Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 AAA AAA
3 AAA BBB JABBALPUR, KATHMANDU,
4 AAA SOCIETY A AA AAAAAAAAAAAAAA
5 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
6 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
7 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
8 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
9 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
10 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
11 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
12 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
13 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
14 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
15 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
16 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
17 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
18 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
19 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
20 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
21 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
22 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
23 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
24 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
25 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
26 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
27 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
28 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
29 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
30 ABC BHOPAL
31 ABC JHSDJHDFKLJDFKJHJKGD
32 ABC JKLJLJK
33 ABC KALARA BURDWAN
34 ABCD ABCDEFGHIJKLMNOP
35 ABCD ABCD
36 ABC FIRM LTD PATNA
37 ABC PVT LTD PUNE
38 ABC TRUST LKCNSDKAJD
39 ABD PVT LTD XYZ
40 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
41 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
42 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
43 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
44 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
45 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
46 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
47 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
48 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
49 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
50 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
51 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
52 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
53 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
54 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
55 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
56 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
57 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
58 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
59 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
60 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
61 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
62 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
63 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
64 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
65 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
66 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
67 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
68 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
69 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
70 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
71 ADARSH FOODS CITY STATION ROAD KHURJA
72 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
73 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
74 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
75 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
76 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
77 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
78 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
79 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
80 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
81 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
82 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
83 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
84 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
85 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
86 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
87 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
88 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
89 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
90 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
91 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
92 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
93 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
94 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
95 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
96 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
97 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
98 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
99 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
100 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
101 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
102 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
103 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
104 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
105 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
106 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
107 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
108 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
109 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
110 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
111 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
112 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
113 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
114 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
115 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
116 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
117 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
118 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
119 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
120 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
121 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
122 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
123 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
124 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
125 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
126 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
127 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
128 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
129 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
130 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
131 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
132 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
133 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
134 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
135 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
136 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
137 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
138 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
139 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
140 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
141 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
142 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
143 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
144 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
145 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
146 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
147 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
148 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
149 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
150 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
151 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
152 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
153 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
154 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
155 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
156 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
157 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
158 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
159 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
160 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
161 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
162 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
163 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
164 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
165 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
166 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
167 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
168 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
169 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
170 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
171 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
172 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
173 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
174 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
175 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
176 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
177 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
178 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
179 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
180 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
181 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
182 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
183 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
184 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
185 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
186 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
187 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
188 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
189 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
190 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
191 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
192 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
193 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
194 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
195 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
196 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
197 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
198 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
199 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
200 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
201 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
202 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
203 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
204 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
205 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
206 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
207 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
208 ANNAMALAI ASDJFKL ADF ASDF AS F
209 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
210 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
211 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
212 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
213 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
214 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
215 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
216 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
217 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
218 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
219 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
220 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
221 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
222 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
223 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
224 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
225 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
226 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
227 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
228 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
229 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
230 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
231 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
232 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
233 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
234 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
235 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
236 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
237 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
238 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
239 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
240 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
241 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
242 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
243 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
244 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
245 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
246 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
247 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
248 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
249 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
250 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
251 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
252 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
253 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
254 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
255 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
256 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
257 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
258 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
259 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
260 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
261 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
262 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
263 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
264 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
265 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
266 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
267 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
268 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
269 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
270 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
271 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
272 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
273 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
274 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
275 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
276 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
277 ASFSDA ASDF
278 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
279 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
280 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
281 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
282 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
283 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
284 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
285 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
286 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
287 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
288 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
289 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
290 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
291 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
292 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
293 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
294 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
295 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
296 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
297 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
298 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
299 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
300 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
301 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
302 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
303 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
304 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
305 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
306 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
307 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
308 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
309 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
310 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
311 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
312 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
313 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
314 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
315 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
316 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
317 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
318 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
319 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
320 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
321 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
322 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
323 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
324 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
325 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
326 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
327 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
328 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
329 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
330 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
331 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
332 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
333 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
334 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
335 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
336 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
337 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
338 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
339 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
340 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
341 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
342 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
343 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
344 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
345 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
346 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
347 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
348 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
349 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
350 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
351 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
352 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
353 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
354 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
355 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
356 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
357 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
358 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
359 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
360 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
361 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
362 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
363 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
364 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
365 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
366 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
367 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
368 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
369 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
370 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
371 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
372 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
373 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
374 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
375 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
376 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
377 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
378 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
379 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
380 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
381 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
382 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
383 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
384 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
385 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
386 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
387 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
388 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
389 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
390 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
391 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
392 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
393 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
394 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
395 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
396 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
397 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
398 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
399 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
400 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
401 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
402 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
403 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
404 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
405 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
406 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
407 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
408 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
409 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
410 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
411 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
412 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
413 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
414 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
415 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
416 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
417 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
418 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
419 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
420 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
421 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
422 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
423 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
424 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
425 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
426 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
427 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
428 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
429 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
430 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
431 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
432 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
433 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
434 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
435 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
436 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
437 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
438 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
439 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
440 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
441 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
442 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
443 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
444 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
445 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
446 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
447 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
448 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
449 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
450 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
451 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
452 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
453 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
454 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
455 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
456 BISWAAS BAHARANA.NIALI,CUTTACK
457 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
458 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
