Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
3 AAA AAA
4 AAA BBB JABBALPUR, KATHMANDU,
5 AAA SOCIETY A AA AAAAAAAAAAAAAA
6 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
7 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
8 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
9 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
10 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
11 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
12 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
13 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
14 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
15 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
16 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
17 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
18 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
19 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
20 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
21 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
22 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
23 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
24 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
25 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
26 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
27 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
28 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
29 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
30 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
31 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
32 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
33 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
34 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
35 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
36 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
37 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
38 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
39 ABC JKLJLJK
40 ABC BHOPAL
41 ABC JHSDJHDFKLJDFKJHJKGD
42 ABC KALARA BURDWAN
43 ABCD ABCDEFGHIJKLMNOP
44 ABCD ABCD
45 ABC FIRM LTD PATNA
46 ABC PVT LTD PUNE
47 ABC TRUST LKCNSDKAJD
48 ABD PVT LTD XYZ
49 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
50 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
51 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
52 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
53 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
54 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
55 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
56 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
57 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
58 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
59 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
60 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
61 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
62 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
63 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
64 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
65 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
66 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
67 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
68 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
69 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
70 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
71 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
72 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
73 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
74 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
75 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
76 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
77 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
78 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
79 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
80 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
81 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
82 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
83 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
84 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
85 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
86 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
87 ADARSH FOODS CITY STATION ROAD KHURJA
88 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
89 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
90 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
91 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
92 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
93 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
94 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
95 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
96 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
97 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
98 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
99 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
100 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
101 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
102 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
103 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
104 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
105 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
106 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
107 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
108 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
109 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
110 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
111 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
112 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
113 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
114 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
115 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
116 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
117 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
118 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
119 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
120 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
121 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
122 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
123 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
124 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
125 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
126 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
127 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
128 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
129 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
130 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
131 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
132 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
133 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
134 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
135 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
136 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
137 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
138 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
139 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
140 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
141 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
142 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
143 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
144 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
145 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
146 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
147 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
148 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
149 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
150 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
151 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
152 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
153 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
154 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
155 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
156 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
157 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
158 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
159 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
160 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
161 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
162 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
163 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
164 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
165 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
166 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
167 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
168 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
169 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
170 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
171 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
172 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
173 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
174 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
175 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
176 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
177 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
178 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
179 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
180 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
181 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
182 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
183 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
184 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
185 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
186 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
187 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
188 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
189 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
190 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
191 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
192 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
193 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
194 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
195 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
196 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
197 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
198 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
199 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
200 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
201 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
202 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
203 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
204 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
205 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
206 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
207 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
208 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
209 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
210 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
211 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
212 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
213 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
214 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
215 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
216 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
217 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
218 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
219 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
220 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
221 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
222 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
223 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
224 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
225 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
226 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
227 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
228 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
229 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
230 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
231 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
232 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
233 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
234 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
235 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
236 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
237 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
238 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
239 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
240 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
241 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
242 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
243 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
244 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
245 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
246 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
247 ANNAMALAI ASDJFKL ADF ASDF AS F
248 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
249 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
250 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
251 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
252 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
253 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
254 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
255 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
256 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
257 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
258 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
259 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
260 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
261 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
262 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
263 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
264 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
265 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
266 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
267 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
268 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
269 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
270 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
271 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
272 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
273 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
274 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
275 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
276 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
277 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
278 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
279 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
280 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
281 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
282 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
283 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
284 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
285 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
286 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
287 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
288 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
289 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
290 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
291 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
292 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
293 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
294 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
295 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
296 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
297 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
298 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
299 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
300 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
301 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
302 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
303 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
304 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
305 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
306 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
307 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
308 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
309 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
310 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
311 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
312 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
313 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
314 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
315 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
316 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
317 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
318 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
319 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
320 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
321 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
322 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
323 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
324 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
325 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
326 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
327 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
328 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
329 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
330 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
331 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
332 ASFSDA ASDF
333 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
334 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
335 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
336 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
337 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
338 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
339 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
340 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
341 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
342 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
343 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
344 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
345 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
346 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
347 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
348 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
349 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
350 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
351 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
352 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
353 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
354 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
355 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
356 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
357 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
358 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
359 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
360 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
361 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
362 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
363 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
364 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
365 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
366 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
367 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
368 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
369 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
370 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
371 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
372 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
373 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
374 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
375 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
376 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
377 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
378 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
379 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
380 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
381 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
382 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
383 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
384 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
385 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
386 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
387 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
388 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
389 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
390 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
391 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
392 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
393 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
394 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
395 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
396 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
397 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
398 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
399 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
400 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
401 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
402 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
403 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
404 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
405 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
406 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
407 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
408 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
409 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
410 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
411 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
412 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
413 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
414 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
415 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
416 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
417 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
418 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
419 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
420 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
421 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
422 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
423 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
424 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
425 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
426 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
427 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
428 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
429 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
430 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
431 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
432 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
433 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
434 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
435 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
436 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
437 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
438 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
439 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
440 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
441 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
442 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
443 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
444 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
445 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
446 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
447 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
448 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
449 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
450 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
451 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
452 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
453 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
454 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
455 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
456 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
457 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
458 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
459 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
460 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
461 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
462 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
463 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
464 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
465 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
466 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
467 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
468 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
469 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
470 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
471 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
472 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
473 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
474 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
475 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
476 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
477 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
478 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
479 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
480 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
481 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
482 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
483 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
484 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
485 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
486 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
487 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
488 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
489 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
490 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
491 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
492 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
493 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
494 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
495 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
496 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
497 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
498 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
499 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
500 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
501 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
502 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
503 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
504 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
505 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
506 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
507 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
508 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
509 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
510 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
511 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
512 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
513 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
514 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
515 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
516 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
517 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
518 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
519 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
520 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
521 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
522 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
523 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
524 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
525 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
526 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
527 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
528 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
529 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
530 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
531 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
532 BISWAAS BAHARANA.NIALI,CUTTACK
533 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
534 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
535 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
536 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
537 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
538 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
539 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
540 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
541 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
542 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
543 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
544 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
545 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
546 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
547 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
548 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
549 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
550 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
551 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
552 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
553 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
554 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
555 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
556 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
557 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
558 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
559 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
560 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
561 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
562 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
563 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
564 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
565 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
566 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
567 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
568 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
569 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
570 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
571 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
572 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
573 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
574 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
575 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
576 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
577 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
578 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
579 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
580 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
581 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
582 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
583 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
584 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
585 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
586 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
587 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
588 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
589 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
590 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
591 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
592 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
593 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
594 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
595 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
596 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
597 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
598 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
599 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
600 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
601 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
602 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
603 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
604 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
605 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
606 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
607 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
608 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
609 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
610 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
611 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
612 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
613 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
614 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
615 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
616 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
617 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
618 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
619 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
620 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
621 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
622 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
623 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
624 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
625 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
626 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
627 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
628 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
629 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
630 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
631 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
632 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
633 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
634 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
635 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
636 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
637 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
638 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
639 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
640 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
641 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
642 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
643 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
644 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
645 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
646 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
647 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
648 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
649 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
650 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
651 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
652 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
653 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
654 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
655 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
656 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
657 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
658 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
659 CHETNA ALLAHABAD ROAD KARWI
660 CHETNA ALLAHABAD ROAD, KARWI
661 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
662 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
663 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
664 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
665 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
666 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
667 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
668 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
669 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
670 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
671 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
672 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
673 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
674 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
675 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
676 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
677 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
678 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
679 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
680 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
681 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
682 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
683 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
684 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
685 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
686 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
687 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
688 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
689 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
690 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
691 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
692 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
693 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
694 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
695 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
696 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
697 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
698 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
699 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
700 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
701 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
702 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
703 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
704 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
705 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
706 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
707 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
708 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
709 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
710 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
711 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
712 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
713 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
714 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
715 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
716 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
717 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
718 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
719 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
720 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
721 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
722 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
723 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
724 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
725 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
726 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
727 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
728 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
729 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
730 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
731 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
732 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
733 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
734 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
735 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
736 COODU TRUST H.83.R M.COLONY DINDIGUL
737 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
738 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
739 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
740 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
741 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
742 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
743 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
744 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
745 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
746 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
747 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
748 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
749 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
750 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
751 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
752 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
753 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
754 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
755 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
756 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
757 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
758 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
759 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
760 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
761 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
762 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
763 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
764 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
765 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
766 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
767 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
768 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
769 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
770 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
771 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
772 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
773 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
774 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
775 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
776 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
777 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
778 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
779 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
780 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
781 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
782 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
783 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
784 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
785 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
786 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
787 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
788 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
789 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
790 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
791 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
792 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
793 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
794 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
795 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
796 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
797 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
798 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
799 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
800 DDUGKY MORD C TEST ALJBSDFLQJHF
801 DDUGKY MORD C TEST1 LJHWDF
802 DDUGKY MORD INC TEST2 NEW DELHI
803 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
804 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
805 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
806 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
807 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
808 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
809 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
810 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
811 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
812 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
813 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
814 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
815 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
816 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
817 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
818 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
819 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
820 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
821 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
822 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
823 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
824 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
825 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
826 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
827 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
828 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
829 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
830 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
831 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
832 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
833 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
834 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
835 DFHDFHFH KJDVNMDV,M DV
836 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
837 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
838 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
839 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
840 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
841 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
842 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
843 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
844 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
845 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
846 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
847 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
848 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
849 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
850 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
851 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
852 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
853 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
854 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
855 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
856 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
857 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
858 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
859 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
860 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
861 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
862 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
863 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
864 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
865 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
866 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
867 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
868 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
869 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
870 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
871 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
872 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
873 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
874 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
875 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
876 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
877 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
878 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
879 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
880 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
881 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
882 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
883 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
884 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
885 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
886 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
887 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
888 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
889 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
890 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
891 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
892 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
893 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
894 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
895 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
896 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
897 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
898 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
899 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
900 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
901 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
902 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
903 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
904 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
905 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
906 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
907 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
908 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
909 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
910 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
911 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
912 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
913 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
