTRE, NEAR ICICI BANK ROHINI, DELHI
1646 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1647 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1648 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1649 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1650 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1651 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1652 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1653 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1654 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1655 INSTITUTE OF ENVIRONMENT AND ECO DEVELOPMENT SHYAM NAGAR COLONY, MAURYAPATH, P.O.- B.V.COLLEGE, KHAJPURA, PATNA(BIHAR)
1656 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1657 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1658 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
1659 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
1660 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
1661 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
1662 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
1663 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
1664 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
1665 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
1666 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
1667 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
1668 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
1669 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
1670 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
1671 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
1672 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
1673 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
1674 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
1675 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
1676 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
1677 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
1678 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
1679 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
1680 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
1681 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1682 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1683 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
1684 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
1685 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
1686 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
1687 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
1688 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
1689 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
1690 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
1691 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
1692 ISHAN JAN SEVA SANSTHAN K-206,YASHODA NAGAR,KANPUR
1693 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
1694 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
1695 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
1696 ISTI EDUCATION PRIVATE LIMITED E-15, BASEMENT, LAJPAT NAGAR-I, NEW DELHI
1697 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
1698 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
1699 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
1700 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
1701 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
1702 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
1703 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
1704 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
1705 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
1706 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
1707 JAGANNATH GUPTA FAMILY TRUST NISCHINTAPUR, BUDGE BUDGE
1708 JAGAN RAJ PROFESSIONAL STUDIES PVT LTD 223,PRATAP NAGAR HOUSING SOCIETY,VASHISHATH MARG,VAISHALI NAGAR,JAIPUR,RAJ.
1709 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
1710 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
1711 JAGO GAON VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR
1712 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
1713 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1714 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1715 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1716 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
1717 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
1718 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
1719 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
1720 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
1721 JAHNAVI TECHNICAL EDUCATIONAL SOCIETY JAHNAVI INSTITUTE OF MULTIMEDIA TECHNOLOGY C/O JAHNAVI DIGITAL STUDIO, BRIDGE ROAD, NEAR 7 ROAD JUNCTION, OPP : SBI ATM, SRIKAKULAM-532001 ANDHRA PRADESH
1722 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
1723 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
1724 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1, GOMTINAGAR
1725 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
1726 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
1727 JAIN COMPUTER ACADEMY SAMITI WARD NO 01 MAHATMA GANDHI WARD BANDA BELAI
1728 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
1729 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
1730 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
1731 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
1732 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
1733 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
1734 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
1735 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
1736 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
1737 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
1738 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1739 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1740 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
1741 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1742 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1743 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
1744 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
1745 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
1746 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
1747 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
1748 JAN KALYAN SAMITI JAIN
1749 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
1750 JAN KALYAN SHIKSHA SAMITI A-1413/3
1751 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
1752 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
1753 JANKI DEVI EDUCATIONAL WELFARE SOCIETY 74/35, RAJPUR ROAD, OPP. HOTEL MADHUBAN DEHRAUN
1754 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
1755 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
1756 JAN SAHARA SARAI VILL + PO- SARAI, PS - MANER, DIST - PATNA
1757 JAN SAHARA SARAI VILL + PO - SARAI,PS - MANER, DIST- PATNA
1758 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
1759 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
1760 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
1761 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
1762 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
1763 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1764 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
1765 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
1766 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1767 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
1768 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
1769 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
1770 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
1771 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
1772 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
1773 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
1774 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
1775 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
1776 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
1777 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
1778 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1779 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1780 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
1781 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
1782 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
1783 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
1784 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
1785 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
1786 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
1787 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
1788 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
1789 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1790 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1791 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU, KOZHIKODE.
1792 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE,JAMIATH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
1793 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
1794 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
1795 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
1796 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1797 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1798 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
1799 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
1800 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
1801 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
1802 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
1803 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
1804 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
1805 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
1806 JEEVANTI SEWA SAMITI 9, CIVIL LINES VIDISHA
1807 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
1808 JFJGF 9ODPJ
1809 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
1810 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
1811 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
1812 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
1813 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
1814 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
1815 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
1816 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
1817 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI
1818 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
1819 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
1820 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
1821 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
1822 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1823 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1824 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
1825 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1826 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1827 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1828 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1829 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
1830 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
1831 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
1832 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1833 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1834 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
1835 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
1836 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
1837 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
1838 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
1839 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
1840 JUPITER CRAFTS PLOT NO 55 – A, E.P.I.P., PHASE I, JHARMAJRI,BADDI,DISTT-SOLAN, HIMACHAL PRADESH
1841 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
1842 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
1843 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
1844 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1845 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1846 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1847 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1848 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1849 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1850 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
1851 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
1852 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING 3RD FLOOR, ZODIN SQUARE
1853 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
1854 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
1855 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
1856 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
1857 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
1858 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1859 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1860 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1861 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
1862 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1863 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1864 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
1865 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
1866 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
1867 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
1868 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
1869 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
1870 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
1871 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
1872 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
1873 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
1874 KALVI INSTITUTE PRIVATE LIMITED NO.9-1-66, DOUBLE AGRAHARAM STREET, SHOLAVANDAN, MADURAI, TAMIL NADU - 625214
1875 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1876 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1877 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
1878 KALYANSUNDARAM WELFARE AND EDUCATIONAL TRUST G01, VASUDEO CITY,RAJENDRA PATH, BENI BABU KA BAGAICHA,NEAR ASHIYANA HYUNDAI SHOWROOM, PATNA BIHAR
1879 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
1880 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
1881 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
1882 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1883 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
1884 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1885 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
1886 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
1887 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
1888 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
1889 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
1890 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED HOUSE NO-15,PLOT NO-1149,GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA
1891 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
1892 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
1893 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
1894 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
1895 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
1896 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GHALIB GHS, PITAMPURA NEW DELHI
1897 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GROUND FLOOR GHALIB APARTMENT PITAMPURA NEW DELHI
1898 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1899 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1900 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
1901 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1902 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
1903 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
1904 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
1905 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
1906 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
1907 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
1908 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
1909 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
1910 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
1911 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
1912 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1913 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1914 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
1915 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
1916 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
1917 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
1918 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
1919 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
1920 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
1921 KASHA GOUD EDUCATIONAL SOCIETY VINAYAKA NAGAR NIZAMABAD
1922 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
1923 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
1924 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
1925 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
1926 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
1927 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
1928 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
1929 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1930 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1931 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1932 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
1933 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
1934 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
1935 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
1936 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
1937 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
1938 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
1939 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
1940 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
1941 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
1942 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
1943 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
1944 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1945 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1946 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1947 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1948 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1949 KAYZEY SOCIETY MAWNGAP MAWSMAI
1950 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
1951 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
1952 KENDRIYA BHANDER B-1 SHYAMALI HOUSING ESTATE, SALT LAKE CITY, KOLKTA
1953 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
1954 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
1955 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
1956 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
1957 KGVK NEORI VIKAS RUKKA RANCHI
1958 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
1959 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
1960 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
1961 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
1962 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
1963 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
1964 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
1965 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
1966 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
1967 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
1968 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
1969 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
1970 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
1971 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
1972 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
1973 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1974 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1975 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
1976 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
1977 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
1978 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
1979 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
1980 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
1981 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
1982 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
1983 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
1984 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
1985 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
1986 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
1987 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
1988 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
1989 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
1990 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
1991 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
1992 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
1993 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
1994 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
1995 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
1996 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
1997 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
1998 KOMAL CONSTRACTION COMPANY MAIN BAZAR ROAD, DANTA, TEHSIL DANTARAMGARH,DIST. SIKAR RAJSTHAN PIN 332701
1999 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
2000 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
2001 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
2002 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
2003 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
2004 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
2005 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2006 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
2007 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2008 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
2009 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
2010 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
2011 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
2012 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
2013 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
2014 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
2015 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
2016 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
2017 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
2018 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
2019 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
2020 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
2021 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
2022 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
2023 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
2024 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
2025 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
2026 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
2027 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
2028 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
2029 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
2030 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
2031 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
2032 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2033 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2034 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
2035 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
2036 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2037 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2038 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
2039 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
2040 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
2041 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
2042 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
2043 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
2044 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
2045 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
2046 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
2047 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
2048 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
2049 LAL BAHADUR SHIKSHA SAMITI KATKAR TEHSIL HINDAUN, DIST. KARAULI, RAJSTHAN PINCODE 322234
2050 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
2051 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
2052 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UTTAR PRADESH
2053 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UP, INDIA
2054 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
2055 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
2056 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2057 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2058 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
2059 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
2060 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
2061 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2062 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2063 LBS LNS HBJHCDJNSJBSBCANM
2064 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
2065 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
2066 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
2067 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
2068 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
2069 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
2070 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
2071 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
2072 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
2073 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
2074 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
2075 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
2076 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
2077 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
2078 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
2079 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
2080 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
2081 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
2082 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD.
2083 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
2084 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
2085 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
2086 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
2087 LIGHTNING INDIA FOUNDATION FOR EXCELLENCE GIRDHARI NAGAR, JAROTHI ROAD NEAR BHARAT GAS GODOWN HAPUR UTTAR PRADESH
2088 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
2089 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2090 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2091 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
2092 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2093 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
2094 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
2095 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2096 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
2097 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
2098 LITCHITREE SKILLS AND SOLUTIONS PVT LTD MIG(S)-1,PRAGATI ENCLAVE,NEAR ST.XAVIAR HIGH SCHOOL,BHUBANESWAR
2099 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
2100 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
2101 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
2102 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
2103 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
2104 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA.
2105 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA
2106 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
2107 LOK SEVA KENDRA VILL - KARPI, KARPI SHERPUR MAIN ROAD, PO.- KARPI, DIST.- ARWAL, BIHAR
2108 LOK SEVA KENDRA VILL - KARPI SHERPUR MAIN ROAD, ARWAL, BIHAR.
2109 LOK SEVA KENDRA VILL KARPI, SHERPUR ROAD,DIST.- ARWAL, BIHAR
2110 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
2111 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
2112 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
2113 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
2114 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
2115 LOYAL ENVIRONMENTAL AWARENESS AND PROTECTION SOCIETY 115,116,PUDUCHERRY IT PARK, PEC CAMPUS,PILLAICHAVADY,ECR ROAD, PUDUCHERRY -605014
2116 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
2117 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
2118 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
2119 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
2120 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
2121 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
2122 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
2123 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
2124 LUIT VALLEY ENGINEERING PRIVATE LIMITED H. NO. 51 & 52, M. E. ROAD, BYE LANE 01, PALTAN BAZAR, GUWAHATI 781008 ASSAM, INDIA
2125 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2126 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2127 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2128 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
2129 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
2130 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
2131 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2132 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2133 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
2134 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
2135 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
2136 MAA PURNAGIRI JAN KALYAN SAMITI H.NO.-3 VANGOAN NITHOLI ROAD (NEAR OM SWEET BHANDHAR) ETAH U.P
2137 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
2138 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
2139 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
2140 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
2141 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2142 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2143 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
2144 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
2145 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
2146 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
2147 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
2148 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST, CUDDALORE.
2149 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
2150 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
2151 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2152 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2153 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
2154 MAGNUM SUPER DISTRIBUTORS INDIA PRIVATE LIMITED KALANIKETAN - I, VAISHALI NAGAR, KOTRA SULTANABAD, BHOPAL
2155 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
2156 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
2157 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
2158 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2159 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2160 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
2161 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2162 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2163 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
2164 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
2165 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
2166 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
2167 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
2168 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
2169 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
2170 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
2171 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
2172 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
2173 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
2174 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2175 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2176 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2177 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
2178 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
2179 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
2180 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
2181 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
2182 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
2183 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
2184 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2185 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
2186 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2187 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2188 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2189 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
2190 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
2191 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
2192 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
2193 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2194 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
2195 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2196 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2197 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
2198 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
2199 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
2200 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
2201 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
2202 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
2203 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
2204 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
2205 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
2206 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
2207 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
2208 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
2209 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2210 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2211 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
2212 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
2213 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2214 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2215 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
2216 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
2217 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2218 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2219 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
2220 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
2221 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
2222 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
2223 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2224 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2225 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
2226 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
2227 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
2228 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
2229 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
2230 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
2231 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
2232 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
2233 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
2234 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V-EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2235 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
2236 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
2237 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
2238 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
2239 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
2240 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
2241 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
2242 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
2243 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
2244 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
2245 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2246 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2247 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
2248 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
2249 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
2250 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
2251 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
2252 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
2253 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
2254 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
2255 MAS CALLNET INDIA PRIVATE LIMITED A-94/10 SECTOR-58 NOIDA
2256 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
2257 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
2258 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
2259 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
2260 MATA KITAB KAUR MEMORIAL WELFARE SOCIETY OPPOSITE ITI,SURATGHAR ROAD, HANUMANGHAR JN. RAJSTHAN
2261 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
2262 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
2263 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITI SUNHERA ROAD SABALGARH MORENA M.P.