459 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
460 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
461 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
462 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
463 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
464 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
465 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
466 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
467 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
468 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
469 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
470 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
471 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
472 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
473 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
474 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
475 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
476 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
477 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
478 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
479 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
480 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
481 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
482 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
483 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
484 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
485 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
486 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
487 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
488 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
489 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
490 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
491 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
492 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
493 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
494 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
495 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
496 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
497 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
498 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
499 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
500 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
501 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
502 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
503 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
504 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
505 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
506 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
507 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
508 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
509 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
510 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
511 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
512 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
513 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
514 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
515 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
516 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
517 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
518 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
519 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
520 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
521 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
522 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
523 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
524 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
525 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
526 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
527 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
528 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
529 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
530 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
531 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
532 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
533 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
534 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
535 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
536 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
537 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
538 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
539 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
540 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
541 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
542 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
543 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
544 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
545 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
546 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
547 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
548 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
549 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
550 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
551 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
552 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
553 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
554 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
555 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
556 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
557 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
558 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
559 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
560 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
561 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
562 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
563 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
564 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
565 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
566 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
567 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
568 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
569 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
570 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
571 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
572 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
573 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
574 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
575 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
576 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
577 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
578 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
579 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
580 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
581 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
582 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
583 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
584 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
585 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
586 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
587 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
588 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
589 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
590 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
591 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
592 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
593 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
594 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
595 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
596 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
597 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
598 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
599 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
600 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
601 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
602 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
603 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
604 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
605 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
606 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
607 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
608 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
609 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
610 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
611 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
612 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
613 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
614 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
615 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
616 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
617 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
618 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
619 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
620 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
621 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
622 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
623 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
624 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
625 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
626 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
627 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
628 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
629 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
630 COODU TRUST H.83.R M.COLONY DINDIGUL
631 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
632 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
633 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
634 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
635 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
636 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
637 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
638 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
639 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
640 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
641 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
642 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
643 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
644 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
645 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
646 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
647 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
648 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
649 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
650 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
651 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
652 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
653 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
654 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
655 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
656 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
657 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
658 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
659 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
660 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
661 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
662 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
663 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
664 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
665 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
666 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
667 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
668 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
669 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
670 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
671 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
672 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
673 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
674 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
675 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
676 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
677 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
678 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
679 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
680 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
681 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
682 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
683 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
684 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
685 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
686 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
687 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
688 DDUGKY MORD C TEST ALJBSDFLQJHF
689 DDUGKY MORD C TEST1 LJHWDF
690 DDUGKY MORD INC TEST2 NEW DELHI
691 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
692 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
693 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
694 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
695 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
696 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
697 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
698 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
699 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
700 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
701 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
702 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
703 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
704 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
705 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
706 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
707 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
708 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
709 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
710 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
711 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
712 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
713 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
714 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
715 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
716 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
717 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
718 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
719 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
720 DFHDFHFH KJDVNMDV,M DV
721 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
722 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
723 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
724 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
725 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
726 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
727 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
728 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
729 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
730 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
731 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
732 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
733 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
734 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
735 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
736 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
737 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
738 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
739 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
740 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
741 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
742 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
743 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
744 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
745 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
746 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
747 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
748 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
749 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
750 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
751 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
752 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
753 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
754 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
755 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
756 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
757 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
758 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
759 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
760 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
761 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
762 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
763 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
764 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
765 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
766 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
767 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
768 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
769 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
770 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
771 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
772 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
773 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
774 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
775 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
776 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
777 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
778 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
779 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
780 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
781 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
782 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
783 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
784 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
785 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
786 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
787 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
788 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
789 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
790 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
791 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
792 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
793 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
794 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
795 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
796 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
797 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
798 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
799 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
800 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
801 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
802 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
803 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
804 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
805 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
806 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
807 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
808 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
809 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
810 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
811 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
812 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
813 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
814 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
815 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
816 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
817 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
818 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
819 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
820 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
821 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
822 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
823 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
824 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
825 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
826 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
827 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
828 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
829 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
830 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
831 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
832 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
833 EDS GADEPAN KOTA
834 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
835 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
836 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
837 EDU INSTITUTE ADDRESS
838 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
839 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
840 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
841 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
842 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
843 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
844 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
845 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
846 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
847 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
848 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
849 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
850 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
851 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
852 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
853 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
854 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
855 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
856 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
857 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
858 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
859 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
860 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
861 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
862 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
863 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
864 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
865 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
866 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
867 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
868 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
869 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
870 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
871 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
872 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
873 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
874 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
875 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
876 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
877 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
878 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
879 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
880 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
881 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
882 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
883 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
884 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
885 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
886 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
887 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
888 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
889 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
890 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
891 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
892 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
893 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
894 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
895 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
896 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
897 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
898 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
899 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
900 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
901 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
902 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
903 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
904 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
905 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
906 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
907 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
908 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