914 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
915 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
916 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
917 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
918 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
919 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
920 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
921 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
922 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
923 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
924 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
925 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
926 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
927 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
928 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
929 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
930 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
931 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
932 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
933 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
934 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
935 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
936 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
937 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
938 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
939 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
940 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
941 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
942 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
943 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
944 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
945 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
946 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
947 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
948 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
949 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
950 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
951 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
952 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
953 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
954 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
955 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
956 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
957 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
958 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
959 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
960 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
961 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
962 EDS GADEPAN KOTA
963 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
964 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
965 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
966 EDU INSTITUTE ADDRESS
967 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
968 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
969 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
970 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
971 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
972 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
973 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
974 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
975 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
976 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
977 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
978 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
979 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
980 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
981 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
982 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
983 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
984 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
985 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
986 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
987 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
988 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
989 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
990 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
991 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
992 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
993 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
994 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
995 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
996 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
997 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
998 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
999 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1000 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1001 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1002 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1003 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1004 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1005 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1006 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1007 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1008 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1009 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1010 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1011 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1012 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1013 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1014 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1015 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1016 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1017 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1018 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1019 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1020 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1021 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1022 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1023 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1024 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1025 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1026 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1027 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1028 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1029 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1030 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1031 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1032 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1033 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1034 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1035 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1036 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1037 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1038 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1039 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1040 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1041 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1042 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1043 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1044 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1045 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1046 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1047 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1048 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1049 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1050 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1051 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1052 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1053 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1054 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1055 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1056 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1057 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1058 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1059 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1060 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1061 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1062 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1063 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1064 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1065 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1066 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1067 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1068 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1069 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1070 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1071 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1072 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1073 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1074 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1075 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1076 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1077 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1078 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1079 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1080 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1081 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1082 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1083 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1084 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1085 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1086 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1087 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1088 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1089 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1090 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1091 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1092 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1093 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1094 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1095 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1096 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1097 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1098 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1099 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1100 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1101 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1102 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1103 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1104 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1105 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1106 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1107 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1108 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1109 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1110 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1111 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1112 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1113 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1114 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1115 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1116 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1117 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1118 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1119 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1120 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1121 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1122 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1123 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1124 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1125 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1126 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1127 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1128 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1129 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1130 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1131 GENUINESOFT ST.HINDUCOLLEGE ROAD
1132 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1133 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1134 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1135 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1136 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1137 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1138 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1139 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1140 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1141 GFHDYHDBAH VSGYCGDHFGSDY
1142 GFHDYHDBAH QSDWEFWE
1143 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1144 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1145 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1146 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1147 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1148 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1149 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1150 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1151 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1152 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1153 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1154 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1155 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1156 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1157 GK FOUNDATION 36/B KALKAJI NEW DELHI
1158 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1159 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1160 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1161 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1162 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1163 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1164 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1165 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1166 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1167 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1168 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1169 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1170 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1171 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1172 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1173 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1174 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1175 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1176 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1177 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1178 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1179 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1180 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1181 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1182 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1183 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1184 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1185 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1186 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1187 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1188 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1189 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1190 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1191 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1192 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1193 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1194 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1195 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1196 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1197 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1198 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1199 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1200 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1201 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1202 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1203 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1204 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1205 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1206 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1207 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1208 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1209 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1210 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1211 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1212 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1213 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1214 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1215 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1216 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1217 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1218 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1219 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1220 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1221 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1222 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1223 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1224 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1225 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1226 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1227 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1228 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1229 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1230 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1231 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1232 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1233 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1234 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1235 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1236 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1237 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1238 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1239 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1240 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1241 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1242 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1243 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1244 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1245 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1246 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1247 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1248 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1249 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1250 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1251 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1252 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1253 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1254 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1255 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1256 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1257 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1258 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1259 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1260 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1261 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1262 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1263 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1264 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1265 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1266 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1267 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1268 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1269 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1270 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1271 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1272 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1273 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1274 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1275 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1276 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1277 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1278 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1279 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1280 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1281 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1282 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1283 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1284 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
1285 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1286 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
1287 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1288 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1289 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1290 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1291 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1292 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1293 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1294 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
1295 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1296 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1297 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1298 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1299 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1300 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1301 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1302 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1303 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1304 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1305 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1306 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1307 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1308 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1309 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1310 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1311 HARSH PVT LTD SDFAAFDSSDF
1312 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1313 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1314 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1315 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1316 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
1317 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1318 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1319 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1320 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1321 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1322 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1323 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1324 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
1325 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1326 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1327 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1328 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
1329 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1330 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1331 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1332 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1333 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1334 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
1335 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
1336 HGXDNG CBGNCBNMCNFMHXFVM
1337 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1338 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1339 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1340 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1341 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1342 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1343 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1344 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1345 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1346 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1347 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1348 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
1349 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1350 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1351 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1352 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1353 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1354 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1355 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1356 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
1357 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1358 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1359 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1360 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1361 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1362 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1363 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1364 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1365 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1366 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1367 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1368 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1369 HSADALO FFSE
1370 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1371 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1372 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1373 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1374 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
1375 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1376 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1377 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1378 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1379 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
1380 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1381 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1382 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1383 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1384 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1385 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1386 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1387 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1388 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1389 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1390 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1391 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1392 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
1393 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
1394 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1395 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1396 ICTPMU DDUGKY TEST NEW DELHI
1397 ICTPMU TEST11 NEW DELHI110001
1398 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1399 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1400 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1401 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1402 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1403 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1404 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1405 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1406 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1407 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1408 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1409 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1410 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1411 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1412 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1413 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1414 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1415 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1416 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1417 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1418 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1419 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1420 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1421 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1422 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1423 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1424 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1425 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1426 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1427 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1428 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1429 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1430 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1431 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1432 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1433 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1434 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1435 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1436 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1437 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1438 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1439 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1440 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1441 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1442 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1443 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1444 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
1445 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1446 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
1447 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
1448 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1449 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1450 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1451 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1452 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1453 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1454 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1455 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1456 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1457 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1458 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1459 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1460 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1461 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1462 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1463 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1464 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1465 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1466 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1467 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1468 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
1469 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1470 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
1471 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1472 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1473 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1474 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1475 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1476 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1477 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1478 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1479 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1480 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1481 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1482 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1483 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1484 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1485 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1486 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1487 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1488 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
1489 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
1490 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
1491 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
1492 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
1493 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
1494 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
1495 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
1496 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
1497 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
1498 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
1499 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
1500 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
1501 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
1502 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
1503 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
1504 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
1505 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
1506 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
1507 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
1508 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
1509 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
1510 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
1511 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1512 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
1513 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1514 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
1515 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
1516 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
1517 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
1518 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
1519 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
1520 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
1521 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
1522 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
1523 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
1524 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
1525 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
1526 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
1527 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
1528 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
1529 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
1530 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
1531 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
1532 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
1533 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
1534 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
1535 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
1536 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
1537 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
1538 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1539 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1540 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1541 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
1542 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
1543 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
1544 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
1545 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
1546 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
1547 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
1548 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
1549 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
1550 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
1551 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
1552 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
1553 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
1554 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
1555 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
1556 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
1557 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
1558 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
1559 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1560 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1561 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1562 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
1563 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1564 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
1565 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
1566 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
1567 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
1568 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
1569 JAN KALYAN SAMITI JAIN
1570 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
1571 JAN KALYAN SHIKSHA SAMITI A-1413/3
1572 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
1573 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
1574 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
1575 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
1576 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
1577 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
1578 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
1579 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
1580 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1581 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
1582 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
1583 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
1584 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1585 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
1586 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
1587 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
1588 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
1589 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
1590 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
1591 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
1592 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
1593 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
1594 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
1595 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
1596 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1597 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
1598 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1599 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
1600 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
1601 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
1602 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
1603 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
1604 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
1605 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
1606 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
1607 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1608 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1609 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
1610 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
1611 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
1612 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1613 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1614 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
1615 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
1616 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
1617 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
1618 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
1619 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
1620 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
1621 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
1622 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
1623 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
1624 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
1625 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
1626 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
1627 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
1628 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
1629 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
1630 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
1631 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
1632 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
1633 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
1634 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1635 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
1636 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1637 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
1638 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1639 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1640 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1641 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1642 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
1643 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
1644 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
1645 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1646 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1647 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
1648 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
1649 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
1650 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
1651 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
1652 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
1653 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
1654 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
1655 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
1656 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1657 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1658 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1659 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1660 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1661 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1662 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
1663 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
1664 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
1665 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
1666 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
1667 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
1668 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
1669 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1670 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1671 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1672 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
1673 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1674 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
1675 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
1676 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1677 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
1678 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
1679 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
1680 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
1681 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
1682 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
1683 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
1684 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
1685 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1686 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1687 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
1688 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
1689 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
1690 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
1691 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
1692 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1693 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1694 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
1695 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
1696 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
1697 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
1698 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
1699 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
1700 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
1701 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
1702 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
1703 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
1704 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
1705 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1706 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1707 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
1708 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
1709 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
1710 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
1711 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
1712 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
1713 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
1714 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
1715 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
1716 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
1717 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
1718 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1719 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1720 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
1721 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
1722 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
1723 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
1724 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
1725 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
1726 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
1727 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
1728 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
1729 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
1730 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
1731 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
1732 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
1733 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
1734 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1735 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1736 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
1737 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
1738 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
1739 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
1740 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
1741 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
1742 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
1743 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
1744 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
1745 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
1746 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
1747 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
1748 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
1749 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1750 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1751 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1752 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1753 KAYZEY SOCIETY MAWNGAP MAWSMAI
1754 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
1755 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
1756 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
1757 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
1758 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
1759 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
1760 KGVK NEORI VIKAS RUKKA RANCHI
1761 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
1762 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
1763 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
1764 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
1765 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
1766 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
1767 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
1768 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
1769 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
1770 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
1771 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
1772 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
1773 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
1774 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
1775 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
1776 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1777 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1778 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
1779 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
1780 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
1781 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
1782 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
1783 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
1784 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
1785 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
1786 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
1787 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
1788 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
1789 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
1790 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
1791 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
1792 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
1793 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
1794 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
1795 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
1796 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
1797 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
1798 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
1799 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
1800 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
1801 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
1802 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
1803 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
1804 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
1805 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
1806 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
1807 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
1808 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
1809 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
1810 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
1811 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
1812 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