2264 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
2265 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
2266 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
2267 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
2268 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
2269 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
2270 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2271 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2272 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
2273 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
2274 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
2275 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
2276 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
2277 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
2278 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
2279 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
2280 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
2281 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2282 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2283 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET
2284 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
2285 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
2286 MEDIWORLD EDUCATIONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEW DELHI
2287 MEDIWORLD EDUCATIOONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEAR FATHER AGNEL SCHOOL
2288 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
2289 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
2290 MEERA INSTITUTE OF TECHNOLOGY AND MANAGEMENT PRIVATE LIMITED 538/5-C, BANKERS COLONY JHANSI
2291 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
2292 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
2293 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
2294 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
2295 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
2296 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2297 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
2298 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2299 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
2300 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
2301 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
2302 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
2303 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
2304 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
2305 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
2306 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
2307 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
2308 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
2309 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
2310 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
2311 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2312 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2313 METORES ISPAT PRIVATE LIMITED METORES ISPAT PRIVATE LIMITED, O-12, CIVIL TOWNSHIP, ROURKELA ORISSIA
2314 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
2315 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2316 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2317 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
2318 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
2319 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
2320 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
2321 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
2322 MIDNAPUR UNIQUE EDUCARE EDUCATIION WELFARE SOCIETY VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
2323 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
2324 MIGS EDUCTECH PRIVATE LIMITED A-86, DDA SHED, OKHLA INDUSTRIAL AREA, PHASE-2, NEW DELHI
2325 MILE MULTIMURPOSE FOUNDATION WARDHA
2326 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
2327 MILKY FASHION CLOTHES PRIVATE LIMITED B-68, CHANAKYA PLACE, JANAKPURI, DELHI
2328 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
2329 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
2330 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
2331 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
2332 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
2333 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
2334 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
2335 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
2336 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
2337 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
2338 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
2339 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
2340 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
2341 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
2342 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2343 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2344 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2345 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2346 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
2347 MITR PROMOTERS PRIVATE LIMITED 139,NOBEL ENCLAVE,SECTOR-22,BEHIND ROTARY PUBLIC SCHOOL,GURGAON,HARYANA-122001.
2348 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
2349 MMCC SKILL FOUNDAION S.C.O-192,195 SECTOR-16
2350 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
2351 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
2352 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
2353 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
2354 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2355 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
2356 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2357 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2358 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2359 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
2360 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
2361 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
2362 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
2363 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
2364 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
2365 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
2366 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
2367 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
2368 MOHAMMADIA EDUCATIONAL AND WELFARE SOCIETY CHAND COLONY, POST PHULWARI SHARIF, DIST PATNA BIHAR 801505
2369 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
2370 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
2371 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
2372 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
2373 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
2374 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
2375 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
2376 MORD TEST ND
2377 MORD TEST1 SBJFLJ
2378 MORD TEST2 ADVCDS
2379 MORD TEST NEW DELHI ND
2380 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
2381 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
2382 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
2383 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
2384 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2385 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2386 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
2387 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
2388 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
2389 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
2390 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
2391 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
2392 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
2393 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
2394 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
2395 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
2396 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2397 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
2398 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2399 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
2400 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2401 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
2402 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
2403 MS POPULAR AGENCIES 60 B/69B, HEWETT ROAD, ALLAHABAD
2404 MS RAJ ASSOCIATES B1/181, VINEET KHAND, GOMTINAGAR, LUCKNOW (U.P.)
2405 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
2406 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
2407 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
2408 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
2409 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
2410 MUKTAI SHIKSHAN PRASARAK MANDAL PULUJWADI TAL-PANDHARPUR DIST-SOLAPUR
2411 MUKTI INDIA FOUNDATION A-105,FIRST FLOOR, ABOVE BANK OF INDIA , OPP. PILLOR NO 749, UTTAM NAGAR
2412 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
2413 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
2414 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
2415 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
2416 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
2417 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
2418 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
2419 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
2420 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
2421 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
2422 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
2423 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
2424 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
2425 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
2426 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
2427 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
2428 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
2429 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
2430 NANAK SINGH RAWAT SHIKSHA SAMITI C-2252, JAWAHAR NAGAR MHOW, TEHSIL MHOW DISTT. INDURE (M.P.)
2431 NANDI SHIKSHA AWAM SAMAJIK SANSTHAN BRAHMPURI COLONY,DEOBAND SAHARANPUR
2432 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
2433 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
2434 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
2435 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2436 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2437 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
2438 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
2439 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
2440 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
2441 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
2442 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
2443 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
2444 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
2445 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
2446 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
2447 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
2448 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2449 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2450 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION C/O MART INFOTECH COLLEGE ANANTNAG NEAR BUS STAND ANANTNAG
2451 NATIONAL EDUCATION AND WALFARE SOCIETY DEGLOOR NEAR BSNL TOWER,TEACHER COLONY,UDGIR ROAD,DEGLOOR DIST.NANDED
2452 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
2453 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
2454 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
2455 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
2456 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
2457 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
2458 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
2459 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
2460 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
2461 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
2462 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
2463 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
2464 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
2465 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
2466 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
2467 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
2468 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
2469 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
2470 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
2471 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
2472 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
2473 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
2474 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2475 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2476 NATIONAL WOMEN DEVELOPMENT TRUST 53 GRAMMASAVADI STREET CUMBUM
2477 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
2478 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
2479 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
2480 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
2481 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
2482 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO,66 B SENGALUNEARODAI STREET, KANCHIPURAM - 631502, TAMIL NADU
2483 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
2484 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2485 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2486 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
2487 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
2488 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
2489 NAVACHETHANA MALLAPPALLY INSTITUTE
2490 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
2491 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
2492 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2493 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2494 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2495 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
2496 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
2497 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
2498 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
2499 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
2500 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
2501 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
2502 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
2503 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
2504 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
2505 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2506 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2507 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2508 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
2509 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
2510 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
2511 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
2512 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2513 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2514 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
2515 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
2516 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
2517 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
2518 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
2519 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
2520 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
2521 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
2522 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
2523 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
2524 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
2525 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
2526 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
2527 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
2528 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
2529 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
2530 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
2531 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
2532 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
2533 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
2534 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
2535 NEST NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
2536 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
2537 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
2538 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
2539 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
2540 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
2541 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
2542 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
2543 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
2544 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
2545 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
2546 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
2547 NEW ERA EDUCATION DEVELOPMENT SOCIETY CO TARA INFOTECH NEAR PS BANK MALL GODOWN ROAD RAMPURA PHUL
2548 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
2549 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
2550 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
2551 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
2552 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
2553 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
2554 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
2555 NEW SIMBOL TAKNIKI PRASHIKSHAN SANSTHAN CIVIL LINE KATNI
2556 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
2557 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2558 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2559 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2560 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
2561 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
2562 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
2563 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
2564 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2565 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2566 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
2567 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
2568 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2569 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2570 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2571 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
2572 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
2573 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2574 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2575 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
2576 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
2577 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
2578 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
2579 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
2580 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
2581 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
2582 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
2583 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
2584 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
2585 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
2586 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2587 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2588 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2589 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
2590 NILANCHAL CHEMICAL AND FERTILIZERS LIMITED C/O RAM RADHIKA MAHAVIDHYALAY GRAM : - CHATIYA POST :- MEHRUNA LAR , SALEMPUR
2591 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
2592 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
2593 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
2594 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
2595 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
2596 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
2597 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
2598 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
2599 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
2600 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
2601 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
2602 NISHKAM SEWA SANSTHAN NEAR 101 NO. RAILWAY GETA, MERTA ROAD TAHSIL MERTA CITY DISTRICT NAGAUR
2603 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
2604 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
2605 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
2606 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2607 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2608 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
2609 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
2610 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
2611 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
2612 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
2613 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
2614 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2615 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2616 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
2617 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
2618 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
2619 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
2620 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
2621 NO EDUCATION RAVINDRA NAGAR RAIPUR
2622 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
2623 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
2624 NORTH EAST INSTITUTE FASHION TECHNOLOGY NEIFT,SECOND FLOOR,(NEXT TO SBI EVENING BRANCH) G.N.B. ROAD,GUWAHATI
2625 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
2626 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
2627 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
2628 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
2629 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
2630 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
2631 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
2632 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
2633 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
2634 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
2635 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
2636 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
2637 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
2638 NRLM SKILLS SAMRAT,CHANKYAPURI
2639 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
2640 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
2641 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
2642 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2643 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2644 NST ACADEMY REGD OFFICE : NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2645 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
2646 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2647 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2648 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2649 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
2650 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2651 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2652 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2653 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
2654 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2655 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
2656 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
2657 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
2658 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
2659 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
2660 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
2661 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
2662 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
2663 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
2664 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
2665 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
2666 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2667 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2668 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2669 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
2670 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
2671 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
2672 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
2673 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
2674 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
2675 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
2676 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
2677 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
2678 OM SAI CONTRUCTION OM SAI CONSTRUCTION 61/2 MAHAVEER CHOWK NARAYANPUR CHHATTISGARH
2679 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
2680 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
2681 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
2682 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
2683 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
2684 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
2685 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
2686 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
2687 ONEWAY SKILL MANAGEMENT AND TECHNOLOGY PRIVATE LIMITED FLAT NO. 1645-A DHANAS CHANDIGARH
2688 ONFIELDIN PRIVATE LIMITED #16, ANJANAVILAS, S.R. LAYOUT, SRIRAMPURA - II STAGE, MYSORE - 570023
2689 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
2690 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
2691 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
2692 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
2693 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
2694 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2695 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2696 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2697 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2698 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2699 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
2700 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
2701 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
2702 ORION TRUST SAGOLBAND THINGOM LEIKAI
2703 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
2704 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
2705 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2706 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
2707 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2708 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2709 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2710 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
2711 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2712 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2713 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
2714 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
2715 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
2716 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
2717 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
2718 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
2719 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
2720 OVER AIR TECHNOLOGIES PRIVATE LIMITED #2385, SECTOR-22C, CHANDIGARH
2721 OVER AIR TECHNOLOGIES PRIVATE LIMITED S.C.O-84/1, SECTOR-58, SHAHI MAJRA MOHALI
2722 OXFORD SHIKHHA PRASAR SANSTHAN TIWARIYAN CHHIBRAMAU, KANNAUJ U.P.
2723 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI U.P. IN CODE-262701
2724 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
2725 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
2726 OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI
2727 OXYGEN INSTITUTE ASE OXYGEN INSTITUTE ASE SETH COLONY ARJUNPURWA
2728 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
2729 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
2730 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
2731 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
2732 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
2733 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
2734 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2735 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2736 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
2737 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
2738 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
2739 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
2740 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
2741 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
2742 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
2743 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
2744 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
2745 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2746 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2747 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
2748 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
2749 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
2750 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
2751 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
2752 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
2753 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
2754 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
2755 PANSI TECHNOLOGIES 101,PANSI HOUSE,NEAR BY PARYAG SOCIETY BUILDING,LOKDHARA KALYAN (E), TISGAON RD, LOKGRAM, KALYAN, MAHARASHTRA 421306
2756 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
2757 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
2758 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2759 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2760 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
2761 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
2762 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
2763 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
2764 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2765 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2766 PARAS SPORTS AND EDUCATIONAL SOCIETY J.K BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2767 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
2768 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
2769 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
2770 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
2771 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
2772 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
2773 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
2774 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
2775 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
2776 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
2777 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
2778 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
2779 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
2780 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
2781 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
2782 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
2783 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
2784 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
2785 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
2786 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
2787 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
2788 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
2789 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, DAALNWALA
2790 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, OPP. GURUDWARA, DEHRADUN
2791 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
2792 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
2793 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
2794 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
2795 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
2796 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
2797 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
2798 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
2799 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
2800 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
2801 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
2802 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
2803 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
2804 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
2805 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
2806 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
2807 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
2808 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
2809 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
2810 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
2811 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
2812 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
2813 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
2814 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
2815 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
2816 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
2817 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
2818 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
2819 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
2820 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
2821 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
2822 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
2823 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
2824 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
2825 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
2826 PLAN TO EMPOWER F 13/17 B, TF JOGA BAI EXTEN. JAMIA NAGAR OKHLA, NED DELHI
2827 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
2828 PLEASE DELETE TEST APPLICATION TEST IN TEST
2829 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
2830 PLUSTRUST FLAT NO 101, SRI SABARI RESIDENCY, 11-3-397, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD
2831 PLUSTRUST 101, SRI SABARI RESIDENCY, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD.
2832 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
2833 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
2834 POLYVALENT CONSULTING PVT LTD KAKADEO,PLOT NO.-117/L/248, NAVEEN NAGAR, KANPUR
2835 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
2836 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
2837 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
2838 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
2839 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
2840 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
2841 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
2842 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
2843 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
2844 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
2845 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2846 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
2847 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
2848 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
2849 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
2850 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
2851 PRAKALPGRAST KALYANKARI SAMITEE GONDIAS JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA-441601 (MS)
2852 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
2853 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
2854 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
2855 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
2856 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2857 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2858 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2859 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
2860 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
2861 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2862 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2863 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2864 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
2865 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
2866 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
2867 PRATAP SEWA SAMITI GOMATI NAGAR PANCHO PEERAN SULTANPUR
2868 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
2869 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
2870 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
2871 PRATHYAK SERVICES PRIVATE LIMITED F-16, RING ROAD, ADIL NAGAR LUCKNOW
2872 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
2873 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
2874 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
2875 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
2876 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
2877 PREM KUNJ CONSTRUCTION AND ENGG PVT LTD 2 KATEWA NAGAR EXT.,GUJAR KI THARI , NEW SANGANER ROAD JAIPUR
2878 PREMLILA VITHALDAS POLYTECHNIC SNDT WOMENS UNIVERSITY MUMBAI PREMLILA VITHALDAS POLYTECHNIC SIR VITHALDAS VIDYAVIHAR, JUHU ROAD, SANTACRUZ (WEST), MUMBAI-400 049. TELEPHONE: 26608676, 26608493, 26608462, 26606648 EXTN. 253 EMAIL: PVP@PVPSNDT.ORG, PRINCIPAL@PVPSNDT.ORG
2879 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
2880 PRERANA RUGUDIPARA BALANGIR ODISHA
2881 PRERANA RUGUDIPARA BALANGIR
2882 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
2883 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2884 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2885 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2886 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2887 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2888 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2889 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2890 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY, ANANTAPUR(V) ANANTAPUR(M) ANANTAPUR (D) ANHRAPRADESH
2891 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY ANANTAPUR (V&M) ANANTAPUR(D) A.P
2892 PRINCIPAL GOVERNMENT INDUSTRIAL TRAINING INSTITUTE ROPAR NANGAL ROAD, ROPAR
2893 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10 HUDA PARK,NEAR NEW BUS STAND KURUKSHETRA
2894 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
2895 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
2896 PRIX AUTOMATION BASEMENT, SEHRAWAT BHAWAN, OPP. SARASWATI MAHILA COLLEGE, PALWAL, HARYANA
2897 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
2898 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING., DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR, DIST-AHMEDNAGAR
2899 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING, DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR
2900 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
2901 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
2902 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
2903 PRIYA GRIH UDYOG VIKAS AVAM SHIKSHA PRASAR SAMITEE N7/48 R-11 PATEL NAGAR CHHOTIBHIKHARIPUR D.L.W VARANASI
2904 PRIYANKA URBAN AND RURAL DEVELOPMENT ORGANIZATION NO.8 6TH MAIN ROAD NEAR GANGAMMA TEMPLE GANGANAGAR R T NAGAR POST BANGALORE
2905 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
2906 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
2907 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
2908 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2909 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2910 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
2911 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
2912 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS DOOR NO 30/348 BALAJINAGAR DHARMAVARAM ANANTAPUR (D) ANDHRAPRADESH (S)
2913 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
2914 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
2915 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
2916 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, NEAR M.J.D. GOVT P.G. COLLEGE, TARANAGAR
2917 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
2918 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
2919 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2920 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2921 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
2922 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
2923 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
2924 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
2925 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
2926 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
2927 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
2928 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
2929 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
2930 PSLMM DG
2931 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
2932 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2933 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