909 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
910 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
911 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
912 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
913 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
914 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
915 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
916 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
917 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
918 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
919 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
920 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
921 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
922 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
923 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
924 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
925 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
926 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
927 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
928 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
929 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
930 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
931 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
932 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
933 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
934 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
935 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
936 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
937 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
938 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
939 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
940 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
941 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
942 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
943 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
944 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
945 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
946 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
947 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
948 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
949 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
950 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
951 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
952 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
953 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
954 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
955 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
956 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
957 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
958 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
959 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
960 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
961 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
962 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
963 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
964 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
965 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
966 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
967 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
968 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
969 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
970 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
971 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
972 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
973 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
974 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
975 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
976 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
977 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
978 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
979 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
980 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
981 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
982 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
983 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
984 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
985 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
986 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
987 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
988 GENUINESOFT ST.HINDUCOLLEGE ROAD
989 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
990 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
991 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
992 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
993 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
994 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
995 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
996 GFHDYHDBAH QSDWEFWE
997 GFHDYHDBAH VSGYCGDHFGSDY
998 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
999 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1000 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1001 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1002 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1003 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1004 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1005 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1006 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1007 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1008 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1009 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1010 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1011 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1012 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1013 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1014 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1015 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1016 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1017 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1018 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1019 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1020 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1021 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1022 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1023 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1024 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1025 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1026 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1027 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1028 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1029 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1030 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1031 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1032 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1033 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1034 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1035 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1036 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1037 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1038 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1039 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1040 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1041 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1042 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1043 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1044 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1045 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1046 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1047 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1048 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1049 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1050 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1051 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1052 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1053 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1054 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1055 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1056 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1057 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1058 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1059 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1060 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1061 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1062 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1063 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1064 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1065 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1066 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1067 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1068 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1069 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1070 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1071 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1072 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1073 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1074 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1075 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1076 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1077 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1078 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1079 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1080 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1081 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1082 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1083 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1084 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1085 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1086 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1087 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1088 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1089 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1090 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1091 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1092 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1093 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1094 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1095 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1096 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1097 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1098 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1099 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1100 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1101 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1102 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1103 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1104 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1105 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1106 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1107 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1108 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1109 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1110 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1111 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1112 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1113 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1114 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1115 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1116 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1117 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1118 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1119 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1120 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1121 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1122 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1123 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1124 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1125 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1126 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1127 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1128 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1129 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1130 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1131 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1132 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1133 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1134 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1135 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1136 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1137 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1138 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1139 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1140 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1141 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1142 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1143 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1144 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1145 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1146 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1147 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1148 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1149 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1150 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1151 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1152 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1153 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1154 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1155 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1156 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1157 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1158 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1159 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1160 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1161 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1162 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1163 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1164 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1165 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1166 HGXDNG CBGNCBNMCNFMHXFVM
1167 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1168 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1169 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1170 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1171 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1172 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1173 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1174 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1175 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1176 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1177 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1178 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1179 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1180 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1181 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1182 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1183 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1184 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1185 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1186 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1187 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1188 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1189 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1190 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1191 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1192 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1193 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1194 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1195 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1196 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1197 HSADALO FFSE
1198 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1199 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1200 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1201 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1202 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1203 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1204 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1205 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1206 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1207 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1208 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1209 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1210 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1211 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1212 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1213 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1214 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1215 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1216 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
1217 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1218 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1219 ICTPMU DDUGKY TEST NEW DELHI
1220 ICTPMU TEST11 NEW DELHI110001
1221 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1222 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1223 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1224 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1225 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1226 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1227 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1228 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1229 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1230 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1231 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1232 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1233 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1234 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1235 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1236 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1237 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1238 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1239 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1240 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1241 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1242 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1243 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1244 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1245 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1246 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1247 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1248 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1249 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1250 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1251 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1252 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1253 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1254 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1255 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1256 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1257 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1258 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1259 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1260 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1261 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1262 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1263 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1264 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1265 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1266 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1267 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1268 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
1269 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1270 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1271 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1272 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1273 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1274 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1275 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1276 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1277 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1278 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1279 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1280 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1281 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1282 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1283 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1284 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1285 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1286 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1287 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1288 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1289 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1290 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1291 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1292 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1293 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1294 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1295 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1296 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1297 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1298 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1299 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1300 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1301 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1302 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1303 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
1304 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
1305 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
1306 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
1307 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
1308 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
1309 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
1310 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
1311 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
1312 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
1313 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
1314 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
1315 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
1316 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
1317 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
1318 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
1319 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
1320 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
1321 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
1322 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
1323 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1324 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
1325 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1326 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
1327 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
1328 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
1329 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
1330 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
1331 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
1332 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
1333 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
1334 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
1335 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
1336 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
1337 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
1338 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
1339 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
1340 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
1341 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
1342 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
1343 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
1344 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
1345 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
1346 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
1347 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1348 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1349 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
1350 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
1351 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
1352 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
1353 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
1354 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
1355 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
1356 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
1357 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
1358 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