1813 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
1814 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
1815 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
1816 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
1817 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
1818 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
1819 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
1820 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
1821 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
1822 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
1823 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
1824 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
1825 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
1826 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
1827 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
1828 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
1829 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
1830 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
1831 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
1832 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
1833 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
1834 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1835 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1836 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
1837 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
1838 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1839 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1840 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
1841 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
1842 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
1843 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
1844 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
1845 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
1846 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
1847 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
1848 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
1849 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
1850 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
1851 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
1852 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
1853 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
1854 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
1855 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1856 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1857 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
1858 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
1859 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
1860 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1861 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1862 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
1863 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
1864 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
1865 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
1866 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
1867 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
1868 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
1869 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
1870 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
1871 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
1872 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
1873 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
1874 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
1875 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
1876 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
1877 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
1878 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
1879 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
1880 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
1881 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
1882 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
1883 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
1884 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
1885 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
1886 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1887 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1888 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1889 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1890 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
1891 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
1892 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
1893 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
1894 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
1895 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
1896 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
1897 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
1898 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
1899 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
1900 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
1901 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
1902 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
1903 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
1904 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
1905 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
1906 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
1907 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
1908 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
1909 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
1910 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
1911 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
1912 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
1913 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1914 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1915 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1916 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
1917 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
1918 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
1919 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1920 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1921 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
1922 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
1923 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
1924 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
1925 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
1926 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
1927 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
1928 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1929 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1930 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
1931 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
1932 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
1933 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
1934 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
1935 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
1936 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
1937 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1938 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1939 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
1940 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
1941 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
1942 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
1943 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1944 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1945 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
1946 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
1947 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
1948 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
1949 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
1950 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
1951 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
1952 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
1953 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
1954 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
1955 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
1956 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
1957 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
1958 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
1959 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1960 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1961 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1962 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
1963 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
1964 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
1965 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
1966 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
1967 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
1968 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
1969 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1970 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
1971 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1972 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1973 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
1974 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1975 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
1976 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
1977 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
1978 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
1979 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
1980 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
1981 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
1982 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
1983 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
1984 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
1985 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
1986 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
1987 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
1988 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
1989 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
1990 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
1991 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
1992 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
1993 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
1994 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1995 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1996 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
1997 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
1998 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
1999 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2000 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
2001 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
2002 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2003 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2004 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
2005 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
2006 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
2007 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
2008 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2009 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2010 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
2011 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
2012 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
2013 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
2014 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
2015 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
2016 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
2017 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
2018 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
2019 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
2020 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
2021 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
2022 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
2023 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
2024 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
2025 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
2026 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
2027 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
2028 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
2029 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2030 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2031 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
2032 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
2033 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
2034 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
2035 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
2036 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
2037 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
2038 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
2039 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
2040 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
2041 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
2042 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
2043 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
2044 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
2045 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
2046 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
2047 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
2048 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
2049 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
2050 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
2051 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2052 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2053 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
2054 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
2055 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
2056 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
2057 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
2058 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
2059 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
2060 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
2061 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
2062 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2063 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2064 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
2065 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
2066 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
2067 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
2068 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
2069 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
2070 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
2071 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
2072 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
2073 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
2074 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2075 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2076 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
2077 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
2078 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
2079 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
2080 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
2081 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
2082 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
2083 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
2084 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
2085 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
2086 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
2087 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
2088 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2089 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2090 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
2091 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2092 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2093 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
2094 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
2095 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
2096 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
2097 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
2098 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
2099 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
2100 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
2101 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
2102 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
2103 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
2104 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
2105 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
2106 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
2107 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
2108 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
2109 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
2110 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
2111 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
2112 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
2113 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
2114 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2115 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2116 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2117 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2118 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
2119 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
2120 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
2121 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
2122 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
2123 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
2124 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2125 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2126 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2127 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
2128 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
2129 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2130 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
2131 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
2132 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
2133 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
2134 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
2135 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
2136 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
2137 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
2138 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
2139 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
2140 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
2141 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
2142 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
2143 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
2144 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
2145 MORD TEST ND
2146 MORD TEST1 SBJFLJ
2147 MORD TEST2 ADVCDS
2148 MORD TEST NEW DELHI ND
2149 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
2150 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
2151 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
2152 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
2153 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2154 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
2155 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2156 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
2157 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
2158 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
2159 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
2160 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
2161 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
2162 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
2163 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
2164 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
2165 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2166 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
2167 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2168 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
2169 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2170 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
2171 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
2172 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
2173 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
2174 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
2175 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
2176 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
2177 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
2178 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
2179 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
2180 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
2181 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
2182 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
2183 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
2184 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
2185 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
2186 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
2187 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
2188 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
2189 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
2190 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
2191 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
2192 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
2193 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
2194 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
2195 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
2196 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
2197 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
2198 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2199 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2200 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
2201 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
2202 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
2203 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
2204 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
2205 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
2206 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
2207 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
2208 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
2209 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
2210 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
2211 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2212 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2213 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
2214 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
2215 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
2216 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
2217 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
2218 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
2219 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
2220 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
2221 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
2222 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
2223 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
2224 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
2225 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
2226 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
2227 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
2228 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
2229 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
2230 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
2231 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
2232 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
2233 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
2234 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2235 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
2236 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2237 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
2238 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
2239 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
2240 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
2241 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
2242 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
2243 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2244 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2245 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
2246 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
2247 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
2248 NAVACHETHANA MALLAPPALLY INSTITUTE
2249 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
2250 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
2251 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
2252 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
2253 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
2254 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
2255 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
2256 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
2257 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
2258 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
2259 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
2260 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
2261 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2262 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2263 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2264 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
2265 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
2266 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
2267 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
2268 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2269 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2270 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
2271 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
2272 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
2273 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
2274 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
2275 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
2276 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
2277 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
2278 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
2279 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
2280 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
2281 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
2282 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
2283 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
2284 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
2285 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
2286 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
2287 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
2288 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
2289 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
2290 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
2291 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
2292 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
2293 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
2294 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
2295 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
2296 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
2297 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
2298 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
2299 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
2300 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
2301 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
2302 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
2303 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
2304 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
2305 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
2306 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
2307 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2308 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
2309 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2310 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2311 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
2312 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
2313 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
2314 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
2315 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2316 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
2317 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2318 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
2319 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2320 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2321 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2322 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
2323 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
2324 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2325 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2326 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
2327 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
2328 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
2329 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
2330 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
2331 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
2332 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
2333 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
2334 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
2335 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
2336 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
2337 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2338 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2339 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2340 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
2341 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
2342 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
2343 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
2344 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
2345 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
2346 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
2347 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
2348 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
2349 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
2350 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
2351 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
2352 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
2353 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
2354 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
2355 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2356 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2357 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
2358 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
2359 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2360 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
2361 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
2362 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
2363 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
2364 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2365 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
2366 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
2367 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
2368 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
2369 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
2370 NO EDUCATION RAVINDRA NAGAR RAIPUR
2371 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
2372 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
2373 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
2374 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
2375 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
2376 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
2377 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
2378 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
2379 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
2380 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
2381 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
2382 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
2383 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
2384 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
2385 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
2386 NRLM SKILLS SAMRAT,CHANKYAPURI
2387 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
2388 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
2389 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
2390 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
2391 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2392 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2393 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2394 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
2395 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2396 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2397 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
2398 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
2399 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2400 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
2401 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2402 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
2403 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
2404 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
2405 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
2406 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
2407 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
2408 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
2409 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
2410 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
2411 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2412 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2413 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2414 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
2415 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
2416 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
2417 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
2418 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
2419 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
2420 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
2421 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
2422 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
2423 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
2424 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
2425 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
2426 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
2427 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
2428 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
2429 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
2430 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
2431 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
2432 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
2433 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
2434 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
2435 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
2436 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2437 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2438 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2439 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2440 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2441 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
2442 ORION TRUST SAGOLBAND THINGOM LEIKAI
2443 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
2444 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2445 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2446 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
2447 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
2448 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2449 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
2450 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2451 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2452 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2453 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
2454 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
2455 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
2456 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
2457 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
2458 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
2459 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
2460 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
2461 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
2462 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
2463 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
2464 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2465 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
2466 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2467 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
2468 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
2469 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
2470 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
2471 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
2472 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
2473 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
2474 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
2475 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
2476 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2477 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2478 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
2479 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
2480 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
2481 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
2482 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
2483 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
2484 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
2485 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
2486 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
2487 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
2488 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2489 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2490 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
2491 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
2492 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
2493 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
2494 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2495 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2496 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
2497 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
2498 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
2499 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
2500 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
2501 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
2502 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
2503 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
2504 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
2505 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
2506 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
2507 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
2508 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
2509 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
2510 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
2511 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
2512 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
2513 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
2514 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
2515 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
2516 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
2517 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
2518 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
2519 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
2520 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
2521 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
2522 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
2523 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
2524 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
2525 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
2526 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
2527 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
2528 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
2529 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
2530 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
2531 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
2532 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
2533 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
2534 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
2535 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
2536 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
2537 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
2538 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
2539 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
2540 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
2541 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
2542 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
2543 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
2544 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
2545 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
2546 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
2547 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
2548 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
2549 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
2550 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
2551 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
2552 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
2553 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
2554 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
2555 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
2556 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
2557 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
2558 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
2559 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
2560 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
2561 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
2562 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
2563 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
2564 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
2565 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
2566 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2567 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
2568 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
2569 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
2570 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
2571 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
2572 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
2573 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
2574 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
2575 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
2576 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2577 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2578 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2579 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
2580 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
2581 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2582 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2583 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2584 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
2585 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
2586 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
2587 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
2588 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
2589 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
2590 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
2591 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
2592 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
2593 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
2594 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
2595 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
2596 PRERANA RUGUDIPARA BALANGIR ODISHA
2597 PRERANA RUGUDIPARA BALANGIR
2598 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
2599 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2600 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2601 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2602 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2603 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2604 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2605 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2606 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
2607 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
2608 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
2609 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
2610 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
2611 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
2612 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
2613 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
2614 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
2615 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2616 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2617 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
2618 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
2619 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
2620 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
2621 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
2622 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
2623 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
2624 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2625 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2626 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
2627 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
2628 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
2629 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
2630 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
2631 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
2632 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
2633 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
2634 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
2635 PSLMM DG
2636 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
2637 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2638 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
2639 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
2640 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
2641 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
2642 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
2643 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
2644 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2645 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2646 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
2647 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2648 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
2649 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
2650 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
2651 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
2652 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
2653 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2654 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2655 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
2656 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
2657 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
2658 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
2659 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
2660 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
2661 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
2662 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
2663 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
2664 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
2665 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
2666 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2667 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2668 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
2669 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2670 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2671 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
2672 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2673 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2674 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
2675 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
2676 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
2677 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2678 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
2679 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
2680 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
2681 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2682 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2683 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2684 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
2685 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
2686 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
2687 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
2688 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
2689 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
2690 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
2691 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
2692 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
2693 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
2694 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
2695 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
2696 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
2697 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
2698 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
2699 RAJ SHREE 787
2700 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
2701 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
2702 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