2934 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
2935 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
2936 PUB BARPETA SOCIAL WELFARE SOCIETY VILL- MAZDIA , P.O- PACHIM MAZDIA, P.S- SARTHEBARI, DIST- BARPETA, ASSAM.
2937 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
2938 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
2939 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
2940 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
2941 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2942 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2943 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2944 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
2945 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
2946 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
2947 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
2948 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
2949 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
2950 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
2951 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
2952 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2953 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2954 QUANTUM GLOBAL INFRATECH LTD N1 / 150, IRC VILLAGE, NAYAPALLI, BHUBANESHWAR, ODISHA
2955 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
2956 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
2957 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
2958 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
2959 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
2960 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
2961 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
2962 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
2963 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
2964 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
2965 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2966 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2967 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
2968 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2969 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2970 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
2971 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2972 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
2973 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2974 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
2975 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
2976 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2977 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
2978 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
2979 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
2980 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2981 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2982 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2983 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
2984 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
2985 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
2986 RAJASTHAN SHIKSHAN PARSHIKSHAN SANSTHAN 77 VIDHYA VIHAR, BEHIND CHETALI ENCLAVE, 5 E CHHOTI
2987 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
2988 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
2989 RAJDHANI EDUTECH ENTERPRISES EW-07,INDRAPRASTH RDA COLONY,RAIPURA,RAIPUR,CHHATISGARH
2990 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
2991 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P) - 226001
2992 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHIITWAPUR ROAD, LALKUAN, HUSSAINGANJ, LUCKNOW (U.P) - 226001
2993 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
2994 RAJEEV INDUSTRIAL TRAINING AND RESEARCH INSTITUTE 22(A), STATION ROAD OPPOSITE VIKAS DEEP BUILDING,HUSAIN GANJ LUCKNOW
2995 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
2996 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
2997 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
2998 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
2999 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
3000 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
3001 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
3002 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
3003 RAJ SHREE 787
3004 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
3005 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
3006 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
3007 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
3008 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
3009 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
3010 RAM MORADABAD
3011 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
3012 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
3013 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
3014 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
3015 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
3016 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
3017 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
3018 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
3019 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
3020 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
3021 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
3022 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
3023 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
3024 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3025 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
3026 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
3027 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3028 RAM SARAN EDUCATIONAL SOCIETY 161/3A/A PURA FATEH MOHAMMAD ARAIL MORE NAINI ALLAHABAD
3029 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
3030 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
3031 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
3032 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
3033 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
3034 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
3035 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
3036 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
3037 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
3038 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
3039 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.-DURG
3040 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG C.G.
3041 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
3042 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3043 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG (C.G.)
3044 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3045 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
3046 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
3047 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
3048 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
3049 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3050 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
3051 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3052 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
3053 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
3054 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3055 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3056 REAL EDUCATION TRUST 24, 25 VISHRAMNAGAR, OPP AKHAND ANAND SCHOOL, VED ROAD,SURAT.
3057 REAL REVOLUTION MARKETING PRIVATE LIMITED B-32, MAHESH NAGAR, TONK PHATAK, JAIPUR
3058 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
3059 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
3060 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
3061 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
3062 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
3063 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
3064 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
3065 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
3066 REKHA SOCIETY DGGHDGHSH
3067 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
3068 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
3069 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
3070 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
3071 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
3072 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
3073 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
3074 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
3075 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
3076 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
3077 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
3078 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
3079 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
3080 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
3081 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3082 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3083 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
3084 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
3085 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
3086 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
3087 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
3088 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
3089 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
3090 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
3091 RISHABHDEV EDUCATION AND RESEARCH INSTITUTE 5, INDRALOK APARTMENT, NEAR MOTIBAG CHOWK, CIVIL LINES, RAIPUR, CHHATISHGARH
3092 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
3093 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
3094 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
3095 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
3096 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
3097 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
3098 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
3099 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
3100 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
3101 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
3102 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3103 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
3104 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
3105 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3106 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
3107 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
3108 ROJGAR MARGDARSHAN AVAM SWAROJGAR PRASHIKSHAN SANSTHAN NEAR NEW BUS STAND,SHARDAPURAM,P.O. BANSAGAR COLONY,REWA (M.P.)486001
3109 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
3110 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
3111 ROUNAK ALPASANKHYANK BAHUUDDESHIY SHIKSHAN SANSTHA DREAMS TECHNOLOGY, DR. ZAKIR HUSSAIN WARD, NEAR WATER TANK, BHANDARA
3112 ROYAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY H.NO. - 347 INSAF NAGAR INDIRA NAGAR
3113 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
3114 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
3115 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
3116 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
3117 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
3118 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
3119 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
3120 RSESK SOCIETY MAHENDRU
3121 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
3122 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
3123 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
3124 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
3125 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
3126 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
3127 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
3128 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
3129 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3130 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
3131 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3132 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
3133 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
3134 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
3135 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
3136 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
3137 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
3138 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
3139 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3140 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3141 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3142 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
3143 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
3144 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3145 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
3146 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3147 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
3148 RURAL FOUNDATION HEAD OFFICE: DULARI DHAM, NEAR KISAN SEWA ASHRAM, AHROULI MOD, POKHRAYAN,KANPUR DEHAT-209111-UTTAR PRADESH
3149 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
3150 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
3151 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
3152 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
3153 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
3154 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
3155 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
3156 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
3157 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
3158 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
3159 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
3160 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3161 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3162 SADGUNA TECHNOLOGIES NAIMNAGAR
3163 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
3164 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
3165 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
3166 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
3167 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
3168 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3169 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
3170 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3171 SAFDSF SADFASD
3172 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
3173 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
3174 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
3175 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
3176 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
3177 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
3178 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
3179 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
3180 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
3181 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
3182 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
3183 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
3184 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3185 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3186 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3187 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3188 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3189 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3190 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
3191 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
3192 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
3193 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
3194 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
3195 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
3196 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
3197 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
3198 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
3199 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
3200 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
3201 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
3202 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
3203 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
3204 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
3205 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
3206 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
3207 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
3208 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
3209 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
3210 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
3211 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
3212 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
3213 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
3214 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3215 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3216 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
3217 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
3218 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
3219 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
3220 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
3221 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
3222 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
3223 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
3224 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
3225 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
3226 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
3227 SAJAR HEALTH EDUCATIONAL AND CHARITABLE TRUST 52, VAIGAI STREET, VELMURUGAN NAGAR, BYPASS ROAD, MADURAI
3228 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
3229 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3230 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3231 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3232 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3233 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
3234 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
3235 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
3236 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
3237 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
3238 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
3239 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
3240 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3241 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3242 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3243 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
3244 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3245 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
3246 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
3247 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
3248 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
3249 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
3250 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3251 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3252 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
3253 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
3254 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
3255 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
3256 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
3257 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
3258 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
3259 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
3260 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
3261 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
3262 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
3263 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
3264 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
3265 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
3266 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
3267 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
3268 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
3269 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
3270 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3271 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3272 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
3273 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
3274 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
3275 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
3276 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
3277 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
3278 SANDEEP TEST ASDASDASD
3279 SANDESH MNGO INDIA INDIA 1 INDORE
3280 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
3281 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
3282 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
3283 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
3284 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
3285 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3286 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3287 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
3288 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
3289 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
3290 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
3291 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
3292 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
3293 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
3294 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
3295 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE
3296 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE KHANDWA
3297 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
3298 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
3299 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3300 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3301 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
3302 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
3303 SAP INTEGRATED SECURITY AND IT SERVICES PRIVATE LIMITED B-544. POCKET-11, JASOLA VIHAR, NEW DELHI-110025
3304 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
3305 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
3306 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
3307 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
3308 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
3309 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
3310 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
3311 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
3312 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
3313 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
3314 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
3315 SARASWATI INSTITUTIONS OF COMPUTER EDUCATIONAL SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX LAWRENCE ROAD
3316 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
3317 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
3318 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
3319 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
3320 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
3321 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
3322 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
3323 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
3324 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
3325 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
3326 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
3327 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
3328 SAROJ GOPAL EDUCATIONAL SOCIETY VILLAGE - MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI, CHHATTISGARH
3329 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
3330 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
3331 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
3332 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
3333 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
3334 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
3335 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
3336 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
3337 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3338 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
3339 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3340 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
3341 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
3342 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
3343 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
3344 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
3345 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
3346 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
3347 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3348 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3349 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
3350 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3351 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3352 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3353 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3354 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3355 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3356 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3357 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3358 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
3359 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
3360 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
3361 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
3362 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
3363 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
3364 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
3365 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
3366 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
3367 SATMILE SATISH CLUB O PATHAGAR VILL-CHHAT ELAJAN, P.O.-ELAJANER KUTHI, DIST-COOCHBEHAR
3368 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
3369 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
3370 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
3371 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO-110 BHUJGAON TALUKA AKRANI DIST NANDURBAR
3372 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
3373 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
3374 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
3375 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
3376 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
3377 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3378 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3379 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
3380 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
3381 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
3382 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
3383 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3384 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3385 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3386 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3387 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
3388 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
3389 SATYAM SKILLS CENTER VISHAKAPATNAM
3390 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
3391 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
3392 SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE 319/1 HAMIRPUR RAOD RATH DISTRICT HAMIRPUR U.P. 210431
3393 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
3394 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
3395 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
3396 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
3397 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
3398 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
3399 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
3400 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
3401 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
3402 SBDA AT-GVBBGFHGFBFGB
3403 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
3404 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
3405 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
3406 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
3407 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
3408 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
3409 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3410 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3411 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
3412 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
3413 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
3414 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
3415 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3416 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3417 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
3418 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3419 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3420 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
3421 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
3422 SCHOOL OF COMMUNITY SCIENCE AND TECHNOLOGY IIEST SHIBPUR DOWNING HALL WEST WING BOTANICAL GARDEN SHIBPUR HOWRAH
3423 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
3424 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
3425 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
3426 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
3427 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3428 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3429 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
3430 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
3431 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
3432 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
3433 SEED AND TREE CONSULTANTS PVT LTD T12, DOOR NO 2004, BLURIDGE TOWNSHIP, HINJEWADI,PUNE
3434 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
3435 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
3436 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
3437 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
3438 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
3439 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
3440 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
3441 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
3442 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
3443 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
3444 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
3445 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
3446 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
3447 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
3448 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
3449 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3450 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3451 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
3452 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
3453 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
3454 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
3455 SEVENTS CONSULTANTS PRIVATE LIMITED NO: 19, 3RD FLOOR,GCDA COMMERCIAL COMPLEX, MARINE DRIVE, KOCHI, KERALA
3456 SEVENTS CONSULTANTS PRIVATE LIMITED ROOM NO:-29, 3RD FLOOR, MARINE DRIVE, GCDA COMPLEX, KOCHI, KERALA
3457 SEVICA 1 SARAI KHAWAJA
3458 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
3459 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
3460 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
3461 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
3462 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
3463 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
3464 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3465 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
3466 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
3467 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
3468 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
3469 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
3470 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3471 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3472 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
3473 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
3474 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
3475 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
3476 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
3477 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3478 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3479 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3480 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
3481 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
3482 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
3483 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
3484 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
3485 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
3486 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
3487 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
3488 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
3489 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
3490 SHEVOM RUBBER INDUSTRIES PVT LTD 3/338 VISHWAS KHAND GOMTINAGAR, LUCKNOW
3491 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
3492 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
3493 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
3494 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
3495 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
3496 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
3497 SHIKSHA VISTAR SANSTHA HOUSE NO 40, SEC 9/2 , GANDHI NAGAR
3498 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
3499 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
3500 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3501 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3502 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
3503 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
3504 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
3505 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
3506 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3507 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3508 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, OPP. JAFARABAD GRAM PANCHAYAT, GODHRA
3509 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, JAFRABAD GODHRA 389001
3510 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
3511 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
3512 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
3513 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
3514 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
3515 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3516 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3517 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3518 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
3519 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
3520 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
3521 SHIV EDUCATION SOCIETY NEAR MLN COLLEGE, RADAUR YAMUNA NAGAR,HARYANA
3522 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
3523 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
3524 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
3525 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
3526 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3527 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
3528 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3529 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
3530 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
3531 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
3532 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
3533 SHODH 180/22, ZAKIR NAGAR, OKHLA
3534 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
3535 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
3536 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
3537 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
3538 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3539 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3540 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3541 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
3542 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
3543 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
3544 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
3545 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
3546 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3547 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3548 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
3549 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
3550 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
3551 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
3552 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
3553 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
3554 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
3555 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
3556 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
3557 SHREE LAXMI COMPUTER CENTER LAXMI COMPUTER CENTER BASAVANA BAGEWADI
3558 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
3559 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
3560 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
3561 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
3562 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
3563 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
3564 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
3565 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
3566 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
3567 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
3568 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
3569 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3570 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3571 SHREE RAM KRIPA BUILD HOME PRIVATE LIMITED 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
3572 SHREERAM OM REAL ESTATE 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
3573 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
3574 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
3575 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
3576 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
3577 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
3578 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
3579 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
3580 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
3581 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3582 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3583 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
3584 SHRI BALAJI INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED DUBEY COLONY MOWA RAIPUR
3585 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
3586 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI,
3587 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
3588 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
3589 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
3590 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
3591 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
3592 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
3593 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
3594 SHRI GOPAL DARBAR LOK KALYAN SAMITI GHATKOTRA MAURANIPUR
3595 SHRI GOPAL DARBAR LOK KALYAN SAMITI GANDHI NAGAR MAHOBA UP
3596 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
3597 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
3598 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
3599 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3600 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3601 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
3602 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST 408, AGGARWAL PRESTIGE MALL, PLOT NO. 02, COMMUNITY CENTRE, PITAMPURA, DELHI
3603 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST STANFORD INTERNATIONAL SCHOOL,MERRUT-SONEPAT ROAD, PALRI, NEAR GLAXO COMPANY, SONEPAT
3604 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
3605 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
3606 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
3607 SHRI JYOTI SERVICES P LTD H-17 IST FLOOR, SOUTH EXTENTION-I DELHI DL 110049 IN
3608 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
3609 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
3610 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
3611 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
3612 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED. MAHARASHTRA
3613 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED MAHARASHTRA
3614 SHRI MAHALAXMI MULTI PURPOSE CO OP SOCIETY LTD TOPINKATTI, TAL: KHANAPUR, DIST: BELGAUM
3615 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
3616 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
3617 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
3618 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
3619 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
3620 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3621 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
3622 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
3623 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
3624 SHRI PITAMBRA VIDHYAPEETH NYAS JR MIG 1/1 GEETANJALI COMPLEX KOTRA SULTANABAD BHOPAL
3625 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
3626 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
3627 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3628 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3629 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
3630 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITIA KARAHIFATEHPURSIKRIAGRA