1359 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1360 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1361 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1362 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
1363 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
1364 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1365 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
1366 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
1367 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
1368 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
1369 JAN KALYAN SAMITI JAIN
1370 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
1371 JAN KALYAN SHIKSHA SAMITI A-1413/3
1372 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
1373 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
1374 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
1375 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
1376 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
1377 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
1378 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
1379 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
1380 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
1381 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1382 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1383 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
1384 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
1385 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
1386 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
1387 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
1388 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
1389 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
1390 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
1391 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
1392 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
1393 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
1394 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1395 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1396 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
1397 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
1398 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
1399 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
1400 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
1401 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
1402 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
1403 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1404 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1405 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
1406 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
1407 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1408 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
1409 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
1410 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
1411 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
1412 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
1413 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
1414 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
1415 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
1416 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
1417 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
1418 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
1419 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
1420 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
1421 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
1422 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
1423 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
1424 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
1425 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1426 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
1427 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1428 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
1429 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1430 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1431 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1432 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
1433 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
1434 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1435 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1436 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
1437 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
1438 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
1439 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
1440 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
1441 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
1442 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
1443 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
1444 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
1445 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1446 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1447 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1448 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1449 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1450 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1451 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
1452 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
1453 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
1454 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
1455 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1456 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1457 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
1458 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
1459 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
1460 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
1461 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
1462 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
1463 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
1464 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
1465 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
1466 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1467 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1468 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
1469 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
1470 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
1471 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
1472 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
1473 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1474 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1475 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
1476 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
1477 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
1478 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
1479 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
1480 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
1481 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
1482 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
1483 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
1484 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
1485 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
1486 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
1487 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
1488 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
1489 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
1490 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
1491 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
1492 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
1493 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
1494 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
1495 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1496 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1497 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
1498 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
1499 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
1500 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
1501 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
1502 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
1503 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
1504 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
1505 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
1506 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
1507 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
1508 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
1509 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
1510 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
1511 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
1512 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
1513 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
1514 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
1515 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
1516 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
1517 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
1518 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
1519 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
1520 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
1521 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
1522 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1523 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
1524 KAYZEY SOCIETY MAWNGAP MAWSMAI
1525 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
1526 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
1527 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
1528 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
1529 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
1530 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
1531 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
1532 KGVK NEORI VIKAS RUKKA RANCHI
1533 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
1534 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
1535 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
1536 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
1537 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
1538 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
1539 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
1540 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
1541 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
1542 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
1543 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1544 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1545 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
1546 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
1547 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
1548 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
1549 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
1550 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
1551 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
1552 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
1553 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
1554 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
1555 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
1556 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
1557 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
1558 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
1559 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
1560 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
1561 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
1562 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
1563 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
1564 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
1565 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
1566 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
1567 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
1568 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
1569 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
1570 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
1571 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
1572 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
1573 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
1574 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
1575 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
1576 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
1577 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
1578 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
1579 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
1580 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
1581 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
1582 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
1583 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
1584 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
1585 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
1586 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
1587 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
1588 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
1589 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
1590 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
1591 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
1592 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1593 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1594 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
1595 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
1596 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1597 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1598 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
1599 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
1600 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
1601 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
1602 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
1603 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
1604 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
1605 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
1606 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
1607 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
1608 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
1609 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
1610 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
1611 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
1612 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
1613 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1614 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1615 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
1616 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
1617 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
1618 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1619 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1620 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
1621 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
1622 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
1623 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
1624 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
1625 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
1626 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
1627 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
1628 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
1629 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
1630 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
1631 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
1632 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
1633 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
1634 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
1635 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
1636 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
1637 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
1638 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
1639 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
1640 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1641 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1642 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
1643 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
1644 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
1645 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
1646 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
1647 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1648 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1649 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
1650 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
1651 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
1652 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
1653 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
1654 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
1655 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
1656 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
1657 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
1658 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
1659 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
1660 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
1661 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
1662 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
1663 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
1664 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1665 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1666 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1667 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
1668 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
1669 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
1670 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1671 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1672 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
1673 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
1674 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
1675 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
1676 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
1677 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
1678 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
1679 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1680 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1681 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
1682 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
1683 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
1684 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
1685 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
1686 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
1687 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
1688 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1689 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1690 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
1691 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
1692 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
1693 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
1694 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1695 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1696 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
1697 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
1698 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
1699 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
1700 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
1701 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
1702 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
1703 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
1704 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
1705 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1706 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1707 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1708 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
1709 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
1710 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
1711 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
1712 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
1713 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
1714 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
1715 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
1716 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1717 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1718 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
1719 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1720 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1721 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
1722 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
1723 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
1724 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
1725 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
1726 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
1727 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
1728 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
1729 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
1730 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
1731 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
1732 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
1733 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
1734 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
1735 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1736 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1737 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
1738 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
1739 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
1740 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
1741 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
1742 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
1743 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
1744 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
1745 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
1746 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
1747 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
1748 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
1749 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
1750 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
1751 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
1752 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
1753 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
1754 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
1755 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
1756 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
1757 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
1758 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
1759 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
1760 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
1761 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
1762 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
1763 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
1764 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
1765 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
1766 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
1767 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
1768 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
1769 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
1770 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
1771 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
1772 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
1773 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
1774 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
1775 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
1776 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
1777 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
1778 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
1779 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
1780 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
1781 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
1782 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
1783 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
1784 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
1785 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
1786 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
1787 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
1788 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
1789 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
1790 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
1791 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
1792 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
1793 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
1794 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
1795 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
1796 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
1797 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
1798 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
1799 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
1800 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