2703 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
2704 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
2705 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
2706 RAM MORADABAD
2707 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
2708 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
2709 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
2710 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
2711 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
2712 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
2713 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
2714 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
2715 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
2716 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
2717 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
2718 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
2719 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
2720 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2721 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
2722 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
2723 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2724 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
2725 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
2726 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
2727 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
2728 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
2729 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
2730 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
2731 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
2732 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
2733 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
2734 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
2735 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
2736 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
2737 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
2738 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
2739 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
2740 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
2741 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
2742 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
2743 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2744 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2745 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
2746 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2747 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2748 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
2749 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
2750 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
2751 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
2752 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
2753 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
2754 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
2755 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
2756 REKHA SOCIETY DGGHDGHSH
2757 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
2758 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
2759 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
2760 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
2761 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
2762 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
2763 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
2764 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
2765 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
2766 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
2767 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
2768 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
2769 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
2770 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
2771 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
2772 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
2773 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
2774 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
2775 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
2776 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
2777 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
2778 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
2779 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
2780 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
2781 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
2782 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
2783 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
2784 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
2785 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
2786 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
2787 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
2788 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
2789 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
2790 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
2791 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
2792 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2793 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2794 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
2795 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
2796 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
2797 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
2798 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
2799 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
2800 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
2801 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
2802 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
2803 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
2804 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
2805 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
2806 RSESK SOCIETY MAHENDRU
2807 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
2808 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
2809 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
2810 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
2811 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
2812 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
2813 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
2814 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
2815 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
2816 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2817 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2818 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
2819 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
2820 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
2821 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
2822 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
2823 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
2824 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
2825 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2826 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2827 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
2828 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2829 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
2830 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2831 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
2832 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2833 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
2834 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
2835 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
2836 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
2837 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
2838 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
2839 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
2840 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
2841 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
2842 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
2843 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
2844 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
2845 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2846 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2847 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
2848 SADGUNA TECHNOLOGIES NAIMNAGAR
2849 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
2850 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
2851 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
2852 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
2853 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
2854 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
2855 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
2856 SAFDSF SADFASD
2857 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
2858 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
2859 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
2860 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
2861 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
2862 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
2863 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
2864 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
2865 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
2866 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
2867 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
2868 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
2869 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
2870 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
2871 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
2872 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
2873 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
2874 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
2875 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
2876 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
2877 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
2878 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
2879 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
2880 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
2881 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
2882 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
2883 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
2884 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
2885 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
2886 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
2887 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
2888 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
2889 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
2890 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
2891 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
2892 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
2893 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
2894 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
2895 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
2896 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
2897 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
2898 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
2899 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2900 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2901 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
2902 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
2903 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
2904 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
2905 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
2906 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
2907 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
2908 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
2909 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
2910 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
2911 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
2912 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
2913 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2914 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2915 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2916 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2917 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
2918 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
2919 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
2920 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
2921 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
2922 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
2923 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
2924 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2925 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2926 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2927 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2928 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
2929 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
2930 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
2931 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
2932 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
2933 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
2934 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2935 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2936 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
2937 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
2938 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
2939 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
2940 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
2941 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
2942 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
2943 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
2944 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
2945 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
2946 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
2947 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
2948 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
2949 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
2950 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
2951 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
2952 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
2953 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
2954 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2955 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2956 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
2957 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
2958 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
2959 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
2960 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
2961 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
2962 SANDEEP TEST ASDASDASD
2963 SANDESH MNGO INDIA INDIA 1 INDORE
2964 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
2965 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
2966 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
2967 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
2968 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2969 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
2970 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2971 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
2972 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
2973 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
2974 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
2975 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
2976 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
2977 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
2978 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
2979 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
2980 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
2981 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
2982 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
2983 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
2984 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
2985 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
2986 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
2987 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
2988 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
2989 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
2990 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
2991 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
2992 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
2993 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
2994 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
2995 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
2996 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
2997 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
2998 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
2999 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
3000 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
3001 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
3002 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
3003 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
3004 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
3005 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
3006 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
3007 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
3008 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
3009 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
3010 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
3011 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
3012 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
3013 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
3014 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
3015 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
3016 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
3017 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3018 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3019 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
3020 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
3021 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
3022 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
3023 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
3024 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
3025 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
3026 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3027 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3028 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
3029 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3030 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3031 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3032 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3033 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3034 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3035 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
3036 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
3037 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
3038 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
3039 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
3040 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
3041 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
3042 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
3043 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
3044 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
3045 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
3046 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
3047 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
3048 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
3049 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
3050 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
3051 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
3052 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3053 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3054 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
3055 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
3056 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
3057 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
3058 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3059 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3060 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3061 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3062 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
3063 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
3064 SATYAM SKILLS CENTER VISHAKAPATNAM
3065 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
3066 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
3067 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
3068 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
3069 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
3070 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
3071 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
3072 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
3073 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
3074 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
3075 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
3076 SBDA AT-GVBBGFHGFBFGB
3077 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
3078 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
3079 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
3080 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
3081 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
3082 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3083 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3084 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
3085 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
3086 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
3087 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
3088 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
3089 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3090 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
3091 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3092 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3093 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3094 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
3095 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
3096 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
3097 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
3098 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
3099 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3100 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3101 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
3102 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
3103 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
3104 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
3105 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
3106 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
3107 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
3108 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
3109 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
3110 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
3111 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
3112 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
3113 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
3114 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
3115 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
3116 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
3117 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
3118 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
3119 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
3120 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3121 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3122 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
3123 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
3124 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
3125 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
3126 SEVICA 1 SARAI KHAWAJA
3127 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
3128 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
3129 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
3130 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
3131 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
3132 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
3133 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3134 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
3135 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
3136 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
3137 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
3138 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
3139 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3140 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3141 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
3142 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
3143 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
3144 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
3145 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3146 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3147 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3148 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
3149 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
3150 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
3151 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
3152 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
3153 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
3154 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
3155 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
3156 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
3157 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
3158 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
3159 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
3160 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
3161 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
3162 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
3163 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
3164 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
3165 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
3166 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3167 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
3168 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3169 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
3170 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
3171 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3172 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
3173 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
3174 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3175 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
3176 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
3177 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
3178 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
3179 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
3180 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3181 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3182 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3183 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
3184 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
3185 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
3186 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
3187 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
3188 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
3189 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
3190 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3191 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3192 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
3193 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
3194 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
3195 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
3196 SHODH 180/22, ZAKIR NAGAR, OKHLA
3197 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
3198 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
3199 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
3200 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
3201 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
3202 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3203 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3204 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3205 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
3206 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
3207 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
3208 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
3209 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3210 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3211 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
3212 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
3213 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
3214 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
3215 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
3216 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
3217 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
3218 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
3219 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
3220 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
3221 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
3222 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
3223 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
3224 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
3225 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
3226 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
3227 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
3228 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
3229 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
3230 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
3231 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
3232 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3233 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3234 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
3235 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
3236 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
3237 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
3238 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
3239 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
3240 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
3241 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
3242 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3243 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3244 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
3245 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
3246 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
3247 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
3248 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
3249 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
3250 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
3251 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
3252 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
3253 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
3254 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
3255 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
3256 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3257 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3258 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
3259 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
3260 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
3261 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
3262 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
3263 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
3264 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
3265 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
3266 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
3267 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
3268 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
3269 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
3270 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
3271 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3272 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
3273 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
3274 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
3275 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3276 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3277 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
3278 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITIA KARAHIFATEHPURSIKRIAGRA
3279 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
3280 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
3281 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3282 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3283 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3284 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3285 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
3286 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
3287 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
3288 SHRI SHIKSHA PRASAR EVAM JANKALYAN SAMITI 26,BAJARIYA MOHALLA SEONDHA DISTT DATIA MADHYA PRADESH
3289 SHRI SIDDHIVINAYAK EDUCATION SOCIETY CINEMA ROAD WARD NO 6 JUNNARDEO
3290 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
3291 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
3292 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
3293 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
3294 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
3295 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
3296 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
3297 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
3298 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
3299 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
3300 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
3301 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
3302 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
3303 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
3304 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3305 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
3306 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
3307 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3308 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
3309 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
3310 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
3311 SIKSHYA BHARATI TRUST SIKSHYA BHARATI TRUST COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK STATE-ODISHA
3312 SIKSHYA BHARATI TRUST AT-COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK
3313 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
3314 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
3315 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
3316 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3317 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3318 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3319 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3320 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3321 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3322 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3323 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
3324 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
3325 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
3326 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3327 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3328 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3329 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3330 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3331 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
3332 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
3333 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
3334 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
3335 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
3336 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
3337 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
3338 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
3339 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
3340 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
3341 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
3342 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
3343 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
3344 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
3345 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3346 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3347 SJP HOTELS AND RESORTS PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
3348 SJS SKILLS DEVELOPMENT CENTER A UNIT OF SHRI JYOTI SERVICES P LTD SM KUTEER ,92 CIVIL LINE MEERUT CANTT
3349 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
3350 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
3351 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
3352 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
3353 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
3354 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
3355 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
3356 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
3357 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
3358 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
3359 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
3360 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
3361 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
3362 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
3363 SKILL VISION SOCIAL EDUCATIONAL SOCIETY 81 KOHARAPEER THALIWALAN CHOWK BAREILLY
3364 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
3365 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
3366 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3367 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
3368 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3369 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
3370 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
3371 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
3372 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3373 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3374 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3375 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
3376 SMART SKILL TECH PRIVATE LIMITED PLOT NO 137 SEC 24
3377 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
3378 SMART ZONE GUNJABARI
3379 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
3380 SMITA MAHILA SHIKSHAN SANSTHAN 567 ANAND COLONY BALDEOBAG JABALPUR MADHYA PRADESH 482002
3381 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
3382 SMT DEVKI DEVI SEVA SAMITI L.I.G. GOVIND PUR ALLAHABAD
3383 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
3384 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
3385 SNAP NEAR MANIPAL HOSPITALS
3386 SNC INFOTECH PRIVATE LIMITED KC-114, KAVI NAGAR , GHAZIABAD
3387 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
3388 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
3389 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
3390 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3391 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3392 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
3393 SOCIAL DEVELOPMENT ORGANISATION H.NO. 50, MASOUD ALI BUILDING, TAAJ LEIRAK, HAFIZ HATTA, IMPHA EAST,MANIUR -7095001
3394 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
3395 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 4 HOUSE NO C-31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR NEW DELHI
3396 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 3 HOUSE NO C 31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR
3397 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
3398 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
3399 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
3400 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
3401 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
3402 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
3403 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
3404 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
3405 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
3406 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
3407 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
3408 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
3409 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
3410 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
3411 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
3412 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
3413 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
3414 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
3415 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
3416 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
3417 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
3418 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
3419 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
3420 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
3421 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEVELOPMENT VILLAGE & P.O- KANISHAIL P.S & DISTRICT- KARIMGANJ
3422 SOCIETY FOR EDUCATION AND SOCIAL ACTIVITIES FF-31, SF-30,31,19,VATSALYA STATUS, OPP RAILWAY STATION, KADI
3423 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
3424 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
3425 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
3426 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
3427 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
3428 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
3429 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
3430 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
3431 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
3432 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
3433 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
3434 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
3435 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
3436 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
3437 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
3438 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
3439 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
3440 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
3441 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
3442 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
3443 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
3444 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
3445 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
3446 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
3447 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
3448 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
3449 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
3450 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
3451 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
3452 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
3453 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
3454 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
3455 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
3456 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
3457 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
3458 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
3459 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
3460 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
3461 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
3462 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
3463 SONAPUR PALLY UNNAYAN SAMITY SONAPUR PART-I,PO-SONAPUR,DISTRICT-CACHAR
3464 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
3465 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
3466 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
3467 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3468 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3469 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3470 SONY XPERIA FGFDGFGFD
3471 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
3472 SOS CARE INDIA C-88/A,GF, GALI NO.3,KAUSHIK SADAN, JANTA GARDEN,PANDAV NAGAR,DELHI-91
3473 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
3474 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
3475 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR
3476 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR (CG)
3477 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
3478 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3479 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
3480 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
3481 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
3482 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
3483 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
3484 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
3485 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
3486 SPARSH 310 CHANDRALOK TOWER KAPOORTHALA, LUCKNOW
3487 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
3488 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3489 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3490 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3491 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3492 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
3493 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
3494 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3495 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
3496 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
3497 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
3498 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3499 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
3500 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
3501 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3502 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
3503 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
3504 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
3505 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
3506 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
3507 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
3508 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
3509 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
3510 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
3511 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
3512 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
3513 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
3514 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3515 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3516 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
3517 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
3518 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
3519 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
3520 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
3521 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA
3522 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
3523 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
3524 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
3525 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
3526 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3527 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
3528 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3529 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
3530 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
3531 SRI GOKULAM TRUST 13,KALIAMMAN KOVIL ST, KOOMAPATTI, SRIVALLIPUTHUR TK, VIRUDHUNAGAR DT
3532 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
3533 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
3534 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
3535 SRI JYOTHI HUMAN RESOURCES WELFARE ASSOCIATION 23-66/A/1/ MADHURA NAGAR SHAMSHABAD,9490324304
3536 SRI KALAI HERBAL BEAUTY PARLOUR MAHILA SANGHA #141 NEW 7 11 MAIN 1ST CROSS K P AGRAHARA BANGALORE
3537 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3538 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3539 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
3540 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
3541 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
3542 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3543 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3544 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3545 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
3546 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
3547 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
3548 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
3549 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
3550 SRI MAHESWARA EDUCATIONAL TRUST SET 1/154,SILLARAHALLI VILL & PO,PAPPIREDDIPATTI TK,DHARMAPURI DT,TAMILNADU,INDIA
3551 SRI MAHESWARA EDUCATIONAL TRUST SET HOME ADDRESS: 1/154,SILLARAHALLI (VILL & PO),PAPPIREDDIPATTI (TK),DHARMAPURI (DT)-635303. OFFICE ADDRESS:SRI GURU MAHESWARA PARAMEDICAL INSTITUTION,PAPPIREDDIPATTI ( VILL & PO & TK),DHARMAPURI (DT)
3552 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
3553 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
3554 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
3555 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
3556 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
3557 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
3558 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
3559 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3560 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3561 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3562 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3563 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3564 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
3565 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
3566 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
3567 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
3568 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3569 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
3570 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3571 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
3572 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3573 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
3574 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: DOOR NO: 75621, FLOT NO.8, JETTI DELUX APARTMENT, PRAKASH NAGAR, RAJAHMUNDRY533103. EAST GODAVAI DISTRICT.