3631 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
3632 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
3633 SHRI RAM SKILLS DEVELOPMENT PRIVATE LIMITED MAIN BARWALA ROAD, VIRAT NAGAR,HANSI, DIST HISAR.
3634 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3635 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3636 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3637 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3638 SHRI SADGURU SAI SAMARTH JEEVAN ADHAR SAMAJIK SANSTHA BRANCH GADHINGLAJ BHADGAON ROAD,DOCTOR COLONY,NEAR SHIVSAGAR HOTEL,GADHINGLAJ
3639 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
3640 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
3641 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
3642 SHRI SHIKSHA PRASAR EVAM JANKALYAN SAMITI 26,BAJARIYA MOHALLA SEONDHA DISTT DATIA MADHYA PRADESH
3643 SHRISHTI HELPING HANDS WELFARE SOCIETY A-602 NEW ASHOKA GARDEN, 80 FEET ROAD,BHOPAL
3644 SHRI SIDDHIVINAYAK EDUCATION SOCIETY CINEMA ROAD WARD NO 6 JUNNARDEO
3645 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
3646 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
3647 SHRI SWAMY RAMA FOUNDATION TRUST THE SWAMI RAM FOUNDATION TRUST, RAM NAGAR, SWAMI RAM MARG, VILLAGE BHUREWALA NARIANGARH134 203, DISTTAMBALA, HARYANA, REWA, HARYANA, INDIA
3648 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
3649 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
3650 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
3651 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
3652 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
3653 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
3654 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
3655 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
3656 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
3657 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
3658 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
3659 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
3660 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
3661 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
3662 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3663 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3664 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
3665 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
3666 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
3667 SIKSHYA BHARATI TRUST SIKSHYA BHARATI TRUST COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK STATE-ODISHA
3668 SIKSHYA BHARATI TRUST AT-COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK
3669 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
3670 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
3671 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD- 382481
3672 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
3673 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3674 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3675 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3676 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3677 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3678 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3679 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3680 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
3681 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
3682 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
3683 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3684 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3685 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3686 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3687 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3688 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
3689 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
3690 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
3691 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
3692 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
3693 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
3694 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
3695 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
3696 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
3697 SISHU KALYANA SWADHIKARA KENDRA HEAD OFFICE AT - RUGUDIPARA, SAI MANDIR LANE PO/DIST - BALANGIR, ODISHA
3698 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
3699 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
3700 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
3701 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
3702 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3703 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
3704 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3705 SJP HOTELS AND RESORTS PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
3706 SJS SKILLS DEVELOPMENT CENTER A UNIT OF SHRI JYOTI SERVICES P LTD SM KUTEER ,92 CIVIL LINE MEERUT CANTT
3707 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
3708 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
3709 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
3710 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
3711 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
3712 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
3713 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
3714 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
3715 SKILLPRO TECHNOLOGIES PVT LTD 2ND FLOOR, 33 SUBASH ROAD, DEHRADUN UTTARAKHAND
3716 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
3717 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
3718 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
3719 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
3720 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
3721 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
3722 SKILL VISION SOCIAL EDUCATIONAL SOCIETY 81 KOHARAPEER THALIWALAN CHOWK BAREILLY
3723 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
3724 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
3725 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3726 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
3727 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3728 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
3729 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
3730 SLC EDUCATIONAL SOCIETY 101, 1-11-112/2 CHAKRAVARTHY TOWERS SHYAMLAL BUILDINGS BEGUMPET, HYDERABAD
3731 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
3732 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3733 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3734 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3735 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
3736 SMARTONE TECHNO SOFT PRIVATE LIMITED NARURANGABAD, COURT ROAD, ETAWAH-206001
3737 SMART SKILL TECH PRIVATE LIMITED PLOT NO 137 SEC 24
3738 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
3739 SMART ZONE GUNJABARI
3740 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
3741 SMITA MAHILA SHIKSHAN SANSTHAN 567 ANAND COLONY BALDEOBAG JABALPUR MADHYA PRADESH 482002
3742 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
3743 SMT DEVKI DEVI SEVA SAMITI L.I.G. GOVIND PUR ALLAHABAD
3744 SMT DEVKI DEVI SEVA SAMITI LIG 123 GOVINDPUR ALLAHABAD
3745 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
3746 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
3747 SNAP NEAR MANIPAL HOSPITALS
3748 SNC INFOTECH PRIVATE LIMITED KC-114, KAVI NAGAR , GHAZIABAD
3749 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
3750 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
3751 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
3752 SNS FOUNDATION 508, 3RD FLOOR, JAISWAL COMPLEX, SAKCHI, JAMSHEDPUR EAST SINGHBHUM
3753 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3754 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3755 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
3756 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
3757 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
3758 SOCIAL DEVELOPMENT ORGANISATION H.NO. 50, MASOUD ALI BUILDING, TAAJ LEIRAK, HAFIZ HATTA, IMPHA EAST,MANIUR -7095001
3759 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
3760 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 4 HOUSE NO C-31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR NEW DELHI
3761 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 3 HOUSE NO C 31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR
3762 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
3763 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
3764 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
3765 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
3766 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
3767 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
3768 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
3769 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
3770 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
3771 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
3772 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
3773 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
3774 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
3775 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
3776 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
3777 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
3778 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
3779 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
3780 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
3781 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
3782 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
3783 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
3784 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
3785 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
3786 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEVELOPMENT VILLAGE & P.O- KANISHAIL P.S & DISTRICT- KARIMGANJ
3787 SOCIETY FOR EDUCATION AND SOCIAL ACTIVITIES FF-31, SF-30,31,19,VATSALYA STATUS, OPP RAILWAY STATION, KADI
3788 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
3789 SOCIETYFORHEALTHACTIONDEVELOPMENTANDENVIRONMENTALSERVICES PLOT NO-468/3A, SHREE VIHAR, PATIA, CHANDRASEKHARPUR, BHUBANESWAR
3790 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
3791 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
3792 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
3793 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
3794 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
3795 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
3796 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
3797 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
3798 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
3799 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
3800 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
3801 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
3802 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
3803 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
3804 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
3805 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
3806 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI,NEW DELHI-110075
3807 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
3808 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
3809 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
3810 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
3811 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
3812 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
3813 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
3814 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
3815 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
3816 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
3817 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
3818 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
3819 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
3820 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
3821 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
3822 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
3823 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
3824 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
3825 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
3826 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
3827 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
3828 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
3829 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
3830 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
3831 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
3832 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
3833 SONAPUR PALLY UNNAYAN SAMITY SONAPUR PART-I,PO-SONAPUR,DISTRICT-CACHAR
3834 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
3835 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
3836 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
3837 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3838 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3839 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3840 SONY XPERIA FGFDGFGFD
3841 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
3842 SOS CARE C-88/A, GF, KAUSHIK SADAN, GALI NO.3, JANTA GARDEN, PANDAV NAGAR, DELHI-110091
3843 SOS CARE INDIA C-88/A,GF, GALI NO.3,KAUSHIK SADAN, JANTA GARDEN,PANDAV NAGAR,DELHI-91
3844 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
3845 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
3846 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR (CG)
3847 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR
3848 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
3849 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
3850 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3851 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
3852 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
3853 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
3854 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
3855 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
3856 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
3857 SPARSH 310 CHANDRALOK TOWER KAPOORTHALA, LUCKNOW
3858 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
3859 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3860 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3861 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3862 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3863 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
3864 S P GRAMYA VIKAS AVAM GRAMODYOG SANSTHAN 636/431 TAKROHI POST CHINHAT SECTOR 11 INDIRA NAGAR LUCKNOW UP
3865 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
3866 SR ASIA 4F-CS-25, ANSAL PLAZA, VAISHALI, GHAZIABAD INDIA
3867 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3868 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
3869 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3870 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
3871 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
3872 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3873 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
3874 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
3875 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
3876 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
3877 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
3878 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
3879 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
3880 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
3881 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
3882 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
3883 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
3884 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
3885 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
3886 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
3887 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3888 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3889 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
3890 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
3891 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
3892 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
3893 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
3894 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
3895 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA
3896 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
3897 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
3898 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
3899 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3900 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
3901 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3902 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
3903 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
3904 SRI GOKULAM TRUST 13,KALIAMMAN KOVIL ST, KOOMAPATTI, SRIVALLIPUTHUR TK, VIRUDHUNAGAR DT
3905 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
3906 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
3907 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
3908 SRI JYOTHI HUMAN RESOURCES WELFARE ASSOCIATION 23-66/A/1/ MADHURA NAGAR SHAMSHABAD,9490324304
3909 SRI KALAI HERBAL BEAUTY PARLOUR MAHILA SANGHA #141 NEW 7 11 MAIN 1ST CROSS K P AGRAHARA BANGALORE
3910 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3911 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3912 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
3913 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
3914 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3915 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
3916 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3917 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3918 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
3919 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
3920 SRI KRISHNA EDUCATION TRUST SRI KRISHNA EDUCATION TRUST, SHISHYA BEML PUBLIC SCHOOL, DR. AMBEDKAR ROAD, BEML TOWNSHIP, NEW THIPPANSANDRA, BANGALORE
3921 SRI KUMARAGURU MILL SRI KUMARAGURU MILL, KG HOUSE, 126 ARTS COLLEGE ROAD, COIMBATORE
3922 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
3923 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
3924 SRI LALDEO MEERA FOUNDATION MEERA BHAWAN,MAIN ROAD KOERIA TOLA,RAXAUL,EAST CHAMPARAN,BIHAR-845305
3925 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
3926 SRI MAHESWARA EDUCATIONAL TRUST SET 1/154,SILLARAHALLI VILL & PO,PAPPIREDDIPATTI TK,DHARMAPURI DT,TAMILNADU,INDIA
3927 SRI MAHESWARA EDUCATIONAL TRUST SET HOME ADDRESS: 1/154,SILLARAHALLI (VILL & PO),PAPPIREDDIPATTI (TK),DHARMAPURI (DT)-635303. OFFICE ADDRESS:SRI GURU MAHESWARA PARAMEDICAL INSTITUTION,PAPPIREDDIPATTI ( VILL & PO & TK),DHARMAPURI (DT)
3928 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
3929 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
3930 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
3931 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
3932 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
3933 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3934 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
3935 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
3936 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3937 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3938 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3939 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
3940 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3941 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
3942 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
3943 SRI RADHA KRISHNA INFOTECH PRIVATE LIMITED B-172, B BLOCK, BHARAT VIHAR KAKROLA, NEW DELHI - 110078, INDIA
3944 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
3945 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
3946 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3947 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3948 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3949 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
3950 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
3951 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
3952 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
3953 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: DOOR NO: 75621, FLOT NO.8, JETTI DELUX APARTMENT, PRAKASH NAGAR, RAJAHMUNDRY533103. EAST GODAVAI DISTRICT.