1801 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
1802 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
1803 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
1804 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
1805 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
1806 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
1807 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
1808 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
1809 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
1810 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
1811 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
1812 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
1813 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
1814 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
1815 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
1816 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
1817 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
1818 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
1819 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
1820 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
1821 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
1822 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
1823 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
1824 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
1825 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
1826 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
1827 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
1828 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
1829 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
1830 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
1831 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
1832 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
1833 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
1834 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
1835 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
1836 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
1837 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
1838 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
1839 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
1840 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
1841 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
1842 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
1843 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
1844 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
1845 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
1846 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
1847 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
1848 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
1849 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
1850 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
1851 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
1852 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
1853 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
1854 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
1855 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
1856 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
1857 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
1858 MORD TEST ND
1859 MORD TEST1 SBJFLJ
1860 MORD TEST2 ADVCDS
1861 MORD TEST NEW DELHI ND
1862 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
1863 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
1864 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
1865 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
1866 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
1867 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
1868 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
1869 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
1870 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
1871 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
1872 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
1873 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
1874 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
1875 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
1876 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
1877 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1878 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1879 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
1880 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
1881 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
1882 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1883 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
1884 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
1885 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
1886 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
1887 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
1888 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
1889 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
1890 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
1891 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
1892 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
1893 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
1894 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
1895 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
1896 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
1897 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
1898 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
1899 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
1900 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
1901 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
1902 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
1903 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
1904 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
1905 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
1906 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
1907 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
1908 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
1909 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
1910 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
1911 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
1912 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
1913 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
1914 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
1915 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
1916 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
1917 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
1918 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
1919 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
1920 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
1921 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
1922 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
1923 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
1924 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
1925 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
1926 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
1927 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
1928 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
1929 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
1930 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
1931 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
1932 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
1933 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
1934 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
1935 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
1936 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
1937 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
1938 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
1939 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
1940 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
1941 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
1942 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
1943 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
1944 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
1945 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
1946 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
1947 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
1948 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
1949 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
1950 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
1951 NAVACHETHANA MALLAPPALLY INSTITUTE
1952 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
1953 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
1954 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
1955 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
1956 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
1957 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
1958 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
1959 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
1960 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
1961 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
1962 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1963 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1964 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1965 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
1966 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
1967 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
1968 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
1969 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
1970 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
1971 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
1972 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
1973 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
1974 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
1975 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
1976 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
1977 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
1978 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
1979 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
1980 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
1981 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
1982 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
1983 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
1984 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
1985 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
1986 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
1987 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
1988 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
1989 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
1990 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
1991 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
1992 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
1993 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
1994 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
1995 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
1996 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
1997 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
1998 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
1999 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
2000 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
2001 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
2002 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
2003 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
2004 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
2005 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2006 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
2007 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2008 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
2009 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2010 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2011 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2012 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
2013 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
2014 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
2015 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
2016 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
2017 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
2018 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
2019 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
2020 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
2021 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
2022 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
2023 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
2024 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2025 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2026 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2027 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
2028 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
2029 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
2030 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
2031 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
2032 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
2033 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
2034 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
2035 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
2036 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
2037 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
2038 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
2039 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
2040 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
2041 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
2042 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2043 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2044 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
2045 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
2046 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2047 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
2048 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
2049 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
2050 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2051 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
2052 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
2053 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
2054 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
2055 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
2056 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
2057 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
2058 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
2059 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
2060 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
2061 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
2062 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
2063 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
2064 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
2065 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
2066 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
2067 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
2068 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
2069 NRLM SKILLS SAMRAT,CHANKYAPURI
2070 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2071 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2072 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2073 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
2074 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2075 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2076 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
2077 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
2078 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
2079 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2080 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2081 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
2082 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
2083 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
2084 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
2085 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
2086 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
2087 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
2088 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
2089 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
2090 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2091 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2092 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2093 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
2094 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
2095 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
2096 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
2097 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
2098 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
2099 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
2100 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
2101 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
2102 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
2103 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
2104 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
2105 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
2106 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
2107 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
2108 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
2109 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
2110 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
2111 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
2112 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
2113 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
2114 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2115 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2116 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2117 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2118 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2119 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
2120 ORION TRUST SAGOLBAND THINGOM LEIKAI
2121 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
2122 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
2123 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2124 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2125 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
2126 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2127 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2128 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2129 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
2130 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2131 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
2132 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
2133 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
2134 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
2135 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
2136 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
2137 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
2138 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
2139 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
2140 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
2141 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
2142 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
2143 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2144 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2145 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
2146 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
2147 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
2148 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
2149 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
2150 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
2151 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
2152 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2153 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2154 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
2155 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
2156 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
2157 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
2158 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
2159 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
2160 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
2161 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
2162 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2163 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
2164 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2165 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
2166 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
2167 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
2168 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
2169 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
2170 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
2171 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
2172 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
2173 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
2174 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
2175 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
2176 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
2177 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
2178 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
2179 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
2180 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
2181 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
2182 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
2183 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
2184 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
2185 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
2186 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
2187 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
2188 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
2189 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
2190 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
2191 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
2192 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
2193 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
2194 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
2195 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
2196 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
2197 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
2198 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
2199 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
2200 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
2201 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
2202 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
2203 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
2204 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
2205 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
2206 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
2207 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
2208 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
2209 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
2210 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
2211 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
2212 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
2213 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
2214 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
2215 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
2216 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
2217 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
2218 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
2219 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
2220 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
2221 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
2222 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
2223 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
2224 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
2225 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2226 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
2227 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
2228 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
2229 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
2230 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
2231 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
2232 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
2233 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2234 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2235 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2236 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
2237 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
2238 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2239 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2240 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2241 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
2242 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
2243 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