3575 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
3576 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
3577 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3578 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
3579 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
3580 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
3581 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
3582 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
3583 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
3584 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
3585 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
3586 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3587 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3588 SRI SATHYA SAI EDUCATIONAL AND CHARITABLE TRUST M/S.DR.M.G.R INSTITUTRE CAMPUS, NO.8,NEDUMARAN NAGAR
3589 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
3590 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
3591 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
3592 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
3593 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
3594 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
3595 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
3596 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
3597 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATRE, M.G.ROAD, TUMKUR
3598 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
3599 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY YASHODAGANASHREE NILAYA 8TH CROSS, SAPTHGIRI EXTN. TUMKUR-
3600 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
3601 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3602 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3603 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3604 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
3605 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
3606 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
3607 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
3608 SRISTI FOUNDATION 8TH FLOOR , RESHMI COMPLEX , P & T COLONY , KIDWAIPURI , PATNA
3609 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
3610 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
3611 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
3612 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
3613 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
3614 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
3615 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
3616 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
3617 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
3618 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
3619 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
3620 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
3621 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
3622 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
3623 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
3624 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI TALUK, THIRUVALLUR DISTRICT
3625 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
3626 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
3627 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
3628 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
3629 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
3630 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
3631 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
3632 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
3633 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
3634 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
3635 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
3636 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
3637 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
3638 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
3639 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
3640 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
3641 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
3642 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
3643 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
3644 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
3645 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
3646 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
3647 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
3648 SSC DDHGH
3649 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
3650 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
3651 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
3652 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
3653 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
3654 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
3655 SSR SERVICES INDIA LLP # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
3656 SSR SERVICES INDIA LLP 17-89/4, MAIN ROAD, OPP SBI, PENDURTHY, VISAKHAPATNAM-531173, ANDHRAPRADESH
3657 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
3658 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
3659 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
3660 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
3661 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
3662 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
3663 STAR SCHOOL SAMITI SHIV KUMAR SINGH INSTITUTE OF TECHNOLOGY AND SCIENCE RAU NEAR IIM PITHAMPUR BYPASS ROAD INDORE
3664 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
3665 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
3666 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
3667 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
3668 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
3669 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3670 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3671 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3672 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
3673 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
3674 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
3675 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
3676 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
3677 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
3678 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
3679 STEP AHEAD FOUNDATION 410,4TH FLOOR, SUNDARAM BUILDING, RDC, RAJ NAGAR, GHAZIABAD.
3680 STEP TO FORWARD SANSTHAN 43, D NEW CIVIL LINES FATEHPUR
3681 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
3682 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
3683 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
3684 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
3685 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
3686 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
3687 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
3688 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
3689 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI
3690 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI BLOCK- KACHHAUNA DISTRICT- HARDOI
3691 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
3692 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
3693 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
3694 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
3695 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
3696 SUBHIKSAM CHARITABLE TRUST NO:1, ARUNACHALAESWARER COMPLEX,PONNAI KOOT ROAD,THIRUVALAM,KATPADI TK,VELLORE DT
3697 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
3698 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
3699 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
3700 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
3701 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
3702 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
3703 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
3704 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
3705 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
3706 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
3707 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
3708 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
3709 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
3710 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
3711 SUNRISE EDUCATION AND WELFARE SOCIETY B-1/3716, BHAGWAN PUR KHERA, SHAHDARA, DELHI
3712 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
3713 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH KALAHANDI
3714 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH
3715 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
3716 SUPER COMPUTERS GENERAL BUS STAND ANANTNAG
3717 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
3718 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
3719 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
3720 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3721 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3722 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3723 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
3724 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
3725 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
3726 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
3727 SURAJ FOUNDATION VILLAGE AND POST JAGIR
3728 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
3729 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
3730 SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED, H NO 2-152,VANI NAGAR, MALKAJGIRI, HYDERABAD, TS
3731 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
3732 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
3733 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
3734 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN,NEAR BUS STAND
3735 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
3736 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
3737 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
3738 S V EDUCATION AND INFRASTRUCTURE PRIVATE LIMITED 2-1-5/34 PLR LUXURY HOMES UPPERPALLY HYDERABAD
3739 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
3740 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
3741 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
3742 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
3743 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
3744 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
3745 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
3746 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
3747 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
3748 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
3749 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
3750 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
3751 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
3752 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
3753 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR KANPUR
3754 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR, KANPUR
3755 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3756 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3757 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3758 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
3759 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
3760 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
3761 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
3762 SWASTHAY SHIKSHA EVAM VYAKTIGAT VIKAS ANUSANDHAN KENDRA B-455, STREAT NO. 30, MAHAVIR ENCLAVE PART-II, NEAR SEC-2, DWARKA NEW DELHI
3763 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
3764 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
3765 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
3766 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
3767 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
3768 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
3769 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
3770 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
3771 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
3772 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
3773 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
3774 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
3775 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
3776 TALISMA TEST TALISMA TEST, TALISMA TEST
3777 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
3778 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
3779 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
3780 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
3781 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
3782 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
3783 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
3784 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
3785 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
3786 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
3787 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
3788 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
3789 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
3790 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3791 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3792 TECH MECH INTERNATIONAL P LTD 92 CIVIL LINES S M KUTEER MEERUT
3793 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
3794 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
3795 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
3796 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
3797 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
3798 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, ALIGANJ, NEAR ENGG COLLEGE CROSSING
3799 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
3800 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
3801 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
3802 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
3803 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
3804 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
3805 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
3806 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
3807 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
3808 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3809 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3810 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3811 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3812 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
3813 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3814 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3815 TERNA PUBLIC CHARITABLE TRUST SOLAPUR ROAD, OSMANABAD 413501
3816 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
3817 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
3818 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
3819 TEST TEST
3820 TEST GUWAHATI METRO
3821 TEST123 QLJLFHLJQ
3822 TEST1234TEST TEST
3823 TEST ABCD 5678 TESTABCD5678
3824 TESTDATA TEMP DELHI
3825 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
3826 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
3827 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
3828 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
3829 TEST FOR MAIL JADGSJAS
3830 TESTING TEST
3831 TESTM2 ASDWDDV
3832 THAKUR KARAM SINGH CHARITABLE TRUST V.P.O. LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
3833 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
3834 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
3835 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET,PODATUR PET,PALLIPET TALUK,
3836 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET, PODATUR PET PALLIPET TALUK, TIRUVALLUR DISTRICT
3837 THANDAVA VENKATESA MUTHALIYAR EDUCATIONAL TRUST 63,EST NAGART,1ST STREET, PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT, TAMILNADU
3838 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
3839 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
3840 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3841 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
3842 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
3843 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
3844 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3845 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
3846 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
3847 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
3848 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
3849 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3850 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3851 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
3852 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
3853 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
3854 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
3855 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
3856 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
3857 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
3858 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
3859 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO/PS THOUBAL, MANIPUR
3860 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
3861 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI
3862 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI NEAR DEPUTY COMMISSIONER COMPLEX.THOUBAL
3863 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
3864 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
3865 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
3866 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
3867 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
3868 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
3869 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
3870 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
3871 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
3872 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
3873 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
3874 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
3875 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
3876 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3877 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3878 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
3879 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
3880 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3881 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
3882 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3883 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3884 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3885 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3886 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3887 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3888 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
3889 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
3890 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
3891 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
3892 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
3893 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
3894 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
3895 TNR SAINIK ACADEMY SOCIETY SURVEY NO.108, BAHADURPALLY VILLAGE, QUTHBULLAPUR, MEDCHAL
3896 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
3897 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
3898 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
3899 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
3900 TOUCH IN ASSOCIATES PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA, PIN - 752101
3901 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
3902 TRANSKILL TRAINING AND CONSULTANCY SERVICES PVT LTD 2ND FLOOR OFFICE NO. 237, KOHINOOR MAJESTIC THERMAX CHOWK CHINCHWAD, PUNE
3903 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
3904 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
3905 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
3906 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
3907 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
3908 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
3909 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
3910 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR
3911 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR DIST.CHHOTAUDEPUR.GUJARAT
3912 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
3913 TRIMURTI WELDMESH PRIVATE LIMITED B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3914 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3915 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3916 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
3917 TRIOS DEVELOPMENT SUPPORT PRIVATE LIMITED T-33, MANISH GLOBAL MALL, PLOT NO-2, OPP. MOUNT CARMEL SCHOOL, SECTOR-22
3918 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
3919 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
3920 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
3921 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
3922 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
3923 TRIVEDI AND ASSOCIATE TECKNICAL SERVICE PRIVATE LIMITED 102, SIDCUP TOWER, RACE COURSE, VADODARA
3924 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
3925 TRP HUI NAGAR
3926 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
3927 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
3928 TULJABHAVNI GRAM VIKAS SEVABHAVI SANSTHA C/O TOTE R G AT POST TQ PATODA DIST BEED
3929 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
3930 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
3931 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
3932 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
3933 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
3934 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
3935 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3936 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3937 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
3938 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
3939 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
3940 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
3941 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
3942 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI,COIMBATORE
3943 UDHAYAM TRUST 187,RAJA MILL ROAD, POLLACHI
3944 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
3945 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
3946 UDYOG VIKAS SANSTHAN N11/106 LANE NO.2 SRI RAM NAGARA COLONY KAKKARMATTA
3947 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
3948 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
3949 ULTIMATUM INFORMATICS PRIVATE LIMITED SUMANGAL APARTMENT, 99 BT. ROAD, IST FLOOR P.O-KHARDAH KOLKATA KOLKATA WB 700117
3950 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
3951 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
3952 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
3953 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
3954 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
3955 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
3956 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
3957 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
3958 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI
3959 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
3960 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
3961 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
3962 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
3963 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
3964 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
3965 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
3966 UNIVERSAL EDUCATIONAL SOCIETY VILLAGE BALLOPUR, P.O- LALRU, DISTT: DERABASSI
3967 UNIVERSAL IDEAL SEWA SAMITI VILL AND POST MAHULI, PS- WYNDHAMGANJ, SONBHADRA (U.P.), 231208
3968 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
3969 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
3970 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
3971 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLE, SARADA BABU LANE, LINE TANK ROAD, RANCHI
3972 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
3973 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
3974 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
3975 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
3976 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
3977 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
3978 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
3979 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK BHOTIA PAROW HALDWANI
3980 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
3981 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
3982 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
3983 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
3984 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ-33A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3985 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ 33 A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3986 URJA GLOBAL LIMITED 487/63, 1ST FLOOR, NATIONAL MARKET, PEERAGARHI, NEW DELHI
3987 URMIDWAR INNOVATIVE ACTION AND RESEARCH FOUNDATION 18,DWARIKAPURAM,NEAR ASHARAM TRUST,CIRCULAR ROAD,BHARATPUR-321001
3988 USHODAYA RURAL AND URBAN DEVELOPMENT VOLUNTARY ORG O V ROAD MRO OFFICE COMPOUND BESIDE E SEVA KANDUKURU 523105 PRAKASAM DT ANDHRA PRADESH
3989 USIT INFOCOM PVT LTD A-152 GALI NO-4 SHAKARPUR DELHI
3990 USIT INFOCOM PVT LTD A-152,GROUND FLOOR,GALI NO-5,ARUNA PARK,SHAKARPUR NEW DELHI
3991 UTKAL BIPANNA SAHAYATA SAMITI PLOT NO-41,SECTOR-A,ZONE-D MANCHESWAR INDUSTRIAL ESTATE CITY-BHUBANESWAR,DIST-KHORDHA STATE-ODISHA
3992 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3993 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3994 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3995 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO- COLLEGE SQUARE,CUTTACK
3996 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3997 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3998 UTL TECHNOLOGIES LIMITED NO 19 6 ASHOKPURAM SCHOOL ROAD INDUSTRIAL SUBURB YESHWANTHPUR BENGALURU
3999 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4000 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4001 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4002 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUTOLA UTTARKASHI
4003 UVA JAGRITI SANSTHAN IN FRONT OF GRAM PANCHYAT BANSUR ALWAR RAJASTHAN PIN 301402
4004 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR,OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4005 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR, OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4006 VAG MANAGEMENT SERVICES D-42, GROUND FLOOR, SOUTH EXTENSION PART-1, NEW DELHI
4007 VAIDYANATH SARVANGIN VIKAS SANSTHA AT BRAHMAWADI, POST -TOKWADI, PARLI-BEED STATE HIGHWAY, PARLI-V., DIST. BEED
4008 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET,TENKASI,TIRUNELVELI
4009 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET TENKASI TIRUNELVELI DIST TAMILNADU
4010 VAISHNAVI COMPUTER AND EDUCATION SOCIETY PATHA THANA ., CHANDANGAON CHHINDWARA
4011 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4012 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4013 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST YAVATMAL
4014 VALEUR FABTEX PRIVATE LIMITED B-39, TRIVENI NAGAR, NEAR GOPALPURA BYPASS, JAIPUR, RAJASTHAN
4015 VALHALL EXPORTS PRIVATE LIMITED VALHALL EXPORTS PVT LTD,229,DSIDC SHEDS,OKHLA INDUSTRIAL AREA,PHASE-1,NEW DELHI-110020
4016 VALLEY OF TECHNICAL INSTITUTE AND TRUST KALI MANDIR LANE, OPP. RAMVILAS PETROL PUMP, RATU ROAD, P.O.+P.S.- SUKHDEV NAGAR, RANCHI
4017 VALUE ADD KNOWLEDGE SERVICES PRIVATE LIMITED STILTH FLOOR, MAXIMUS 2B, RAHEJA MINDSPACE IT PARK, HITECH CITY,MADHAPUR, RANGAREDDY, TELANGANA-500081
4018 VAMANI OVERSEAS PRIVATE LIMITED 169 SECTOR 24
4019 VANDEMATRAM IDEAL PUBLIC SOCIETY GWALIOR VILL& POST BARAUA NEW BY PASS HIGHWAY TIRAHA AB ROAD VIPS COLLEGE CAMPUS GWALIOR
4020 VANI SANSTHA 126, MAHAVEER NAGAR Y, 80 FEET ROAD, NEAR ADARSH VIDYA MANDIR, SANGANER , JAIPUR, RAJASTHAN
4021 VANITHA JYOTHI MAHILA SANGAM H.NO: 8-44/2, SRI SAI NAGAR COLONY, SAROOR NAGAR, RANGA REDDY, TELANGANA(STATE)
4022 VANUSRA SOLUTIONS AND ENTERPRISES PVT LIMITED OPC REGISTERED ADDRESS: NEW NO 29/G2, N R FLATS, 6TH STREET, ALAGIRI NAGAR, VADAPALANI, CHENNAI, TAMILNADU. CORPORATE OFFICE: 11/23, 5TH FLOOR, K R BUILDING, L B ROAD, ADYAR, CHENNAI, TAMILNADU
4023 VAP TECHNOLOGY UNDER VIDYA SOCIETY SHRI GURU TEGH BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4024 VARAIYA KRISHI BAGVANI EVAM JAN KALYAN SAMITI AMOLPATHA NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI M.P.