3954 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3955 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
3956 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
3957 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
3958 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
3959 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
3960 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
3961 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
3962 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
3963 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3964 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3965 SRI SATHYA SAI EDUCATIONAL AND CHARITABLE TRUST M/S.DR.M.G.R INSTITUTRE CAMPUS, NO.8,NEDUMARAN NAGAR
3966 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
3967 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
3968 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
3969 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
3970 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
3971 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
3972 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
3973 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
3974 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
3975 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY YASHODAGANASHREE NILAYA 8TH CROSS, SAPTHGIRI EXTN. TUMKUR-
3976 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATRE, M.G.ROAD, TUMKUR
3977 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
3978 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3979 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3980 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3981 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
3982 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
3983 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
3984 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
3985 SRISTI FOUNDATION 8TH FLOOR , RESHMI COMPLEX , P & T COLONY , KIDWAIPURI , PATNA
3986 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
3987 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
3988 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
3989 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
3990 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
3991 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
3992 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
3993 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
3994 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
3995 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
3996 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
3997 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
3998 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
3999 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4000 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4001 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
4002 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
4003 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4004 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI TALUK, THIRUVALLUR DISTRICT
4005 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4006 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
4007 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
4008 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
4009 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
4010 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
4011 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
4012 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
4013 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
4014 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
4015 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
4016 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
4017 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
4018 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
4019 SRM MULTISERVICES PRIVATE LIMITED 78 NEAR WATER TANK MUNSHIGANJ SITAPUR
4020 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
4021 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
4022 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
4023 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
4024 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
4025 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
4026 SSC DDHGH
4027 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
4028 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
4029 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4030 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4031 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
4032 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
4033 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
4034 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4035 SSR SERVICES INDIA LLP 17-89/4, MAIN ROAD, OPP SBI, PENDURTHY, VISAKHAPATNAM-531173, ANDHRAPRADESH
4036 SSR SERVICES INDIA LLP #17-83/3, BRUNDHVANAM GARDENS, OPP GOVT HOSPITAL, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRA PRADESH, INDIA
4037 SSR SERVICES INDIA LLP # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4038 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
4039 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
4040 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4041 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
4042 STARLINE HOLIDAYS PRIVATE LIMITED 234, POCKET-4, ROHINI, NEW DELHI-110085
4043 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4044 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
4045 STAR SCHOOL SAMITI SHIV KUMAR SINGH INSTITUTE OF TECHNOLOGY AND SCIENCE RAU NEAR IIM PITHAMPUR BYPASS ROAD INDORE
4046 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
4047 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
4048 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
4049 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4050 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4051 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4052 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4053 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4054 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
4055 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
4056 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
4057 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
4058 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
4059 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
4060 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
4061 STEP AHEAD FOUNDATION 410,4TH FLOOR, SUNDARAM BUILDING, RDC, RAJ NAGAR, GHAZIABAD.
4062 STEP TO FORWARD SANSTHAN 43, D NEW CIVIL LINES FATEHPUR
4063 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
4064 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
4065 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
4066 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
4067 ST MARYS TAILORING AND CHARITABLE TRUST 4/122,AMBATHKAR STREET,KUDUMIYAMPATTI,ACHALVADI PO,HARUR TK,DHARMAPURI DT,TAMILNADU,INDIA-636903
4068 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
4069 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
4070 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4071 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GURU JAMBESHWAR UNIVERSITY HISAR
4072 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4073 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
4074 STYLE N SCISSORS 4/36-J SUNRISE ENCLAVE GROUND FLOOR, CHITRAKOOT SCHEME JAIPUR ,RAJASTHAN
4075 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
4076 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI BLOCK- KACHHAUNA DISTRICT- HARDOI
4077 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI
4078 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
4079 SUBHASH EDUCATIONAL SOCIETY SUBHASH CHANDRA BOSE INSTITUTE OF HIGHER EDUCATION, PRABANDH NAGAR, MUBARAKPUR,NEAR IIM, LUCKNOW
4080 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
4081 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
4082 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
4083 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
4084 SUBHIKSAM CHARITABLE TRUST NO:1, ARUNACHALAESWARER COMPLEX,PONNAI KOOT ROAD,THIRUVALAM,KATPADI TK,VELLORE DT
4085 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
4086 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
4087 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
4088 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
4089 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
4090 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
4091 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
4092 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
4093 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
4094 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
4095 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA
4096 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
4097 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
4098 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
4099 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
4100 SUNRISE EDUCATION AND WELFARE SOCIETY B-1/3716, BHAGWAN PUR KHERA, SHAHDARA, DELHI
4101 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
4102 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH
4103 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH KALAHANDI
4104 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
4105 SUPER COMPUTER COLLEGE GENERAL BUS STAND ANANTNAG
4106 SUPER COMPUTERS GENERAL BUS STAND ANANTNAG
4107 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
4108 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
4109 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
4110 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4111 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4112 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4113 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
4114 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
4115 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
4116 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
4117 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
4118 SURAJ FOUNDATION VILLAGE AND POST JAGIR
4119 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
4120 SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED, H NO 2-152,VANI NAGAR, MALKAJGIRI, HYDERABAD, TS
4121 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
4122 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4123 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN,NEAR BUS STAND
4124 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4125 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
4126 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
4127 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
4128 S V EDUCATION AND INFRASTRUCTURE PRIVATE LIMITED 2-1-5/34 PLR LUXURY HOMES UPPERPALLY HYDERABAD
4129 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
4130 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
4131 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
4132 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
4133 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
4134 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
4135 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
4136 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
4137 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
4138 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
4139 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
4140 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
4141 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
4142 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
4143 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR, KANPUR
4144 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR KANPUR
4145 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4146 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4147 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4148 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
4149 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
4150 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
4151 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
4152 SWASTHAY SHIKSHA EVAM VYAKTIGAT VIKAS ANUSANDHAN KENDRA B-455, STREAT NO. 30, MAHAVIR ENCLAVE PART-II, NEAR SEC-2, DWARKA NEW DELHI
4153 SWASTIKA MAHILA VIKAS SANSTHAN SWASTIKA MAHILA VIKAS SANSTHAN, GALI NO-3, NEW KAREHRA COLONY, MOHAHNNAGAR, GHAZIABAD, U.P
4154 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
4155 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
4156 SWATHI EDUCATIONAL SOCIETY H.NSAO. 17-1-380/E/9,CENTRAL EXCISE COLONY SAIDABAD, HYDERABAD
4157 SWATHI MEMORIAL EDUCATIONAL SOCIETY H.NO.16-2-754/A/23/1,APAU COLONY,ASMANGADH,DILSUKHNAGAR HYDERABAD
4158 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
4159 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
4160 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
4161 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
4162 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
4163 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
4164 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
4165 SYMBIOSIS INSTITUTE OF COMPUTER APPLICATIONS FORTE INSTITUTE OF TECHNOLOGY, VILLAGE KASERU BUXER , OPPOSITE VIJAYLOK COLONY, GREEN PARK , MAWANA ROAD , MEERUT
4166 SYNCHRONIZED TECHNOSOFT PRIVATE LIMITED D201, OYSTER GRANDE, SECTOR-102/102 (A), GURGAON, HARYANA-122001
4167 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
4168 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
4169 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
4170 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
4171 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
4172 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
4173 TALISMA TEST TALISMA TEST, TALISMA TEST
4174 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
4175 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
4176 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
4177 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
4178 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
4179 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
4180 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
4181 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
4182 TARUN CREATIONS PRIVATE LIMITED KHASRA NO 115 SHITLAMATA WALI GALI ALIPUR DELHI
4183 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
4184 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
4185 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
4186 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
4187 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
4188 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
4189 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
4190 TECH MECH INTERNATIONAL P LTD 92 CIVIL LINES S M KUTEER MEERUT
4191 TECH MECH INTERNATIONAL P LTD 208 II FLOOR,AGARWAL CHAMBERSIV,VEER SAVARKAR BLOCK,SHAKAPUR,DELHI
4192 TECHNICAL EDUCATION SOCIETY NAGPUR RAJESH REWADE 122 KACHORE LAY OUT WAED NO 06 BUTI BORI NAGPUR 441108
4193 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKATESH CITY SHIRUL NAGPUR
4194 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
4195 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
4196 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
4197 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
4198 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
4199 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, ALIGANJ, NEAR ENGG COLLEGE CROSSING
4200 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
4201 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
4202 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
4203 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
4204 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
4205 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
4206 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
4207 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
4208 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
4209 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
4210 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
4211 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4212 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4213 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4214 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4215 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
4216 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
4217 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
4218 TENNEX CONSULTING PRIVATE LIMITED 2/514A, RIVER ENCLAVE, MANAPAKKAM, CHENNAI
4219 TERNA PUBLIC CHARITABLE TRUST SOLAPUR ROAD, OSMANABAD 413501
4220 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
4221 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
4222 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
4223 TEST TEST
4224 TEST GUWAHATI METRO
4225 TEST123 QLJLFHLJQ
4226 TEST1234TEST TEST
4227 TEST ABCD 5678 TESTABCD5678
4228 TESTDATA TEMP DELHI
4229 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
4230 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
4231 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
4232 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
4233 TEST FOR MAIL JADGSJAS
4234 TESTING TEST
4235 TESTM2 ASDWDDV
4236 TEZ ENGINEERING AND INFRASTRUCTURE PRIVATE LIMITEO SHEELAM COLONY STREET NO-03, OPPOSITE DIHILLONG PETROL PUMP, PUNJAB
4237 TEZ ENGINEERING PRIVATE LIMITED SHEELAM COLONY GALI NO.3 OPP DIHILLONG PETROL PUMP
4238 THAKUR KARAM SINGH CHARITABLE TRUST H/O LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
4239 THAKUR KARAM SINGH CHARITABLE TRUST V.P.O. LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
4240 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
4241 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
4242 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET,PODATUR PET,PALLIPET TALUK,
4243 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET, PODATUR PET PALLIPET TALUK, TIRUVALLUR DISTRICT
4244 THANDAVA VENKATESA MUTHALIYAR EDUCATIONAL TRUST 63,EST NAGART,1ST STREET, PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT, TAMILNADU
4245 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
4246 THE ASHOKA HANDLOOM AND HANDICRAFTS SOCIETY BLDG NO- 918,WARD NO-11, PANIPAT,HARIYANA
4247 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
4248 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
4249 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
4250 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
4251 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
4252 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
4253 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
4254 THE ASSOCIATION OF VOLUNTARY AGENCIES FOR RURAL DEVELOPMENT MANIPUR MATA LAMBULANE VILLAGE BPO TOLPHEI PO CHURACHANDPUR CHURACHANDPUR DISTRICT
4255 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
4256 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
4257 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
4258 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
4259 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
4260 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
4261 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
4262 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
4263 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
4264 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
4265 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
4266 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
4267 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
4268 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI
4269 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI NEAR DEPUTY COMMISSIONER COMPLEX.THOUBAL
4270 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO/PS THOUBAL, MANIPUR
4271 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
4272 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
4273 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
4274 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
4275 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
4276 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
4277 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
4278 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
4279 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
4280 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
4281 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
4282 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
4283 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
4284 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
4285 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
4286 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
4287 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
4288 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
4289 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
4290 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4291 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4292 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4293 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
4294 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
4295 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
4296 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
4297 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
4298 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
4299 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
4300 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
4301 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
4302 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
4303 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
4304 TNR SAINIK ACADEMY SOCIETY SURVEY NO.108, BAHADURPALLY VILLAGE, QUTHBULLAPUR, MEDCHAL
4305 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
4306 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
4307 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
4308 TOUCH IN ASSOCIATES PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA, PIN - 752101
4309 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
4310 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
4311 TRANSKILL TRAINING AND CONSULTANCY SERVICES PVT LTD 2ND FLOOR OFFICE NO. 237, KOHINOOR MAJESTIC THERMAX CHOWK CHINCHWAD, PUNE
4312 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
4313 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
4314 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
4315 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
4316 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
4317 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
4318 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR
4319 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
4320 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR DIST.CHHOTAUDEPUR.GUJARAT
4321 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
4322 TRIMURTI WELDMESH PRIVATE LIMITED B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4323 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4324 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4325 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
4326 TRIOS DEVELOPMENT SUPPORT PRIVATE LIMITED T-33, MANISH GLOBAL MALL, PLOT NO-2, OPP. MOUNT CARMEL SCHOOL, SECTOR-22
4327 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
4328 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
4329 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
4330 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
4331 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
4332 TRIVEDI AND ASSOCIATE TECKNICAL SERVICE PRIVATE LIMITED 102, SIDCUP TOWER, RACE COURSE, VADODARA
4333 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
4334 TRP HUI NAGAR
4335 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
4336 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
4337 TULJABHAVNI GRAM VIKAS SEVABHAVI SANSTHA C/O TOTE R G AT POST TQ PATODA DIST BEED
4338 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
4339 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
4340 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
4341 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
4342 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
4343 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
4344 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
4345 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
4346 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
4347 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
4348 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
4349 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
4350 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
4351 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4352 UDHAYAM TRUST 187,RAJA MILL ROAD, POLLACHI
4353 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI,COIMBATORE
4354 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4355 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4356 UDYOG VIKAS SANSTHAN N11/106 LANE NO.2 SRI RAM NAGARA COLONY KAKKARMATTA
4357 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
4358 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
4359 ULTIMATUM INFORMATICS PRIVATE LIMITED SUMANGAL APARTMENT, 99 BT. ROAD, IST FLOOR P.O-KHARDAH KOLKATA KOLKATA WB 700117
4360 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
4361 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
4362 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
4363 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
4364 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
4365 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
4366 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
4367 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
4368 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI
4369 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
4370 UNIQUE VIKAS SANSTHAN 2/94-B, VIJAY KHAND, GOMTI NAGAR, LUCKNOW
4371 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
4372 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
4373 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
4374 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
4375 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
4376 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
4377 UNIVERSAL EDUCATIONAL SOCIETY VILLAGE BALLOPUR, P.O- LALRU, DISTT: DERABASSI
4378 UNIVERSAL IDEAL SEWA SAMITI VILL AND POST MAHULI, PS- WYNDHAMGANJ, SONBHADRA (U.P.), 231208
4379 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
4380 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
4381 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
4382 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLE, SARADA BABU LANE, LINE TANK ROAD, RANCHI
4383 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
4384 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
4385 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
4386 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
4387 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
4388 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
4389 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK BHOTIA PAROW HALDWANI
4390 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
4391 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
4392 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
4393 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
4394 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
4395 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ-33A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
4396 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ 33 A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
4397 URJA GLOBAL LIMITED 487/63, 1ST FLOOR, NATIONAL MARKET, PEERAGARHI, NEW DELHI
4398 URMIDWAR INNOVATIVE ACTION AND RESEARCH FOUNDATION 18,DWARIKAPURAM,NEAR ASHARAM TRUST,CIRCULAR ROAD,BHARATPUR-321001
4399 USHODAYA RURAL AND URBAN DEVELOPMENT VOLUNTARY ORG O V ROAD MRO OFFICE COMPOUND BESIDE E SEVA KANDUKURU 523105 PRAKASAM DT ANDHRA PRADESH
4400 USIT INFOCOM PVT LTD A-152 GALI NO-4 SHAKARPUR DELHI
4401 USIT INFOCOM PVT LTD A-152,GROUND FLOOR,GALI NO-5,ARUNA PARK,SHAKARPUR NEW DELHI
4402 UTKAL BIPANNA SAHAYATA SAMITI PLOT NO-41,SECTOR-A,ZONE-D MANCHESWAR INDUSTRIAL ESTATE CITY-BHUBANESWAR,DIST-KHORDHA STATE-ODISHA
4403 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
4404 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4405 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
4406 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO- COLLEGE SQUARE,CUTTACK
4407 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4408 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4409 UTL TECHNOLOGIES LIMITED NO 19 6 ASHOKPURAM SCHOOL ROAD INDUSTRIAL SUBURB YESHWANTHPUR BENGALURU
4410 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4411 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUTOLA UTTARKASHI
4412 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4413 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4414 UVA JAGRITI SANSTHAN IN FRONT OF GRAM PANCHYAT BANSUR ALWAR RAJASTHAN PIN 301402
4415 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR,OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4416 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR, OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4417 VAG MANAGEMENT SERVICES D-42, GROUND FLOOR, SOUTH EXTENSION PART-1, NEW DELHI
4418 VAIDYANATH SARVANGIN VIKAS SANSTHA AT BRAHMAWADI, POST -TOKWADI, PARLI-BEED STATE HIGHWAY, PARLI-V., DIST. BEED
4419 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET TENKASI TIRUNELVELI DIST TAMILNADU
4420 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET,TENKASI,TIRUNELVELI
4421 VAISHNAVI COMPUTER AND EDUCATION SOCIETY PATHA THANA ., CHANDANGAON CHHINDWARA
4422 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4423 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4424 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST YAVATMAL
4425 VALEUR FABTEX PRIVATE LIMITED B-39, TRIVENI NAGAR, NEAR GOPALPURA BYPASS, JAIPUR, RAJASTHAN
4426 VALHALL EXPORTS PRIVATE LIMITED VALHALL EXPORTS PVT LTD,229,DSIDC SHEDS,OKHLA INDUSTRIAL AREA,PHASE-1,NEW DELHI-110020
4427 VALLEY OF TECHNICAL INSTITUTE AND TRUST KALI MANDIR LANE, OPP. RAMVILAS PETROL PUMP, RATU ROAD, P.O.+P.S.- SUKHDEV NAGAR, RANCHI
4428 VALUE ADD KNOWLEDGE SERVICES PRIVATE LIMITED STILTH FLOOR, MAXIMUS 2B, RAHEJA MINDSPACE IT PARK, HITECH CITY,MADHAPUR, RANGAREDDY, TELANGANA-500081
4429 VAMANI OVERSEAS PRIVATE LIMITED 169 SECTOR 24
4430 VANDEMATRAM IDEAL PUBLIC SOCIETY GWALIOR VILL& POST BARAUA NEW BY PASS HIGHWAY TIRAHA AB ROAD VIPS COLLEGE CAMPUS GWALIOR
4431 VANI SANSTHA 126, MAHAVEER NAGAR Y, 80 FEET ROAD, NEAR ADARSH VIDYA MANDIR, SANGANER , JAIPUR, RAJASTHAN
4432 VANITHA JYOTHI MAHILA SANGAM H.NO: 8-44/2, SRI SAI NAGAR COLONY, SAROOR NAGAR, RANGA REDDY, TELANGANA(STATE)
4433 VANUSRA SOLUTIONS AND ENTERPRISES PVT LIMITED OPC REGISTERED ADDRESS: NEW NO 29/G2, N R FLATS, 6TH STREET, ALAGIRI NAGAR, VADAPALANI, CHENNAI, TAMILNADU. CORPORATE OFFICE: 11/23, 5TH FLOOR, K R BUILDING, L B ROAD, ADYAR, CHENNAI, TAMILNADU
4434 VAP TECHNOLOGY UNDER VIDYA SOCIETY SHRI GURU TEGH BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4435 VARAIYA KRISHI BAGVANI EVAM JAN KALYAN SAMITI AMOLPATHA NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI M.P.