2244 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
2245 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
2246 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
2247 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
2248 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
2249 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
2250 PRERANA RUGUDIPARA BALANGIR ODISHA
2251 PRERANA RUGUDIPARA BALANGIR
2252 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
2253 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
2254 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2255 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2256 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2257 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
2258 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2259 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2260 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2261 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
2262 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
2263 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
2264 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
2265 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
2266 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
2267 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
2268 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2269 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2270 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
2271 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
2272 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
2273 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
2274 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2275 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2276 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
2277 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
2278 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
2279 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
2280 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
2281 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
2282 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
2283 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
2284 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
2285 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
2286 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2287 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
2288 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
2289 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
2290 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
2291 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
2292 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
2293 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2294 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2295 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2296 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
2297 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
2298 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
2299 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
2300 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
2301 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2302 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
2303 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2304 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
2305 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
2306 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
2307 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
2308 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
2309 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
2310 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
2311 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
2312 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
2313 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2314 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2315 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2316 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
2317 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2318 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
2319 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2320 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
2321 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
2322 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
2323 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
2324 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
2325 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
2326 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
2327 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2328 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2329 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2330 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
2331 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
2332 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
2333 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
2334 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
2335 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
2336 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
2337 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
2338 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
2339 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
2340 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
2341 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
2342 RAJ SHREE 787
2343 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
2344 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
2345 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
2346 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
2347 RAM MORADABAD
2348 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
2349 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
2350 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
2351 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
2352 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
2353 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
2354 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
2355 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
2356 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
2357 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
2358 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
2359 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
2360 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2361 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2362 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
2363 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
2364 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
2365 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
2366 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
2367 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
2368 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
2369 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
2370 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
2371 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
2372 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
2373 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
2374 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
2375 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
2376 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
2377 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
2378 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2379 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2380 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
2381 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
2382 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2383 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2384 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
2385 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
2386 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
2387 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
2388 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
2389 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
2390 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
2391 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
2392 REKHA SOCIETY DGGHDGHSH
2393 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
2394 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
2395 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
2396 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
2397 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
2398 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
2399 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
2400 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
2401 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
2402 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
2403 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
2404 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
2405 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
2406 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
2407 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
2408 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
2409 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
2410 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
2411 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
2412 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
2413 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
2414 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
2415 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
2416 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
2417 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
2418 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
2419 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
2420 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
2421 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
2422 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
2423 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
2424 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2425 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
2426 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2427 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
2428 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
2429 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
2430 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
2431 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
2432 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
2433 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
2434 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
2435 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
2436 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
2437 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
2438 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
2439 RSESK SOCIETY MAHENDRU
2440 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
2441 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
2442 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
2443 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
2444 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
2445 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
2446 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
2447 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2448 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2449 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
2450 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
2451 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
2452 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
2453 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
2454 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
2455 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2456 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2457 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
2458 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2459 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
2460 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2461 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
2462 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
2463 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
2464 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
2465 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
2466 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
2467 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
2468 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
2469 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
2470 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
2471 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
2472 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2473 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2474 SADGUNA TECHNOLOGIES NAIMNAGAR
2475 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
2476 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
2477 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
2478 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
2479 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
2480 SAFDSF SADFASD
2481 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
2482 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
2483 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
2484 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
2485 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
2486 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
2487 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
2488 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
2489 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
2490 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
2491 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
2492 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
2493 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
2494 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
2495 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
2496 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
2497 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
2498 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
2499 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
2500 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
2501 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
2502 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
2503 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
2504 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
2505 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
2506 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
2507 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
2508 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
2509 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
2510 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
2511 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
2512 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2513 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2514 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
2515 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
2516 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
2517 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
2518 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
2519 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
2520 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
2521 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
2522 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2523 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2524 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2525 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2526 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
2527 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
2528 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
2529 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
2530 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
2531 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2532 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2533 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2534 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
2535 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2536 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
2537 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
2538 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
2539 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
2540 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
2541 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2542 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
2543 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2544 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
2545 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
2546 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
2547 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
2548 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
2549 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
2550 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
2551 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
2552 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
2553 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
2554 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
2555 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
2556 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
2557 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
2558 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
2559 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
2560 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2561 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2562 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
2563 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
2564 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
2565 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
2566 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
2567 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
2568 SANDEEP TEST ASDASDASD
2569 SANDESH MNGO INDIA INDIA 1 INDORE
2570 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
2571 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
2572 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
2573 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
2574 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2575 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2576 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
2577 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
2578 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
2579 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
2580 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
2581 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
2582 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
2583 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
2584 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
2585 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
2586 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
2587 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
2588 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
2589 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
2590 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
2591 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
2592 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
2593 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
2594 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
2595 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
2596 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
2597 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
2598 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
2599 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
2600 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
2601 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
2602 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
2603 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
2604 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
2605 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
2606 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
2607 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
2608 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
2609 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
2610 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
2611 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
2612 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
2613 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
2614 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
2615 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
2616 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
2617 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
2618 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
2619 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
2620 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
2621 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
2622 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
2623 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
2624 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
2625 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
2626 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
2627 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
2628 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
2629 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2630 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2631 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2632 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2633 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
2634 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
2635 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
2636 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
2637 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
2638 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
2639 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
2640 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
2641 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
2642 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
2643 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
2644 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
2645 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
2646 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
2647 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
2648 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
2649 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
2650 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
2651 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2652 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2653 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2654 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
2655 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2656 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
2657 SATYAM SKILLS CENTER VISHAKAPATNAM
2658 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
2659 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
2660 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
2661 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
2662 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
2663 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
2664 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
2665 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
2666 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
2667 SBDA AT-GVBBGFHGFBFGB
2668 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
2669 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
2670 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
2671 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
2672 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
2673 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
2674 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
2675 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
2676 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
2677 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
2678 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2679 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2680 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
2681 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
2682 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2683 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2684 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
2685 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
2686 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
2687 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
2688 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
2689 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