4025 VARAIYA VOCATIONAL TRAINING INSTITUTE NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI
4026 VARDHANA SOCIETY D.NO:22-366/RP, DODDIPALLI ROAD, CHITTOOR
4027 VARDMAN SOCIETY 612, RAMKISHAN MARKET CHANDI ROAD HAPUR
4028 VARHAD VIKAS BAHUUDDES SHIKSHAN PRASARAK MANDAL HIWARKHED VARHAD VIKAS BAHUUDDESHIYVA SHIKSHAN PRASARAK MANDAL HIWARKHED C/O MANISH V BHAMBURKAR AT/PO HIWARKHED (RUPRAO)TQ.TELHARA DST.AKOLA
4029 VASANTHALAKSHMI CHARITABLE TRUST AND RESEARCH CENTRE 16-2-131, KASTURIDEVI NAGAR, POGATHOTA, NELLORE
4030 VASANTHAM EDUCATIONAL AND RURAL DEVELOPED SOCITY 14A,SATHIYANARAYANAN STREET, VENKATASAPURI,
4031 VASAVYA MAHILA MANDALI 40-9/1-16 VASAVYA NAGAR, BENZ CIRCLE VIJAYAWADA
4032 VAS KNOWELDGE GROWTH INITATIVES PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
4033 VAS KNOWLEDGE GROWTH INITIATIVE PVT LTD B-73, NIRALA NAGAR
4034 VAS KNOWLEDGE GROWTH INITIATIVES PVT LTD 320, SYNDICATE HOUSE INDERLOK DELHI
4035 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4036 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4037 VASUNDHARA NZARAPAR JAGIROAD
4038 VASUNDHARA NIZARAPAR JAGIROAD
4039 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4040 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4041 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4042 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4043 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4044 VASUNDHARA VIDYAPRASARAK V K S V SANSTHA REG.OFFICE- AT-DWARKADHISH BHAWAN,NIWANE,TAL-KALWAN,DT-NASIK PROJECT OFFICE- PANDURANG NAGAR,MANMAD,DT-NASIK
4045 VATIKA BHAGYA SHASTRA LLP HEAD OFF:- CUG-1, 1 ST FLOOR, JUMBO HOUSE, 15. DR. JHA MARG , OKHLA PHASE-3, SOUTH DELHI DELHI
4046 VATSALYA EDUCATION AND CHARITABLE TRUST 2ND FLOOR KRISHNA SHRUSTI APARTMENT 10JUNCTION PLOT
4047 VAYAM INFO SOLUTIONS PVT LTD B-157, LOWER GROUND FLOOR, CHITRANJAN PARK, NEW DELHI
4048 VAYAM TECHNOLOGIES LIMITED THAPAR HOUSE, 124, JANPATH, NEW DELHI
4049 V DO SKILLS AND MICRONET LLP 21213B, STREET NO. 2B, AJIT ROAD, BATHINDA
4050 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4051 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4052 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4053 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4054 VEERA EDUCATIONAL SOCIETY #3-20-1/10, RAM MOHAN RAJA NAGAR, KAKINADA, KAKINADA MANDAL, EAST GODAVARI DISTRICT, AP
4055 VEER INDRA SOCILA GROUP SOCIETY ZILA PARTHMIKSHIK SHAK SHANG SIYARAMNAGAR, BHIHKHANPUR,BHAGALPUR
4056 VEER PAL VILL NARKHERA POST NIPANIYA TEH MILAK RAMPUR
4057 VEER VIJAY EDUCATION SOCIETY VILL & POST-SUNDERPUR, DISTRICT-SAHARANPUR, UP
4058 VEE TECHNOLOGIES PVT LTD NO 71,SONA TOWERS,MILLERS ROAD,7TH FLOOR, BANGALORE
4059 VELLORE ACADEMY NO:508/A, VERSHEN COMPLEX 3RD FLOOR, MUTHURANGAM GOVT ARTS COLLEGE ROAD, OTTERI, VELLORE. TAMILNADU.
4060 VELS UNIVERSITY VELS INSTITUTE OF SCIENCE TECHNOLOGY AND ADVANCED STUDIES (VISTAS) ADDRESS : VELAN NAGAR, P V VAITHIYALINGAM ROAD, PALLAVARAM, CHENNAI - 600 117
4061 VEMULA BHASKAR FOUNDATION ELURU MINI BYPASS ROAD, GREEN CITY, PLOT NO 9.
4062 VENDOR PLUS CONSULTANTS PRIVATE LIMITED SP-49-A, MAIN MARKET PANDAV NAGAR, OPPOSITE MOTHER DAIRY, PATPARGANJ,DELHI-110092 INDIA
4063 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE JONNALAGADDA(V), NARASARAOPET, GUNTUR DISTRICT
4064 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE,JONNALAGADDA,NARASARAOPET,GUNTUR
4065 VENKATESWARA SKILL FOUNDATION 12/13,RAJAYYA VEEDI, GORANTLA, ANANHAPUR, ANANTAPUR, ANDHRA PRADESH, INDIA, 515231
4066 VENUS COMPUTER EDUCATIONAL INSTITUTION 76, ALAGAR KOIL ROAD, GORIPALAYAM BUS STOP, MADURAI
4067 VERSATILE INFOSECURITY PRIVATE LIMITED M-73A, LGF, MALVIYA NAGAR, NEW DELHI
4068 VFX ANIMATION COLLEGE # 28/1 SKT COMPLEX,KAKKALUR ROAD THERADI THIRUVALLUR DIST
4069 VGENUINE SOLUTIONS PRIVATE LIMITED BUILDING 7 SIDCO RANGRETH
4070 VGENUINE SOLUTIONS PRIVATE LIMITED FIRST FLOOR BUILDING 7 SIDCO IE RANGRETH
4071 VIBHA EDUCATIONAL DEVELOPMENT SOCIETY #2-31, VIDYA NAGAR, OPP. JNTU MAIN GAYE, ANANTAPUR, ANDHRA PRADESH.
4072 VIDHARBH RURAL RECONSTRUCTION FOUNDATION KONGHARA AT.KONGHARA POST.PIMPRI TQ.KELAPUR DIST YAVATMAL
4073 VIDHYADEEP SOCIETY P.O NARMADA NAGAR, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4074 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NR. MUKHTANAND SOCIETY, NARMADANAGAR, BHARUCH.
4075 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4076 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4077 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4078 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA VIDISHA
4079 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA
4080 VIDIYAL MAHALIR MEBATTU SANGAM 29K-RAMNAGAR, DEVAKOTTAI, SIVAGANGAI-DIST
4081 VIDIYAL MAHARIL MEMBATTU SANGAM 29K RAMNAGAR, DEVAKOTTAI SIVAGANGAI-DIST
4082 VIDYA VAP TECHNOLOGY SHREE GURU TEG BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4083 VIDYA NR KHALSA SCHOOL SUBASH NAGAR NAINITAL ROAD HALDWANI
4084 VIDYA GURU TEG BAHADUR TOWER, NEAR KHALSA SCHOOL, THANDI SADAK, SUBHASH NAGAR
4085 VIDYA SHRI GURU TEG BAHADUR TOWER NEAR KHALSA GIRLS SCHOOL NAINITAL ROAD HALDWANI NAINITAL
4086 VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, COCHIN UNIVERSITY ROAD, CUSAT P.O, COCHIN
4087 VIDYADHIRAJA EDUCATION SOCIETY 27/3, ANAND NAGAR, KHANDELWAL MARG, MUMBAI
4088 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI
4089 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE, PATPARGANJ, EAST DELHI
4090 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI 110096
4091 VIDYA NIKETAN SEVABHAVI SANSTHA DONGARGAON DONGARGAON PO. DONGARPIMPALA TQ. GANGAKHED DIST. PARBHANI
4092 VIDYASAGAR ADEVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4093 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4094 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4095 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR 482003
4096 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463, KHANKA ROAD, LALLU POKHAR , MUNGER
4097 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED MISHRA COLONY, KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4098 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463,MISHRA COLONY KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4099 VIJAYA SOCIAL EDUCATIONAL AND CULTURAL TRUST #986, 2ND MAIN,VIDYARANYAPURAM, MYSORE - 570 008