4436 VARAIYA VOCATIONAL TRAINING INSTITUTE NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI
4437 VARDHANA SOCIETY D.NO:22-366/RP, DODDIPALLI ROAD, CHITTOOR
4438 VARDMAN SOCIETY 612, RAMKISHAN MARKET CHANDI ROAD HAPUR
4439 VARHAD VIKAS BAHUUDDES SHIKSHAN PRASARAK MANDAL HIWARKHED VARHAD VIKAS BAHUUDDESHIYVA SHIKSHAN PRASARAK MANDAL HIWARKHED C/O MANISH V BHAMBURKAR AT/PO HIWARKHED (RUPRAO)TQ.TELHARA DST.AKOLA
4440 VASANTHALAKSHMI CHARITABLE TRUST AND RESEARCH CENTRE 16-2-131, KASTURIDEVI NAGAR, POGATHOTA, NELLORE
4441 VASANTHAM EDUCATIONAL AND RURAL DEVELOPED SOCITY 14A,SATHIYANARAYANAN STREET, VENKATASAPURI,
4442 VASAVYA MAHILA MANDALI 40-9/1-16 VASAVYA NAGAR, BENZ CIRCLE VIJAYAWADA
4443 VAS KNOWELDGE GROWTH INITATIVES PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
4444 VAS KNOWLEDGE GROWTH INITIATIVE PVT LTD B-73, NIRALA NAGAR
4445 VAS KNOWLEDGE GROWTH INITIATIVES PVT LTD 320, SYNDICATE HOUSE INDERLOK DELHI
4446 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4447 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4448 VASUNDHARA NZARAPAR JAGIROAD
4449 VASUNDHARA NIZARAPAR JAGIROAD
4450 VASUNDHARA NGO JAGIROAD MORIGAON ASSAM
4451 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4452 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4453 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4454 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4455 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4456 VASUNDHARA VIDYAPRASARAK V K S V SANSTHA REG.OFFICE- AT-DWARKADHISH BHAWAN,NIWANE,TAL-KALWAN,DT-NASIK PROJECT OFFICE- PANDURANG NAGAR,MANMAD,DT-NASIK
4457 VATIKA BHAGYA SHASTRA LLP HEAD OFF:- CUG-1, 1 ST FLOOR, JUMBO HOUSE, 15. DR. JHA MARG , OKHLA PHASE-3, SOUTH DELHI DELHI
4458 VATSALYA EDUCATION AND CHARITABLE TRUST 2ND FLOOR KRISHNA SHRUSTI APARTMENT 10JUNCTION PLOT
4459 VAYAM INFO SOLUTIONS PVT LTD B-157, LOWER GROUND FLOOR, CHITRANJAN PARK, NEW DELHI
4460 VAYAM TECHNOLOGIES LIMITED THAPAR HOUSE, 124, JANPATH, NEW DELHI
4461 V DO SKILLS AND MICRONET LLP 21213B, STREET NO. 2B, AJIT ROAD, BATHINDA
4462 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4463 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4464 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4465 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4466 VEDOM ENGINEERING SERVICES PRIVATE LIMITED 893/A/35, NEAR NAMDEV MANDIR, JANTA COLONY, ROHTAK
4467 VEDOM ENGINEERING SERVICES PRIVATE LIMITED 893 A/35, NEAR NAMDEV MANDIR, JANTA COLONY, ROHTAK HARYANA
4468 VEERA EDUCATIONAL SOCIETY #3-20-1/10, RAM MOHAN RAJA NAGAR, KAKINADA, KAKINADA MANDAL, EAST GODAVARI DISTRICT, AP
4469 VEER INDRA SOCILA GROUP SOCIETY ZILA PARTHMIKSHIK SHAK SHANG SIYARAMNAGAR, BHIHKHANPUR,BHAGALPUR
4470 VEER PAL VILL NARKHERA POST NIPANIYA TEH MILAK RAMPUR
4471 VEER VIJAY EDUCATION SOCIETY VILL & POST-SUNDERPUR, DISTRICT-SAHARANPUR, UP
4472 VEE TECHNOLOGIES PVT LTD NO 71,SONA TOWERS,MILLERS ROAD,7TH FLOOR, BANGALORE
4473 VELLORE ACADEMY NO:508/A, VERSHEN COMPLEX 3RD FLOOR, MUTHURANGAM GOVT ARTS COLLEGE ROAD, OTTERI, VELLORE. TAMILNADU.
4474 VELS UNIVERSITY VELS INSTITUTE OF SCIENCE TECHNOLOGY AND ADVANCED STUDIES (VISTAS) ADDRESS : VELAN NAGAR, P V VAITHIYALINGAM ROAD, PALLAVARAM, CHENNAI - 600 117
4475 VEMULA BHASKAR FOUNDATION ELURU MINI BYPASS ROAD, GREEN CITY, PLOT NO 9.
4476 VENDOR PLUS CONSULTANTS PRIVATE LIMITED SP-49-A, MAIN MARKET PANDAV NAGAR, OPPOSITE MOTHER DAIRY, PATPARGANJ,DELHI-110092 INDIA
4477 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE,JONNALAGADDA,NARASARAOPET,GUNTUR
4478 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE JONNALAGADDA(V), NARASARAOPET, GUNTUR DISTRICT
4479 VENKATESWARA SKILL FOUNDATION 12/13,RAJAYYA VEEDI, GORANTLA, ANANHAPUR, ANANTAPUR, ANDHRA PRADESH, INDIA, 515231
4480 VENUS COMPUTER EDUCATIONAL INSTITUTION 76, ALAGAR KOIL ROAD, GORIPALAYAM BUS STOP, MADURAI
4481 VERSATILE INFOSECURITY PRIVATE LIMITED M-73A, LGF, MALVIYA NAGAR, NEW DELHI
4482 VFX ANIMATION COLLEGE # 28/1 SKT COMPLEX,KAKKALUR ROAD THERADI THIRUVALLUR DIST
4483 VGENUINE SOLUTIONS PRIVATE LIMITED FIRST FLOOR BUILDING 7 SIDCO IE RANGRETH
4484 VGENUINE SOLUTIONS PRIVATE LIMITED BUILDING 7 SIDCO RANGRETH
4485 VHREDUCATIONAL SOCIETY DOOR NO:-10-1064-2-38G ,JAWAHAR NAGAR COLONY,MARKAPUR,PRAKASAM,ANDHRA PRADESH
4486 VIBHA EDUCATIONAL DEVELOPMENT SOCIETY #2-31, VIDYA NAGAR, OPP. JNTU MAIN GAYE, ANANTAPUR, ANDHRA PRADESH.
4487 VIDHARBH RURAL RECONSTRUCTION FOUNDATION KONGHARA AT.KONGHARA POST.PIMPRI TQ.KELAPUR DIST YAVATMAL
4488 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4489 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NR. MUKHTANAND SOCIETY, NARMADANAGAR, BHARUCH.
4490 VIDHYADEEP SOCIETY P.O NARMADA NAGAR, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4491 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4492 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4493 VIDIAL SOCIAL SERVICE CENTER VIDIAL SOCIAL SERVICE CENTER BAUL COMPLEX (OPP MALAIMALAR OFFICE) MEENAKSHIPURAM NAGARCOIL
4494 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA
4495 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA VIDISHA
4496 VIDIYAL MAHALIR MEBATTU SANGAM 29K-RAMNAGAR, DEVAKOTTAI, SIVAGANGAI-DIST
4497 VIDIYAL MAHARIL MEMBATTU SANGAM 29K RAMNAGAR, DEVAKOTTAI SIVAGANGAI-DIST
4498 VIDYA VAP TECHNOLOGY SHREE GURU TEG BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4499 VIDYA NR KHALSA SCHOOL SUBASH NAGAR NAINITAL ROAD HALDWANI
4500 VIDYA SHRI GURU TEG BAHADUR TOWER NEAR KHALSA GIRLS SCHOOL NAINITAL ROAD HALDWANI NAINITAL
4501 VIDYA GURU TEG BAHADUR TOWER, NEAR KHALSA SCHOOL, THANDI SADAK, SUBHASH NAGAR
4502 VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, COCHIN UNIVERSITY ROAD, CUSAT P.O, COCHIN
4503 VIDYADHIRAJA EDUCATION SOCIETY 27/3, ANAND NAGAR, KHANDELWAL MARG, MUMBAI
4504 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE, PATPARGANJ, EAST DELHI
4505 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI
4506 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI 110096
4507 VIDYA NIKETAN SEVABHAVI SANSTHA DONGARGAON DONGARGAON PO. DONGARPIMPALA TQ. GANGAKHED DIST. PARBHANI
4508 VIDYASAGAR ADEVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4509 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4510 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR 482003
4511 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4512 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463,MISHRA COLONY KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4513 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463, KHANKA ROAD, LALLU POKHAR , MUNGER
4514 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED MISHRA COLONY, KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4515 VIJAYA SOCIAL EDUCATIONAL AND CULTURAL TRUST #986, 2ND MAIN,VIDYARANYAPURAM, MYSORE - 570 008