2690 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
2691 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
2692 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
2693 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
2694 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
2695 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
2696 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
2697 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
2698 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
2699 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
2700 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
2701 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
2702 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
2703 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
2704 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
2705 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
2706 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
2707 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
2708 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
2709 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
2710 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
2711 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
2712 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
2713 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
2714 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
2715 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
2716 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
2717 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
2718 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
2719 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
2720 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
2721 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
2722 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
2723 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
2724 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
2725 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
2726 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
2727 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
2728 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
2729 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
2730 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
2731 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
2732 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
2733 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
2734 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
2735 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
2736 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
2737 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
2738 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
2739 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
2740 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
2741 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
2742 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
2743 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
2744 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
2745 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
2746 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
2747 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
2748 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
2749 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
2750 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
2751 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2752 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2753 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2754 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
2755 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
2756 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
2757 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
2758 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
2759 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
2760 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
2761 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
2762 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
2763 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
2764 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
2765 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
2766 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
2767 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
2768 SHODH 180/22, ZAKIR NAGAR, OKHLA
2769 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
2770 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
2771 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
2772 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
2773 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2774 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2775 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2776 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
2777 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
2778 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
2779 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
2780 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
2781 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
2782 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
2783 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
2784 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
2785 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
2786 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
2787 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
2788 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
2789 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
2790 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
2791 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
2792 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
2793 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
2794 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
2795 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
2796 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
2797 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
2798 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
2799 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
2800 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
2801 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
2802 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
2803 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
2804 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
2805 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
2806 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
2807 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
2808 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
2809 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
2810 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
2811 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
2812 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
2813 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
2814 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
2815 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
2816 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
2817 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
2818 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
2819 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
2820 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
2821 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
2822 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
2823 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
2824 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
2825 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
2826 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
2827 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
2828 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
2829 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
2830 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
2831 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
2832 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
2833 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
2834 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
2835 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
2836 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
2837 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
2838 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
2839 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
2840 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
2841 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
2842 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
2843 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2844 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2845 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2846 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2847 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
2848 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
2849 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
2850 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
2851 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
2852 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
2853 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
2854 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
2855 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
2856 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
2857 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
2858 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
2859 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
2860 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
2861 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
2862 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
2863 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
2864 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
2865 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
2866 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
2867 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
2868 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
2869 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
2870 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
2871 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
2872 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
2873 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
2874 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2875 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2876 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2877 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2878 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2879 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2880 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2881 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
2882 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
2883 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
2884 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
2885 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
2886 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2887 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2888 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2889 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
2890 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
2891 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
2892 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
2893 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
2894 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
2895 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
2896 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
2897 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
2898 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
2899 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
2900 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
2901 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
2902 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
2903 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
2904 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
2905 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
2906 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
2907 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
2908 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
2909 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
2910 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
2911 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
2912 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
2913 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
2914 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
2915 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
2916 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
2917 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
2918 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
2919 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
2920 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
2921 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
2922 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
2923 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
2924 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
2925 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
2926 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
2927 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2928 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2929 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2930 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
2931 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
2932 SMART ZONE GUNJABARI
2933 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
2934 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
2935 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
2936 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
2937 SNAP NEAR MANIPAL HOSPITALS
2938 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
2939 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
2940 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
2941 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2942 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2943 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
2944 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
2945 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
2946 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
2947 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
2948 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
2949 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
2950 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
2951 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
2952 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
2953 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
2954 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
2955 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
2956 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
2957 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
2958 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
2959 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
2960 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
2961 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
2962 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
2963 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
2964 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
2965 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
2966 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
2967 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
2968 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
2969 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
2970 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
2971 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
2972 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
2973 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
2974 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
2975 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
2976 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
2977 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
2978 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
2979 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
2980 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
2981 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
2982 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
2983 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
2984 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
2985 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
2986 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
2987 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
2988 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
2989 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
2990 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
2991 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
2992 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
2993 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
2994 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
2995 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
2996 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
2997 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
2998 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
2999 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
3000 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
3001 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
3002 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
3003 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
3004 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
3005 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
3006 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
3007 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
3008 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
3009 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3010 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3011 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
3012 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
3013 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
3014 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
3015 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
3016 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3017 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
3018 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
3019 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
3020 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
3021 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
3022 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
3023 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
3024 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3025 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
3026 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3027 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
3028 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
3029 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
3030 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
3031 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3032 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
3033 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
3034 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
3035 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
3036 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
3037 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
3038 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
3039 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
3040 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
3041 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
3042 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
3043 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
3044 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
3045 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
3046 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
3047 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
3048 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
3049 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
3050 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3051 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
3052 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
3053 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
3054 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
3055 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
3056 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
3057 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA
3058 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
3059 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
3060 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
3061 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
3062 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
3063 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3064 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
3065 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
3066 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
3067 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
3068 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
3069 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
3070 SRI JYOTHI HUMAN RESOURCES WELFARE ASSOCIATION 23-66/A/1/ MADHURA NAGAR SHAMSHABAD,9490324304
3071 SRI KALAI HERBAL BEAUTY PARLOUR MAHILA SANGHA #141 NEW 7 11 MAIN 1ST CROSS K P AGRAHARA BANGALORE
3072 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3073 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
3074 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
3075 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
3076 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
3077 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3078 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3079 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
3080 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
3081 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
3082 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
3083 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
3084 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
3085 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
3086 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
3087 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
3088 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
3089 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
3090 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3091 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
3092 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
3093 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3094 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
3095 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3096 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
3097 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
3098 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
3099 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
3100 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
3101 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3102 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
3103 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3104 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
3105 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
3106 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
3107 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
3108 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
3109 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3110 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
3111 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
3112 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
3113 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
3114 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
3115 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
3116 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
3117 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
3118 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3119 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
3120 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
3121 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
3122 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
3123 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
3124 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
3125 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
3126 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
3127 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
3128 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
3129 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY YASHODAGANASHREE NILAYA 8TH CROSS, SAPTHGIRI EXTN. TUMKUR-