4100 VIJAY GANGA RURAL MEDICAL AND RESEARCH FOUNDATION AT/P – BHALWANI, TAL-PARNER, DIST-AHMEDNAGAR. MAHARASHTRA
4101 VIJAY KUMAR CONTRACTOR HO. NO. - 37, MODERN SAKET COLONY, HISAR.
4102 VIJAY LAXMI TRANSPORT PRIVATE LIMITED AT.GANDHI CHOWK PO- BRAJRAJNAGAR DIST-JHARSUGUDA ODISHA
4103 VIKALP SEWA SAMITI 94, PASCHIMI TARAUS
4104 VIKASH D-2/7, INDUSTRIAL ESTATE RASULGARH, BHUBANESWAR
4105 VIKASH EDUCATION SOCIETY H.NO 1648 URBAN ESTATE JIND
4106 VIKASSHEEL FOUNDATION GRAM PANCHAYAT BHAVAN KE PAS, SHIVTARAI, TAHSIL-KOTA, BILASPUR, CHHATISGARH.
4107 VIKRANT EDUCATIONAL AND SOCIAL WELFARE SOCIETY 3-B ASHIRWAAD, HARIOM COLONY, 7 NO CROSSING, MORAR,GWALIOR
4108 VILLAGE DEVELOPEMNT AND ENVIRONMENTAL ORGANISATION THE SECRETARY NEAR TO INDIAN OVERSEAS BANK., KADAYAMPATTY POST, OMALUR TK., SALEM DISTRICT TAMILNADU
4109 VILLAGE DEVELOPMENT TRUST 63/25, KAMARAJ NAGAR, 3RD STREET, CHOOLAIMEDU, CHENNAI. CECIL ROGERS SALES HEAD 9884922452 9677256296
4110 VILLAGE INDIA KALYAN SANSTAHN KAUSHAL VIKAS PRASHIKSHAN KENDRA
4111 VILLAGE INDIA KALYAN SANSTAHN FRONT ON STATE BANK BINDKI(FATEHPUR)-212635
4112 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI
4113 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI ,FATEHPUR-212635 U.P
4114 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI(212635)-FATEHPUR U.P
4115 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI (FATEHPUR)-212635
4116 VILLAGE MULTIMEDIA PVT LTD NO.4, 1ST FLOOR, SUNRISE BUILDING, OPP KLE COLLEGE ,2ND STAG
4117 VIMALA DEVI SEWA SANSTHAN LOHIYA NAGAR MAHARAJGANJ
4118 VIMALAGIRI VIDYAPEETAM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 686664
4119 VINAYAGAR PERARASAR TRUST VPT 2/71 SABANAYAGAR STREET MA UAIDAYAR POST KATTUMANNARKOIL TALUK
4120 VINDHYA CONSULTANTS AND SERVICES PRIVATE LIMIITED KOTHI GULJAR BAG,OPPOSITE MULTIPURPOSE SCHOOL,BHARATPUR(RAJ.)
4121 VINOD JAIN SMRITI JAN KALYAN SAMITI 201, MAHESHWARI COMPLEX, POWER HOUSE ROAD, WARD NO. 25, RATLAM
4122 VIRAJ GLOBAL SECURITAS PVT LTD B 156 NEW ASHOK NAGAR , NEW DELHI
4123 VIRAT VOLUNTARY ORGANIZATION FOR RURAL AGRICULTUR VILLAGE DEVARGHATA TEH- DABHRA DIST-JANJHGIR CHAMPA C G
4124 VIRAT VOLUNTARY ORG RURAL AGRI AND TECHNOLOGY 47, SUKH SAGAR PHASE 3, PIPLANI BHOPAL
4125 VIRINCHI LIMITED PLOT NO 10, SRK COLONY, WEST MAREDPALLY, SECUNDERABAD
4126 VIRTUAL COMPUTER EDUCATION SHIV NAGAR NH-1A UDHAMPUR (J&K)
4127 VIRTUAL COMPUTER EDUCATIONAL SOCIETY SHIV NAGAR NH-1A
4128 VIRTUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 TILWARA ROAD APPOSITE HP PATROL PUMP SAGRA JABALPUR
4129 VIRTUE INTERNATIONAL PRIVATE LIMITED 63, ESPACE NIRVANA COUNTRY, SECTOR - 50
4130 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE MANAGING BOARD ROSALPATTI VILLAGE VIRUDHUNAGAR POST 626 001
4131 VISHNU DAYAL SHIKSHA SAMITI 529K/197 SANT KABIR LANE KHURRAM NAGAR LUCKNOW 226022
4132 VISHNU DAYAL SHIKSHA SAMITI 529K/197, SANT KABIR LANE, KHURRAM NAGAR, LUCKNOW
4133 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL, G.T ROAD, GHAZIABAD
4134 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL G.T. ROAD GHAZIABAD
4135 VISHVESHWARYA SCHOOL OF BUSINESS 17,KIRAN ENCLAVE NEAR SAMRAT HOTEL, G.T. ROAD GHAZIABAD
4136 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE,NEAR SAMRAT HOTEL, G.T. ROAD, GHAZIABAD
4137 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL , G.T. ROAD GHAZIABAD
4138 VISHWABHARATHI EDUCATIONAL DEVELOPMENT TRUST 117 NIZAMPET ROAD KUKATPALLY BRINDAVAN COLONY HYDERABAD
4139 VISHWA BHARATI EDUCATION AND RURAL DEVELOPMENT SOCIETY SAI BRANDAVAN, POLICE STATION ROAD, HOKARNA
4140 VISHWAGYAN BAHUDDESIA SEVABHAVI SANSTHA OPP. UMER MASJID, GAZIPURA, LATUR
4141 VISHWA HINDU EDUCATION SOCIETY NO 1-111/1 A PDA COLLEGE ROAD AIWAN E SHAHI GULBARGA KARNATAKA
4142 VISHWATMAK JANGLI MAHARAJ ASHRAM TRUST AT MOHILI POST AGHAI TAL SHAHPUR SIDT THANE
4143 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI-75.
4144 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI
4145 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXT., NEAR SECTOR-7, DWARKA, DELHI.
4146 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA
4147 VISION A RURAL DEVELOPMENT SOCIETY 14-8/3 SDPT RAMAYAMPET MEDAK DITRICT TELANGANA
4148 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4149 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4150 VISION SHIKSHA SAMITI DEOLI KHASRA NO. 1493/1136, NEAR JAHAZPUR CHUNGI NAKA UNCHA DISTT. BHILWARA
4151 VISION VOICE EDUCARE SOCIETY 111D/1 GARFA MAIN ROAD,JADAVPUR
4152 VISRI TECHNOLOGIES AND SOLUTIONS PLOT NO 89, VENKATESHWARA ENCLAVE, OPP:PRIYADARSHINI HOTEL, SUCHITRA X ROADS, SECUNDERABAD.AP
4153 VISWA BHARATHI TRUST HYDER NAGAR , KUKAT PALLI, HYD - 85
4154 VISWADEEPTHI EDUCATIONAL SOCIETY 20-151/A, JAILKHAN STREET, MITTOOR CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH
4155 VISWA SAI ADS FLAT NO 502, SIVA RESIDENCY, HINDI NAGAR, PANJAGUTTA, HYDERABAD
4156 VITRUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 OPP HP PERTOL PUMP TILWARA ROAD SAGRA JABALPUR
4157 VIVEKANANDA NAGAR PRAGATI VIVEKANANDA NAGAR, POST OFFICE:BABLA GOBINDAPUR PS: SANTIPUR DIST: NADIA WEST BENGAL 741404
4158 VIVEKANANDARURALANDURBANDEVELOPMENTASSOCIATION HNO 6-3-266,NEAR GEETA VIGNANA HIGH SCHOOL,RAMAGIRI,NALGONDA TELAGANA STATE
4159 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS DISTRICT, WEST BENGAL, PIN 743336
4160 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS , EMAIL :VSSU.IN@GMAIL.COM , WWW.VSSU.IN , PH +91 3174 277451 /9735706439
4161 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.B. OFFICE, NEAR POWER HOUSE,PINDWARA
4162 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.BOFFICE, NEAR POWER HOUSE, PINDWARA, DIST-SIROHI(RAJ.)
4163 VIVEKANAND TT COLLEGE WARD 07 BHADRA
4164 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11 MUKAND VIHAR VILLAGE MUKANDPUR
4165 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD,
4166 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD
4167 VJ SECURITY LLP B 156, NEW ASHOK NAGAR, NEW DELHI
4168 VK EDUCATIONAL AND TRAINING CENTER 783 DILDAR NAGAR KHATI BABA JHANSI
4169 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E) NAVI MUMBAI 400614
4170 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E),NAVI MUMBAI,MAHARASHTRA STATE
4171 VLCC HEALTH CARE LIMITED 64, HSIDC, SECTOR-18, MARUTI INDUSTRIAL AREA, GURUGRAM
4172 VMART PLOT NO. 862,UDHYOG VIHAR INDUSTRIAL AREA PHASE V
4173 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED WZ-22, ASALATPUR, JANAKPURI
4174 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED FLAT NO.B, OLD NO. 9, NEW NO.2, LAKSHMI COLONY, (NEAR NORTH CRESCENT ROAD), T-NAGAR, CHENNAI
4175 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NEAR AUCKLAND HOTEL LAKKAR BAZAAR SHIMLA
4176 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NR AUCKLAND HOTEL LAKKAR BAZAR SHIMLA
4177 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN BHOPAL
4178 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4179 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR. BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL.
4180 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO.3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD BHOPAL
4181 VOC INDUSTRIAL TRAINING INSTITUTE VOC NAGAR,PATTALAMMAN KOVIL ST CHINNAMANUR
4182 VOCMAN INDIA PRIVATE LIMITED C 326, VIKAS PURI, NEW DELHI
4183 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4184 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4185 VSOFT TECHNOLOGIES PRIVATE LIMITED MY HOME HUB, BLOCK-I 4TH FLOOR, MADHAPUR HYDERABAD - 500 081
4186 V S SHAH EDUCATION AND SOFTWARE PRIVATE LIMITED 1/14 PARUL APARTMENT, SHANTADEVI ROAD, NAVSARI
4187 V S SHAH EDUCATION AND SOFTWARE PVT LTD 1/14, PARUL APARTMENT SHANTADEVI ROAD NAVSARI. GUJARAT
4188 VVJ CHARITABLE TRUST 93G/6A/2, PALAI MAIN ROAD, OPP TVS SHOWROOM, THOOTHUKUDI-628002
4189 VYAVASAYA JANA CHAITANYA SAMITHI H.NO: 1-9-8/1/11, FLAT NO:303, B BLOCK, GIRISHIKHARA PLAZA, RAM NAGAR, HYDERABAD, TELANGANA
4190 VYUGA CONSULTING # 2905/3 & 4, HOTEL GANESH COMPLEX SRINIVASAM PILLAI ROAD, RAILADY THANJAVUR
4191 WAGONS LEARNING PRIVATE LIMITED A-8, A/7-8, 4TH FLOOR, SRUSHTI, OPPOSITE CORPORATION BANK, BANER ROAD, PUNE
4192 WAKE UP SKILLS PVT LTD VISHNU SOFTECH, 2ND FLOOR, SHRI DINESH COMPLEX, NEHRU CHOWK, AGRA ROAD, DEOPUR, DHULE
4193 WALL COMMUNICATION PRIVATE LIMITED A-31/20, NETAJI GALI NO-1 MAUJPUR,
4194 WATERSHED ORGANISATION TRUST 'PRYAVARAN BUILDING' BEHIND MARKET YARD AHMEDNAGAR
4195 WATERSHED SUPPORT SERVICES AND ACTIVITIES NETWORK 12-13-452, STREET NO.1, TARNAKA, SECUNDRABAD
4196 WATRANA TRACTION COMPANY I-28,UPSIDC INDL.AREA,GREATER NOIDA-201306
4197 WATRANA TRACTION PRIVATE LIMITED G-3, SITE V, UPSIDC INDUSTRIAL AREA, GREATER NOIDA
4198 WBSCSTRDSEWA KULIANA, MALINCHA BELIABERAH
4199 WB SOFTECH 41/B/1 ASUTOSH MUKHERJEE ROAD P.S- BUDGE BUDGE P.O- BUDGE BUDGE BLOCK:- BUDGE BUDGE I KOLKATA, WEST BENGAL
4200 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH-700103
4201 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR,24 PARGANA SOUTH-700103
4202 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR, 24 PARGANA SOUTH, 700103.