4516 VIJAY GANGA RURAL MEDICAL AND RESEARCH FOUNDATION AT/P – BHALWANI, TAL-PARNER, DIST-AHMEDNAGAR. MAHARASHTRA
4517 VIJAY KUMAR CONTRACTOR HO. NO. - 37, MODERN SAKET COLONY, HISAR.
4518 VIJAY LAXMI TRANSPORT PRIVATE LIMITED AT.GANDHI CHOWK PO- BRAJRAJNAGAR DIST-JHARSUGUDA ODISHA
4519 VIKALP SEWA SAMITI 94, PASCHIMI TARAUS
4520 VIKASH D-2/7, INDUSTRIAL ESTATE RASULGARH, BHUBANESWAR
4521 VIKASH EDUCATION SOCIETY H.NO 1648 URBAN ESTATE JIND
4522 VIKASSHEEL FOUNDATION GRAM PANCHAYAT BHAVAN KE PAS, SHIVTARAI, TAHSIL-KOTA, BILASPUR, CHHATISGARH.
4523 VIKAS VIDYA MANDIR VILL-POST : DARIBA, AMAWAN,RAIBARELY,
4524 VIKRANT EDUCATIONAL AND SOCIAL WELFARE SOCIETY 3-B ASHIRWAAD, HARIOM COLONY, 7 NO CROSSING, MORAR,GWALIOR
4525 VILLAGE DEVELOPEMNT AND ENVIRONMENTAL ORGANISATION THE SECRETARY NEAR TO INDIAN OVERSEAS BANK., KADAYAMPATTY POST, OMALUR TK., SALEM DISTRICT TAMILNADU
4526 VILLAGE DEVELOPMENT TRUST 63/25, KAMARAJ NAGAR, 3RD STREET, CHOOLAIMEDU, CHENNAI. CECIL ROGERS SALES HEAD 9884922452 9677256296
4527 VILLAGE INDIA KALYAN SANSTAHN FRONT ON STATE BANK BINDKI(FATEHPUR)-212635
4528 VILLAGE INDIA KALYAN SANSTAHN KAUSHAL VIKAS PRASHIKSHAN KENDRA
4529 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI (FATEHPUR)-212635
4530 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK OF INDIA BINDKI FATEHPUR (UTTAR-PRADESH)
4531 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI
4532 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI ,FATEHPUR-212635 U.P
4533 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK OF INDIA BINDKI FATEHPUR
4534 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI(212635)-FATEHPUR U.P
4535 VILLAGE MULTIMEDIA PVT LTD NO.4, 1ST FLOOR, SUNRISE BUILDING, OPP KLE COLLEGE ,2ND STAG
4536 VIMALA DEVI SEWA SANSTHAN LOHIYA NAGAR MAHARAJGANJ
4537 VIMALAGIRI VIDYAPEETAM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 686664
4538 VINAYAGAR PERARASAR TRUST VPT 2/71 SABANAYAGAR STREET MA UAIDAYAR POST KATTUMANNARKOIL TALUK
4539 VINDHYA CONSULTANTS AND SERVICES PRIVATE LIMIITED KOTHI GULJAR BAG,OPPOSITE MULTIPURPOSE SCHOOL,BHARATPUR(RAJ.)
4540 VINOD JAIN SMRITI JAN KALYAN SAMITI 201, MAHESHWARI COMPLEX, POWER HOUSE ROAD, WARD NO. 25, RATLAM
4541 VIRAJ GLOBAL SECURITAS PVT LTD B 156 NEW ASHOK NAGAR , NEW DELHI
4542 VIRAT VOLUNTARY ORGANIZATION FOR RURAL AGRICULTUR VILLAGE DEVARGHATA TEH- DABHRA DIST-JANJHGIR CHAMPA C G
4543 VIRAT VOLUNTARY ORG RURAL AGRI AND TECHNOLOGY 47, SUKH SAGAR PHASE 3, PIPLANI BHOPAL
4544 VIRINCHI LIMITED PLOT NO 10, SRK COLONY, WEST MAREDPALLY, SECUNDERABAD
4545 VIRTUAL COMPUTER EDUCATION SHIV NAGAR NH-1A UDHAMPUR (J&K)
4546 VIRTUAL COMPUTER EDUCATIONAL SOCIETY SHIV NAGAR NH-1A
4547 VIRTUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 TILWARA ROAD APPOSITE HP PATROL PUMP SAGRA JABALPUR
4548 VIRTUE INTERNATIONAL PRIVATE LIMITED 63 ESPACE NIRVANA COUNTRY SECTOR - 50
4549 VIRTUE INTERNATIONAL PRIVATE LIMITED 63, ESPACE NIRVANA COUNTRY, SECTOR - 50
4550 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE MANAGING BOARD ROSALPATTI VILLAGE VIRUDHUNAGAR POST 626 001
4551 VISHNU DAYAL SHIKSHA SAMITI 529K/197, SANT KABIR LANE, KHURRAM NAGAR, LUCKNOW
4552 VISHNU DAYAL SHIKSHA SAMITI 529K/197 SANT KABIR LANE KHURRAM NAGAR LUCKNOW 226022
4553 VISHNU VIKLANG SEWA SANSTHAN SAMITI VILLAGE AND POST PATAN
4554 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL G.T. ROAD GHAZIABAD
4555 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL, G.T ROAD, GHAZIABAD
4556 VISHVESHWARYA SCHOOL OF BUSINESS 17,KIRAN ENCLAVE NEAR SAMRAT HOTEL, G.T. ROAD GHAZIABAD
4557 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE,NEAR SAMRAT HOTEL, G.T. ROAD, GHAZIABAD
4558 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL , G.T. ROAD GHAZIABAD
4559 VISHWABHARATHI EDUCATIONAL DEVELOPMENT TRUST 117 NIZAMPET ROAD KUKATPALLY BRINDAVAN COLONY HYDERABAD
4560 VISHWA BHARATI EDUCATION AND RURAL DEVELOPMENT SOCIETY SAI BRANDAVAN, POLICE STATION ROAD, HOKARNA
4561 VISHWAGYAN BAHUDDESIA SEVABHAVI SANSTHA OPP. UMER MASJID, GAZIPURA, LATUR
4562 VISHWA HINDU EDUCATION SOCIETY NO 1-111/1 A PDA COLLEGE ROAD AIWAN E SHAHI GULBARGA KARNATAKA
4563 VISHWATMAK JANGLI MAHARAJ ASHRAM TRUST AT MOHILI POST AGHAI TAL SHAHPUR SIDT THANE
4564 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXT., NEAR SECTOR-7, DWARKA, DELHI.
4565 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI-75.
4566 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA
4567 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI
4568 VISION A RURAL DEVELOPMENT SOCIETY 14-8/3 SDPT RAMAYAMPET MEDAK DITRICT TELANGANA
4569 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4570 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4571 VISIONINDIA SOFTWARE EXPORTS LIMITED SHUBHAMKAR, PLOT NO 14, DHANASHREE COLONY, KARVE NAGAR, PUNE, MAHARASHTRA
4572 VISIONINDIA SOFTWARE EXPORTS LIMITED SHUBHAMKAR, PLOT NO 14, DHANASHREE COLONY, KARVE NAGAR, PUNE, MAHARASHTRA
4573 VISION SHIKSHA SAMITI DEOLI KHASRA NO. 1493/1136, NEAR JAHAZPUR CHUNGI NAKA UNCHA DISTT. BHILWARA
4574 VISION VOICE EDUCARE SOCIETY 111D/1 GARFA MAIN ROAD,JADAVPUR
4575 VISION WORLDTECH PVT LTD A-16 JAI AMBEY NAGAR TONK ROAD JAIPUR
4576 VISRI TECHNOLOGIES AND SOLUTIONS PLOT NO 89, VENKATESHWARA ENCLAVE, OPP:PRIYADARSHINI HOTEL, SUCHITRA X ROADS, SECUNDERABAD.AP
4577 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION, TULSI NIKETAN, MAIN ROAD, SEC 4, HIRAN MAGRI, UDAIPUR (RAJASTHAN) 313001
4578 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION ADDRESS:VISVESVARAYA FIRE AND SAFETY PRIVATE ITI TULSI NIKETAN HIRAN MAGRI,SEC 4, MAIN ROAD, CITY , STATE: UDAIPUR (RAJASTHAN) 313001 COUNTRY : INDIA CONTACT NO.: 0294-2460656, 9829242332.
4579 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION ADDRESS:VISVESVARAYA FIRE AND SAFETY PRIVATE ITI TULSI NIKETAN HIRAN MAGRI,SEC 4, MAIN ROAD, CITY , STATE: UDAIPUR (RAJASTHAN) 313001 COUNTRY : INDIA CONTACT NO.: 0294-2460656, 9829242332.
4580 VISWA BHARATHI TRUST HYDER NAGAR , KUKAT PALLI, HYD - 85
4581 VISWADEEPTHI EDUCATIONAL SOCIETY 20-151/A, JAILKHAN STREET, MITTOOR CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH
4582 VISWA SAI ADS FLAT NO 502, SIVA RESIDENCY, HINDI NAGAR, PANJAGUTTA, HYDERABAD
4583 VITRUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 OPP HP PERTOL PUMP TILWARA ROAD SAGRA JABALPUR
4584 VIVEKANANDA NAGAR PRAGATI VIVEKANANDA NAGAR, POST OFFICE:BABLA GOBINDAPUR PS: SANTIPUR DIST: NADIA WEST BENGAL 741404
4585 VIVEKANANDARURALANDURBANDEVELOPMENTASSOCIATION HNO 6-3-266,NEAR GEETA VIGNANA HIGH SCHOOL,RAMAGIRI,NALGONDA TELAGANA STATE
4586 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS DISTRICT, WEST BENGAL, PIN 743336
4587 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS , EMAIL :VSSU.IN@GMAIL.COM , WWW.VSSU.IN , PH +91 3174 277451 /9735706439
4588 VIVEKANAND EDUCATIONAL SOCIETY ADJ. SEC-18, HUDA, JAGADHRI
4589 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.B. OFFICE, NEAR POWER HOUSE,PINDWARA
4590 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.BOFFICE, NEAR POWER HOUSE, PINDWARA, DIST-SIROHI(RAJ.)
4591 VIVEKANAND TT COLLEGE WARD 07 BHADRA
4592 VIVEK JYOTI NEAR MATA KALI MANDIR, NEW RAMNAGAR, ADHARTAL, JABALPUR
4593 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11 MUKAND VIHAR VILLAGE MUKANDPUR
4594 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11, MUKAND VIHAR VILLAGE, MUKANDPUR, DELHI
4595 VIVID FOUNDATION KH NO 283/53/2 LANE NO 11 MUKAND VIHAR VILLAGE MUKANDPUR DELHI
4596 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11, JANTA VIHAR, MUKUNDPUR, DELHI
4597 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD
4598 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD,
4599 VIYAYLAXMI PRIVATE LIMITED GANDHI CHOWK BRAJRAJNAGAR JHARSUGUDA
4600 VJ SECURITY LLP B 156, NEW ASHOK NAGAR, NEW DELHI
4601 VK EDUCATIONAL AND TRAINING CENTER 783 DILDAR NAGAR KHATI BABA JHANSI
4602 VK EDUCATIONAL AND TRAINING CENTER 783 DILDAR NAGAR KHATI BABA JHANSI
4603 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E) NAVI MUMBAI 400614
4604 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E),NAVI MUMBAI,MAHARASHTRA STATE
4605 VLCC HEALTH CARE LIMITED 64, HSIDC, SECTOR-18, MARUTI INDUSTRIAL AREA, GURUGRAM
4606 VMART PLOT NO. 862,UDHYOG VIHAR INDUSTRIAL AREA PHASE V
4607 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED FLAT NO.B, OLD NO. 9, NEW NO.2, LAKSHMI COLONY, (NEAR NORTH CRESCENT ROAD), T-NAGAR, CHENNAI
4608 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED WZ-22, ASALATPUR, JANAKPURI
4609 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NR AUCKLAND HOTEL LAKKAR BAZAR SHIMLA
4610 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NEAR AUCKLAND HOTEL LAKKAR BAZAAR SHIMLA
4611 V M TECHNO SOFT PVT LTD G-3 SECTOR-1 AVANTI VIHAR, RAIPUR (CG)
4612 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO.3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD BHOPAL
4613 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR. BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL.
4614 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4615 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN BHOPAL
4616 VOC INDUSTRIAL TRAINING INSTITUTE VOC NAGAR,PATTALAMMAN KOVIL ST CHINNAMANUR
4617 VOCMAN INDIA PRIVATE LIMITED C 326, VIKAS PURI, NEW DELHI
4618 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4619 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4620 VRUTTI VRUTTI, LIVELIHOOD RESOURCE CENTRE, 2ND FLOOR, "SRI RAGHAVENDRA NILAYA", # 25, AECS LAYOUT, ASHWATHNAGAR, SANJAYNAGAR (BEHIND PARATHA PLAZA), BANGALORE - 560094. KARNATAKA. PHONE: +91-80-23419616/23517241
4621 VRUTTI NO.25, AECS LAYOUT, ASHWATHNAGAR,BANGALORE BANGALORE KARNATAKA 560094
4622 VRUTTI D-45/A EAST OF KAILASH DELHI
4623 VSOFT TECHNOLOGIES PRIVATE LIMITED MY HOME HUB, BLOCK-I 4TH FLOOR, MADHAPUR HYDERABAD - 500 081
4624 V S SHAH EDUCATION AND SOFTWARE PRIVATE LIMITED 1/14 PARUL APARTMENT, SHANTADEVI ROAD, NAVSARI
4625 V S SHAH EDUCATION AND SOFTWARE PVT LTD 1/14, PARUL APARTMENT SHANTADEVI ROAD NAVSARI. GUJARAT
4626 VVJ CHARITABLE TRUST 93G/6A/2, PALAI MAIN ROAD, OPP TVS SHOWROOM, THOOTHUKUDI-628002
4627 VYAVASAYA JANA CHAITANYA SAMITHI H.NO: 1-9-8/1/11, FLAT NO:303, B BLOCK, GIRISHIKHARA PLAZA, RAM NAGAR, HYDERABAD, TELANGANA
4628 VYUGA CONSULTING # 2905/3 & 4, HOTEL GANESH COMPLEX SRINIVASAM PILLAI ROAD, RAILADY THANJAVUR
4629 WAGONS LEARNING PRIVATE LIMITED A-8, A/7-8, 4TH FLOOR, SRUSHTI, OPPOSITE CORPORATION BANK, BANER ROAD, PUNE
4630 WAKE UP SKILLS PVT LTD VISHNU SOFTECH, 2ND FLOOR, SHRI DINESH COMPLEX, NEHRU CHOWK, AGRA ROAD, DEOPUR, DHULE
4631 WALL COMMUNICATION PRIVATE LIMITED A-31/20, NETAJI GALI NO-1 MAUJPUR,
4632 WATERSHED ORGANISATION TRUST 'PRYAVARAN BUILDING' BEHIND MARKET YARD AHMEDNAGAR
4633 WATERSHED SUPPORT SERVICES AND ACTIVITIES NETWORK 12-13-452, STREET NO.1, TARNAKA, SECUNDRABAD
4634 WATRANA TRACTION COMPANY I-28,UPSIDC INDL.AREA,GREATER NOIDA-201306
4635 WATRANA TRACTION PRIVATE LIMITED G-3, SITE V, UPSIDC INDUSTRIAL AREA, GREATER NOIDA
4636 WBSCSTRDSEWA KULIANA, MALINCHA BELIABERAH
4637 WB SOFTECH 41/B/1 ASUTOSH MUKHERJEE ROAD P.S- BUDGE BUDGE P.O- BUDGE BUDGE BLOCK:- BUDGE BUDGE I KOLKATA, WEST BENGAL
4638 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH - 700103
4639 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH-700103
4640 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR, 24 PARGANA SOUTH, 700103.
4641 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR,24 PARGANA SOUTH-700103
4642 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH-700103
4643 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH ,700103
4644 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4645 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4646 WE ARE HUMAN FOUNDATION WE ARE HUMAN FOUNDATION WORKSHOP, C-68, MANGE RAM COMPLEX, LOWER GROUND FLOOR, MAHAVIR VIHAR, SECTOR-1, DWARKA, NEW DELHI.
4647 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4648 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4649 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4650 WELCOME P LTD SIVA ST, MADURAI
4651 WELFARE ORGANISATION FOR RURAL LEAGUE DEVELOPMENT VEJENDLA POST ,CHEBROLU M GUNTUR DIST
4652 WELFARE SERVICES ERNAKULAM PONNURUNNI, VYTILA, ERNAKULAM, KERALA, INDIA
4653 WELKIN SOCIETY N-6/66, R-30, PRABHAT NAGAR,INDIRA NAGAR EXT., CHITAIPUR ROAD, SUNDERPUR, VARANASI-221005
4654 WELKIN SOCIETY N-6/66, R-30, PRABHAT NAGAR,INDIRA NAGAR EXT., CHITAIPUR ROAD, SUNDERPUR, VARANASI-221005
4655 WELSPUN INDIA LIMITED WELSPUN CITY, VILLAGE VERSAMEDI, TALUKA ANJAR
4656 WENS LINK ALHAJ COMMERCIAL COMPLEX, 1ST FLOOR, NEAR AGV BANK, NH-15, P.O.- BECHIMARI, DISTRICT.- DARRANG, STATE- ASSAM
4657 WENS LINK AMAN COMPLEX, 1ST & 2ND FLOOR, NH-15, KHARUPETIA
4658 WEST BENGAL SC AND ST RURAL DEVELOPMENT AND SOCIO ECONOMICS WELFARE ASSOCIATION GOPIBALLAVPUR , PASCHIM MEDINIPUR
4659 WE THE PEOPLE ROOM NO. 102, D211, LAXMANSINGH COMPLEX I, MUNIRKA, NEW DELHI 110067
4660 WHIZZY WORLD SURTEING VB COLLEGE ROAD RAINAWARI
4661 WINGSEDUCATIONS I-II 229/7 SANGAM VIHAR NEW DELHI
4662 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.36,PRABHU NAGAR,RAKKIYAPALAYAM PIRIVU,TIRUPUR
4663 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.195,EMKAY COMPLEX, KANGAYAM ROAD,TIRUPUR
4664 WISDOM EDUCATIONAL AND CHARITABLE TRUST 36 PRABHU NAGAR RAKKIYAPALAYAM PIRIVU KANGAYAM ROAD TIRUPUR 641606
4665 WITNUT COMPUTING PRIVATE LIMITED G77/2, SF, SHAHEEN BAGH, AF ENCLAVE-II, OKHLA, NEW DELHI
4666 WIZARD TECH COMPUTER ACADEMY PVT LTD SALEMPUR LAH BAZAR NEAR INDRALOK HOTEL CHAPRA
4667 WOMEN AND CHILDREN WELFARE SOCIETY 15/8, BIG STREET CHEYYAR
4668 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGR, KURINJIPADI, CUDDALORE
4669 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4670 WOMEN EMPOWERMENTAND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4671 WOMEN ENTERPRENEURS OF KARNATAKA ASSOCIATION #6, BESIDE ESHWAR TEMPLE, ESHWAR NAGAR, AMARGOL, OPP.APMC HUBLI
4672 WOMEN ENTREPRENEURSHIP DEVELOPMENT INSTITUTE WEDI CPK COMPLEX, NEAR ARYASAMAJ, RAM MOHAN ROAD, KOZHIKODE
4673 WOMEN INTERNATIONAL NETWORK WIN D-8/8, PARYAVARAN COMPLEX, SAID-UL-A-JAIB, SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4674 WOMEN INTERNATIONAL NETWORK WIN D-8/8, RIGHT SIDE, PARYAVARAN COMPLEX,SAID-UL-A-JAIB,SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4675 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI KRISHAN PURA PANIPAT
4676 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI, KISHAN PURA, PANIPAT
4677 WOMENS WELFARE SOCIETY 5-9-102/3, 1ST FLOOR, PUBLIC GARDEN ROAD, NAMPALLY, HYDERABAD
4678 WORLD WIDE SECURITY ORGANIZATION B-6, VIDHYA NAGAR HOSHANGABAD ROAD BHOPAL , MADHYA PRADESH
4679 WYATH SERVICES PRIVATE LIMITED GULAB MOHALLA,LOCK GATE SRINAGAR,SRINAGAR JAMMU AND KASHMIR
4680 XECUTE HR SOLUTIONS PVT LTD #307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON – 122018
4681 XECUTE HR SOLUTIONS PVT LTD 307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON
4682 XINE IT BRAINS PRIVATE LIMITED L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW UTTAR PRADESH INDIA
4683 XINE IT BRAINS PVT LTD L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW
4684 XI TECHNOLOGIES PVT LTD 4TH FLOOR, CHAKMIR, BUDGE BUDGE TRUNK ROAD, MAHESHTALA, KOLKATA – 700 141
4685 XPREZ INFOSOLUTIONS PVT LTD PLOT NO 7 ROOTS TOWER 8TH FLOOR LAXMI NAGAR DISTRICT CENTER DELHI.
4686 XYZ XYZ
4687 XYZ SSIISI SSSSF SDG SDG SG
4688 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE-411005
4689 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, CTS NO-95 A, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE
4690 YASH BAHU UDDESHIYE SEVA BHAVI SANSTHA TULSAI NIVAS, JALALPUR ROAD, NEAR ARUNODAYA RESIDENCY, PARLI VAIJNATH, DIST : BEED, MAHARASHTRA
4691 YASH EDUCATIONAL SOCIETY III-H/146, NEHRU NAGAR, GHAZIABAD
4692 YASH EDUCATION SOCIETY A/P. NIRA, WARD NO. 2
4693 YASH EDUCATION SOCIETY A/P. NIRA, TAL PURANDAR, DIST : PUNE MAHARASHTRA
4694 YASH EDUCATION SOCIETY AT POST NIRA, WARD NO. 2
4695 YASH EDUCATION SOCIETY AT POST NIRA, NEAR S.T. STAND, WARD NO. 2
4696 YASHWANT SHIKSHAN SANSTHA 11, FIRST FLOOR, BACK OF SAMBHAJI NAGAR KAMAN,NEAR SHIVRAJ PETROL PUMP NH- 4 SATARA PIN- 415004.
4697 YASHWANT SHIKSHAN SANSTHA A/P - KSHETRA MAHULI, TAL./DIST - SATARA MAHARASHTRA
4698 YATHARTH GURUKRUL COMPUTER SHIKSHAN SAMITI INDORE ROAD DEPALPUR
4699 YELLOW HOME HEALTH CARE PVT LTD 1-63-5-8B, KAVURI HILLS, JUBILEE HILLS POST
4700 YESH BAHUUDDESHIYA SEWABHAVI SANSTHA RAMPURI BK AT.POST.RAMPUTI BK, TQ.MANWAT DIST.PARBHANI HEAD OFFICE RAHUL NAGAR, PARBHANI
4701 YIMKUMMER WELFARE SOCIETY YIMKUMMER WELFARE SOCIETY LUKONGMENDANG WARD, TULI TOWN. MOKOKCHUNG
4702 YIMKUMMER WELFARE SOCIETY LUKONGMENDANG WARD, TULI TOWN. MOKOKCHUNG
4703 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1, MOTILAL NEHRU NAGAR (EAST) BHILAI
4704 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH.
4705 YOUNGSTERS ASSOCIATION #2/489,OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL,NAGARAJPET,KADAPA -516001, CON:08562-222083,FAX:08562-222149.
4706 YOUNGSTERS ASSOCIATION YOUNGSTERS ASSOCIATION # 2/489,2ND FLOOR, OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL, NAGARAJPET, KADAPA -516001, CON: 08562-222083, FAX: 08562-222149
4707 YOUTH ACTION FOR RURAL DEVELOPMENT RANI BHASKAR NILAYAM, 6-3-668/10/20, 1ST FLOOR, NEAR VENKATESHWARA SWAMY TEMPLE, DURGANAGAR COLONY, PANJAGUTTA, HYDERABAD, TELANGANA STATE
4708 YOUTH BASE DEVELOPMENT SOCIETY C- 1087, TIGRI COLONY
4709 YOUTH EDUCATIONAL SOCIETY HARIDWAR BYPASS ROAD, NEAR RISPANA PUL OPP. AKASHWANI BHAWAN DEHRADUN UTTARAKHAND
4710 YOUTH EFFORTS FOR SOCIETY YES TRUST NO 47, 1ST FLOOR KEB COLONY UDAYAGIRI MYSORE
4711 YOUTH EMPOWERMENT SOCIETY 44 PRAHALAD COLONY, NEAR BY VISHNU GARDEN , SANGANER THANA , JAIPUR
4712 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4713 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4714 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4715 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4716 YOUTH FOR NATION SOCIAL WELFARE AND EDUCATION SOCIETY PLOT NO. 7 & 8 SETH PHOOL CHAND NAGAR MANDIDEEP
4717 YOUTH INDIA SAKSHARTA MISSION BHITAR KAMTA, GOSANIMARI, DINHATA COOCH BEHAR, WEST BENGAL
4718 YOUTHNET YOUTHNET BILLY GRAHAM ROAD, NEAR KOHIMA COLLEGE, KOHIMA, NAGALAND
4719 YOUTHNET YOUTHNET, BILLY GRAHAM ROAD, OPP. KOHIMA COLLEGE, KOHIMA
4720 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
4721 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
4722 YOUTH UPTURN VOLUNTARY ASSOCIATION 16-3-245, 3RD FLOOR, TRENDSET TOWERS, RAMALINGAPURAM, NELLORE.
4723 YPJ EDUCATIONAL SOCIETY D.NO.1-9-837/2 TOP OF HIND BAKERY, POCHAMMAGALLY, NIZAMABAD DISTRICT, TELANGANA STATE
4724 YPR MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH
4725 YUVADESH SHIKSHA EVAM SAMAJIK KALYAN SAMITI C/O SHOURYA CONSULTANCY,GROUND FLOOR,JYOTI CINEPLEX,M P NAGAR,ZONE I BHOPAL
4726 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
4727 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
4728 YUVA JAGRUTI MANCH B-2/22, WALLFORT ENCLAVE, BEHIND RAMKRISHNA HOSPITAL, PACHPEDI NAKA, RAIPUR
4729 YUVA SANKALP BAHUUDDESHIYA SANSTHA WORD NO. 12, MOHAPA, TAL KALAMESHWAR, DIST NAGPUR
4730 YUVA SANKALP BAHUUDDESHIYA SANSTHA NAGPUR PLOT NO. 28, GOPAL NAGAR, NAGPUR
4731 YUVA SANSKRITI AVOM SAMAHJIK KALYAN SANGATHAN H.NO.- 1082, K.H. NO.- 199, GROUND FLOOR, NEAR MTNL EXCHANGE, KANJHAWALA ROAD, BAWANA
4732 YUVASHAKTI FOUNDATION 8 /4 , LAKSHA , PURNANAGAR ,BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE-411019
4733 YUVASHAKTI FOUNDATION 8/4 , PURNANAGAR , NEAR RTO , CHINCHWAD , PUNE
4734 YUVASHAKTI FOUNDATION 8/4 , LAKSHYA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
4735 YUVASHAKTI FOUNDATION 8/4 , LAKSHA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
4736 YUVA TRAINING AND PLACEMENTS RAMALINGAPURAM, TRENDSET TOWERS,3RD FLOOR,NELLORE-524001
4737 YUVA VIKAS SOCIETY 26,DEENDAYAL UPADHYAY MARG,ITO,NEW DELHI
4738 ZACLON INDIA LIMITED 54,55, 1ST & 2ND FLOOR,VASHISHT PARK, MAIN PANKHA ROAD ,SAGARPUR,NEW DELHI-110046
4739 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR, JAMMU AND KASHMIR
4740 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR JAMMU AND KASHMIR
4741 ZAINUL ABIDEEN TECHINICAL TRAINING CENTRE SHALTENG CROSSSING SRINAGAR
4742 ZAINUL ABIDEEN TECHINICAL TRAINING CENTRE SHALTENG
4743 ZENITH CAREER WINGS 51-A,NEHRU STREET , RAMNAGAR, COIMBATORE
4744 ZENITH NEEDS MULTMEDIA T.S.NO:3074-3075, GNANA ARUL PLAZA 1ST FLOOR, RAJA RANI COMPLEX, KEELA RAJA VEETHI, PUDUKKOTTAI DISTRICT.
4745 ZENSOFT TECHNOLOGIES PRIVATE LIMTED WRIGHT EDUCATION, NEAR PANJAB NATIONAL BANK, MAIN MARKET KARANPRAYAG, DISTT-CHAMOLI UTTARAKHAND
4746 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL HYDERABAD
4747 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL
http://rural.nic.in    http://aajeevika.gov.in    http://nird.org.in http://www.nabcons.com http://ddugky.gov.in