4203 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH-700103
4204 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH - 700103
4205 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH ,700103
4206 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4207 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4208 WE ARE HUMAN FOUNDATION WE ARE HUMAN FOUNDATION WORKSHOP, C-68, MANGE RAM COMPLEX, LOWER GROUND FLOOR, MAHAVIR VIHAR, SECTOR-1, DWARKA, NEW DELHI.
4209 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4210 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4211 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4212 WELCOME P LTD SIVA ST, MADURAI
4213 WELFARE ORGANISATION FOR RURAL LEAGUE DEVELOPMENT VEJENDLA POST ,CHEBROLU M GUNTUR DIST
4214 WELFARE SERVICES ERNAKULAM PONNURUNNI, VYTILA, ERNAKULAM, KERALA, INDIA
4215 WENS LINK ALHAJ COMMERCIAL COMPLEX, 1ST FLOOR, NEAR AGV BANK, NH-15, P.O.- BECHIMARI, DISTRICT.- DARRANG, STATE- ASSAM
4216 WENS LINK AMAN COMPLEX, 1ST & 2ND FLOOR, NH-15, KHARUPETIA
4217 WEST BENGAL SC AND ST RURAL DEVELOPMENT AND SOCIO ECONOMICS WELFARE ASSOCIATION GOPIBALLAVPUR , PASCHIM MEDINIPUR
4218 WE THE PEOPLE ROOM NO. 102, D211, LAXMANSINGH COMPLEX I, MUNIRKA, NEW DELHI 110067
4219 WHIZZY WORLD SURTEING VB COLLEGE ROAD RAINAWARI
4220 WINGSEDUCATIONS I-II 229/7 SANGAM VIHAR NEW DELHI
4221 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.36,PRABHU NAGAR,RAKKIYAPALAYAM PIRIVU,TIRUPUR
4222 WISDOM EDUCATIONAL AND CHARITABLE TRUST 36 PRABHU NAGAR RAKKIYAPALAYAM PIRIVU KANGAYAM ROAD TIRUPUR 641606
4223 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.195,EMKAY COMPLEX, KANGAYAM ROAD,TIRUPUR
4224 WITNUT COMPUTING PRIVATE LIMITED G77/2, SF, SHAHEEN BAGH, AF ENCLAVE-II, OKHLA, NEW DELHI
4225 WOMEN AND CHILDREN WELFARE SOCIETY 15/8, BIG STREET CHEYYAR
4226 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4227 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGR, KURINJIPADI, CUDDALORE
4228 WOMEN EMPOWERMENTAND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4229 WOMEN ENTERPRENEURS OF KARNATAKA ASSOCIATION #6, BESIDE ESHWAR TEMPLE, ESHWAR NAGAR, AMARGOL, OPP.APMC HUBLI
4230 WOMEN ENTREPRENEURSHIP DEVELOPMENT INSTITUTE WEDI CPK COMPLEX, NEAR ARYASAMAJ, RAM MOHAN ROAD, KOZHIKODE
4231 WOMEN INTERNATIONAL NETWORK WIN D-8/8, RIGHT SIDE, PARYAVARAN COMPLEX,SAID-UL-A-JAIB,SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4232 WOMEN INTERNATIONAL NETWORK WIN D-8/8, PARYAVARAN COMPLEX, SAID-UL-A-JAIB, SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4233 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI KRISHAN PURA PANIPAT
4234 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI, KISHAN PURA, PANIPAT
4235 WOMENS WELFARE SOCIETY 5-9-102/3, 1ST FLOOR, PUBLIC GARDEN ROAD, NAMPALLY, HYDERABAD
4236 WORLD WIDE SECURITY ORGANIZATION B-6, VIDHYA NAGAR HOSHANGABAD ROAD BHOPAL , MADHYA PRADESH
4237 XECUTE HR SOLUTIONS PVT LTD 307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON
4238 XECUTE HR SOLUTIONS PVT LTD #307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON – 122018
4239 XINE IT BRAINS PRIVATE LIMITED L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW UTTAR PRADESH INDIA
4240 XINE IT BRAINS PVT LTD L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW
4241 XI TECHNOLOGIES PVT LTD 4TH FLOOR, CHAKMIR, BUDGE BUDGE TRUNK ROAD, MAHESHTALA, KOLKATA – 700 141
4242 XPREZ INFOSOLUTIONS PVT LTD PLOT NO 7 ROOTS TOWER 8TH FLOOR LAXMI NAGAR DISTRICT CENTER DELHI.
4243 XYZ XYZ
4244 XYZ SSIISI SSSSF SDG SDG SG
4245 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE-411005
4246 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, CTS NO-95 A, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE
4247 YASH BAHU UDDESHIYE SEVA BHAVI SANSTHA TULSAI NIVAS, JALALPUR ROAD, NEAR ARUNODAYA RESIDENCY, PARLI VAIJNATH, DIST : BEED, MAHARASHTRA
4248 YASH EDUCATIONAL SOCIETY III-H/146, NEHRU NAGAR, GHAZIABAD
4249 YASH EDUCATION SOCIETY AT POST NIRA, NEAR S.T. STAND, WARD NO. 2
4250 YASH EDUCATION SOCIETY A/P. NIRA, TAL PURANDAR, DIST : PUNE MAHARASHTRA
4251 YASH EDUCATION SOCIETY AT POST NIRA, WARD NO. 2
4252 YASH EDUCATION SOCIETY A/P. NIRA, WARD NO. 2
4253 YASHWANT SHIKSHAN SANSTHA A/P - KSHETRA MAHULI, TAL./DIST - SATARA MAHARASHTRA
4254 YASHWANT SHIKSHAN SANSTHA 11, FIRST FLOOR, BACK OF SAMBHAJI NAGAR KAMAN,NEAR SHIVRAJ PETROL PUMP NH- 4 SATARA PIN- 415004.
4255 YATHARTH GURUKRUL COMPUTER SHIKSHAN SAMITI INDORE ROAD DEPALPUR
4256 YELLOW HOME HEALTH CARE PVT LTD 1-63-5-8B, KAVURI HILLS, JUBILEE HILLS POST
4257 YESH BAHUUDDESHIYA SEWABHAVI SANSTHA RAMPURI BK AT.POST.RAMPUTI BK, TQ.MANWAT DIST.PARBHANI HEAD OFFICE RAHUL NAGAR, PARBHANI
4258 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH.
4259 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1, MOTILAL NEHRU NAGAR (EAST) BHILAI
4260 YOUNGSTERS ASSOCIATION #2/489,OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL,NAGARAJPET,KADAPA -516001, CON:08562-222083,FAX:08562-222149.
4261 YOUNGSTERS ASSOCIATION YOUNGSTERS ASSOCIATION # 2/489,2ND FLOOR, OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL, NAGARAJPET, KADAPA -516001, CON: 08562-222083, FAX: 08562-222149
4262 YOUTH ACTION FOR RURAL DEVELOPMENT RANI BHASKAR NILAYAM, 6-3-668/10/20, 1ST FLOOR, NEAR VENKATESHWARA SWAMY TEMPLE, DURGANAGAR COLONY, PANJAGUTTA, HYDERABAD, TELANGANA STATE
4263 YOUTH BASE DEVELOPMENT SOCIETY C- 1087, TIGRI COLONY
4264 YOUTH EDUCATIONAL SOCIETY HARIDWAR BYPASS ROAD, NEAR RISPANA PUL OPP. AKASHWANI BHAWAN DEHRADUN UTTARAKHAND
4265 YOUTH EFFORTS FOR SOCIETY YES TRUST NO 47, 1ST FLOOR KEB COLONY UDAYAGIRI MYSORE
4266 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4267 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4268 YOUTH EMPOWERMENT SOCIETY 44 PRAHALAD COLONY, NEAR BY VISHNU GARDEN , SANGANER THANA , JAIPUR
4269 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4270 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4271 YOUTH INDIA SAKSHARTA MISSION BHITAR KAMTA, GOSANIMARI, DINHATA COOCH BEHAR, WEST BENGAL
4272 YOUTHNET YOUTHNET, BILLY GRAHAM ROAD, OPP. KOHIMA COLLEGE, KOHIMA
4273 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
4274 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
4275 YOUTH UPTURN VOLUNTARY ASSOCIATION 16-3-245, 3RD FLOOR, TRENDSET TOWERS, RAMALINGAPURAM, NELLORE.
4276 YPJ EDUCATIONAL SOCIETY D.NO.1-9-837/2 TOP OF HIND BAKERY, POCHAMMAGALLY, NIZAMABAD DISTRICT, TELANGANA STATE
4277 YPR MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH
4278 YUVADESH SHIKSHA EVAM SAMAJIK KALYAN SAMITI C/O SHOURYA CONSULTANCY,GROUND FLOOR,JYOTI CINEPLEX,M P NAGAR,ZONE I BHOPAL
4279 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
4280 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
4281 YUVA JAGRUTI MANCH B-2/22, WALLFORT ENCLAVE, BEHIND RAMKRISHNA HOSPITAL, PACHPEDI NAKA, RAIPUR
4282 YUVA SANKALP BAHUUDDESHIYA SANSTHA WORD NO. 12, MOHAPA, TAL KALAMESHWAR, DIST NAGPUR
4283 YUVA SANKALP BAHUUDDESHIYA SANSTHA NAGPUR PLOT NO. 28, GOPAL NAGAR, NAGPUR
4284 YUVASHAKTI FOUNDATION 8 /4 , LAKSHA , PURNANAGAR ,BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE-411019
4285 YUVASHAKTI FOUNDATION 8/4 , PURNANAGAR , NEAR RTO , CHINCHWAD , PUNE
4286 YUVASHAKTI FOUNDATION 8/4 , LAKSHYA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
4287 YUVASHAKTI FOUNDATION 8/4 , LAKSHA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
4288 YUVA TRAINING AND PLACEMENTS RAMALINGAPURAM, TRENDSET TOWERS,3RD FLOOR,NELLORE-524001
4289 YUVA VIKAS SOCIETY 26,DEENDAYAL UPADHYAY MARG,ITO,NEW DELHI
4290 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR JAMMU AND KASHMIR
4291 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR, JAMMU AND KASHMIR
4292 ZENITH CAREER WINGS 51-A,NEHRU STREET , RAMNAGAR, COIMBATORE
4293 ZENITH NEEDS MULTMEDIA T.S.NO:3074-3075, GNANA ARUL PLAZA 1ST FLOOR, RAJA RANI COMPLEX, KEELA RAJA VEETHI, PUDUKKOTTAI DISTRICT.
4294 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL
4295 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL HYDERABAD
http://rural.nic.in    http://aajeevika.gov.in    http://nird.org.in http://www.nabcons.com http://ddugky.gov.in