3130 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATRE, M.G.ROAD, TUMKUR
3131 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
3132 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3133 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3134 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
3135 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
3136 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
3137 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
3138 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
3139 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
3140 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
3141 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
3142 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
3143 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
3144 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
3145 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
3146 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
3147 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
3148 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
3149 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
3150 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
3151 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
3152 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
3153 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
3154 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI TALUK, THIRUVALLUR DISTRICT
3155 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
3156 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
3157 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
3158 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
3159 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
3160 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
3161 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
3162 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
3163 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
3164 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
3165 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
3166 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
3167 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
3168 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
3169 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
3170 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
3171 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
3172 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
3173 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
3174 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
3175 SSC DDHGH
3176 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
3177 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
3178 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
3179 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
3180 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
3181 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
3182 SSR SERVICES INDIA LLP # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
3183 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
3184 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
3185 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
3186 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
3187 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
3188 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
3189 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
3190 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
3191 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
3192 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
3193 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3194 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3195 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3196 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
3197 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
3198 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
3199 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
3200 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
3201 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
3202 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
3203 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
3204 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
3205 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
3206 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
3207 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
3208 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
3209 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
3210 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
3211 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
3212 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
3213 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
3214 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
3215 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
3216 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
3217 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
3218 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
3219 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
3220 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
3221 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
3222 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
3223 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
3224 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
3225 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
3226 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
3227 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
3228 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
3229 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
3230 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
3231 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
3232 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
3233 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
3234 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
3235 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3236 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3237 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3238 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
3239 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
3240 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
3241 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
3242 SURAJ FOUNDATION VILLAGE AND POST JAGIR
3243 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
3244 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
3245 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
3246 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN,NEAR BUS STAND
3247 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
3248 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
3249 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
3250 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
3251 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
3252 S V EDUCATION AND INFRASTRUCTURE PRIVATE LIMITED 2-1-5/34 PLR LUXURY HOMES UPPERPALLY HYDERABAD
3253 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
3254 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
3255 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
3256 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
3257 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
3258 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
3259 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
3260 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
3261 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
3262 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
3263 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
3264 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
3265 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
3266 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
3267 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3268 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3269 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3270 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
3271 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
3272 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
3273 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
3274 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
3275 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
3276 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
3277 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
3278 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
3279 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
3280 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
3281 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
3282 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
3283 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
3284 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
3285 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
3286 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
3287 TALISMA TEST TALISMA TEST, TALISMA TEST
3288 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
3289 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
3290 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
3291 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
3292 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
3293 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
3294 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
3295 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
3296 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
3297 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
3298 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
3299 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
3300 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
3301 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3302 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3303 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
3304 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
3305 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
3306 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
3307 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
3308 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
3309 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, ALIGANJ, NEAR ENGG COLLEGE CROSSING
3310 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
3311 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
3312 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
3313 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
3314 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
3315 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
3316 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
3317 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
3318 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3319 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3320 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3321 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3322 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
3323 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3324 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3325 TERNA PUBLIC CHARITABLE TRUST SOLAPUR ROAD, OSMANABAD 413501
3326 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
3327 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
3328 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
3329 TEST GUWAHATI METRO
3330 TEST TEST
3331 TEST123 QLJLFHLJQ
3332 TEST1234TEST TEST
3333 TEST ABCD 5678 TESTABCD5678
3334 TESTDATA TEMP DELHI
3335 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
3336 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
3337 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
3338 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
3339 TEST FOR MAIL JADGSJAS
3340 TESTING TEST
3341 TESTM2 ASDWDDV
3342 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
3343 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
3344 THANDAVA VENKATESA MUTHALIYAR EDUCATIONAL TRUST 63,EST NAGART,1ST STREET, PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT, TAMILNADU
3345 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
3346 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
3347 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3348 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3349 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
3350 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
3351 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
3352 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
3353 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
3354 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
3355 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
3356 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3357 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3358 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
3359 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
3360 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
3361 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
3362 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
3363 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
3364 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
3365 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
3366 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO/PS THOUBAL, MANIPUR
3367 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
3368 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
3369 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
3370 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
3371 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
3372 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
3373 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
3374 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
3375 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
3376 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
3377 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
3378 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
3379 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
3380 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
3381 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3382 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3383 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
3384 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
3385 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
3386 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3387 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3388 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3389 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3390 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3391 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3392 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
3393 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
3394 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3395 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
3396 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
3397 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
3398 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
3399 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
3400 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
3401 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
3402 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
3403 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
3404 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
3405 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
3406 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
3407 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
3408 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
3409 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
3410 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
3411 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
3412 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR
3413 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR DIST.CHHOTAUDEPUR.GUJARAT
3414 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
3415 TRIMURTI WELDMESH PRIVATE LIMITED B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3416 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3417 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
3418 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
3419 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
3420 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
3421 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
3422 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
3423 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
3424 TRIVEDI AND ASSOCIATE TECKNICAL SERVICE PRIVATE LIMITED 102, SIDCUP TOWER, RACE COURSE, VADODARA
3425 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
3426 TRP HUI NAGAR
3427 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
3428 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
3429 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
3430 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
3431 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
3432 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
3433 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
3434 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
3435 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3436 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3437 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
3438 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
3439 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
3440 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
3441 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
3442 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
3443 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
3444 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
3445 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
3446 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
3447 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
3448 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
3449 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
3450 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
3451 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
3452 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI
3453 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
3454 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
3455 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
3456 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
3457 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
3458 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
3459 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
3460 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
3461 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
3462 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
3463 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
3464 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
3465 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
3466 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
3467 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
3468 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
3469 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
3470 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
3471 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
3472 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ-33A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3473 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ 33 A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3474 URJA GLOBAL LIMITED 487/63, 1ST FLOOR, NATIONAL MARKET, PEERAGARHI, NEW DELHI
3475 URMIDWAR INNOVATIVE ACTION AND RESEARCH FOUNDATION 18,DWARIKAPURAM,NEAR ASHARAM TRUST,CIRCULAR ROAD,BHARATPUR-321001
3476 USHODAYA RURAL AND URBAN DEVELOPMENT VOLUNTARY ORG O V ROAD MRO OFFICE COMPOUND BESIDE E SEVA KANDUKURU 523105 PRAKASAM DT ANDHRA PRADESH
3477 USIT INFOCOM PVT LTD A-152 GALI NO-4 SHAKARPUR DELHI
3478 USIT INFOCOM PVT LTD A-152,GROUND FLOOR,GALI NO-5,ARUNA PARK,SHAKARPUR NEW DELHI
3479 UTKAL BIPANNA SAHAYATA SAMITI PLOT NO-41,SECTOR-A,ZONE-D MANCHESWAR INDUSTRIAL ESTATE CITY-BHUBANESWAR,DIST-KHORDHA STATE-ODISHA
3480 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3481 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3482 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO- COLLEGE SQUARE,CUTTACK
3483 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3484 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3485 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3486 UTL TECHNOLOGIES LIMITED NO 19 6 ASHOKPURAM SCHOOL ROAD INDUSTRIAL SUBURB YESHWANTHPUR BENGALURU
3487 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
3488 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
3489 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUTOLA UTTARKASHI
3490 UVA JAGRITI SANSTHAN IN FRONT OF GRAM PANCHYAT BANSUR ALWAR RAJASTHAN PIN 301402
3491 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR,OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
3492 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR, OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
3493 VAG MANAGEMENT SERVICES D-42, GROUND FLOOR, SOUTH EXTENSION PART-1, NEW DELHI
3494 VAIDYANATH SARVANGIN VIKAS SANSTHA AT BRAHMAWADI, POST -TOKWADI, PARLI-BEED STATE HIGHWAY, PARLI-V., DIST. BEED
3495 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET TENKASI TIRUNELVELI DIST TAMILNADU
3496 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET,TENKASI,TIRUNELVELI
3497 VAISHNAVI COMPUTER AND EDUCATION SOCIETY PATHA THANA ., CHANDANGAON CHHINDWARA
3498 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
3499 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST YAVATMAL
3500 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
3501 VALEUR FABTEX PRIVATE LIMITED B-39, TRIVENI NAGAR, NEAR GOPALPURA BYPASS, JAIPUR, RAJASTHAN
3502 VALHALL EXPORTS PRIVATE LIMITED VALHALL EXPORTS PVT LTD,229,DSIDC SHEDS,OKHLA INDUSTRIAL AREA,PHASE-1,NEW DELHI-110020
3503 VALUE ADD KNOWLEDGE SERVICES PRIVATE LIMITED STILTH FLOOR, MAXIMUS 2B, RAHEJA MINDSPACE IT PARK, HITECH CITY,MADHAPUR, RANGAREDDY, TELANGANA-500081
3504 VAMANI OVERSEAS PRIVATE LIMITED 169 SECTOR 24
3505 VANDEMATRAM IDEAL PUBLIC SOCIETY GWALIOR VILL& POST BARAUA NEW BY PASS HIGHWAY TIRAHA AB ROAD VIPS COLLEGE CAMPUS GWALIOR
3506 VANI SANSTHA 126, MAHAVEER NAGAR Y, 80 FEET ROAD, NEAR ADARSH VIDYA MANDIR, SANGANER , JAIPUR, RAJASTHAN
3507 VANITHA JYOTHI MAHILA SANGAM H.NO: 8-44/2, SRI SAI NAGAR COLONY, SAROOR NAGAR, RANGA REDDY, TELANGANA(STATE)
3508 VANUSRA SOLUTIONS AND ENTERPRISES PVT LIMITED OPC REGISTERED ADDRESS: NEW NO 29/G2, N R FLATS, 6TH STREET, ALAGIRI NAGAR, VADAPALANI, CHENNAI, TAMILNADU. CORPORATE OFFICE: 11/23, 5TH FLOOR, K R BUILDING, L B ROAD, ADYAR, CHENNAI, TAMILNADU
3509 VAP TECHNOLOGY UNDER VIDYA SOCIETY SHRI GURU TEGH BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
3510 VARAIYA KRISHI BAGVANI EVAM JAN KALYAN SAMITI AMOLPATHA NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI M.P.
3511 VARAIYA VOCATIONAL TRAINING INSTITUTE NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI
3512 VARHAD VIKAS BAHUUDDES SHIKSHAN PRASARAK MANDAL HIWARKHED VARHAD VIKAS BAHUUDDESHIYVA SHIKSHAN PRASARAK MANDAL HIWARKHED C/O MANISH V BHAMBURKAR AT/PO HIWARKHED (RUPRAO)TQ.TELHARA DST.AKOLA
3513 VASANTHAM EDUCATIONAL AND RURAL DEVELOPED SOCITY 14A,SATHIYANARAYANAN STREET, VENKATASAPURI,
3514 VASAVYA MAHILA MANDALI 40-9/1-16 VASAVYA NAGAR, BENZ CIRCLE VIJAYAWADA
3515 VAS KNOWELDGE GROWTH INITATIVES PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
3516 VAS KNOWLEDGE GROWTH INITIATIVE PVT LTD B-73, NIRALA NAGAR
3517 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
3518 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
3519 VASUNDHARA NIZARAPAR JAGIROAD
3520 VASUNDHARA NZARAPAR JAGIROAD
3521 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3522 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3523 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3524 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3525 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3526 VASUNDHARA VIDYAPRASARAK V K S V SANSTHA REG.OFFICE- AT-DWARKADHISH BHAWAN,NIWANE,TAL-KALWAN,DT-NASIK PROJECT OFFICE- PANDURANG NAGAR,MANMAD,DT-NASIK
3527 VATSALYA EDUCATION AND CHARITABLE TRUST 2ND FLOOR KRISHNA SHRUSTI APARTMENT 10JUNCTION PLOT
3528 VAYAM INFO SOLUTIONS PVT LTD B-157, LOWER GROUND FLOOR, CHITRANJAN PARK, NEW DELHI
3529 VAYAM TECHNOLOGIES LIMITED THAPAR HOUSE, 124, JANPATH, NEW DELHI
3530 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3531 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3532 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3533 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3534 VEERA EDUCATIONAL SOCIETY #3-20-1/10, RAM MOHAN RAJA NAGAR, KAKINADA, KAKINADA MANDAL, EAST GODAVARI DISTRICT, AP
3535 VEER INDRA SOCILA GROUP SOCIETY ZILA PARTHMIKSHIK SHAK SHANG SIYARAMNAGAR, BHIHKHANPUR,BHAGALPUR
3536 VEER VIJAY EDUCATION SOCIETY VILL & POST-SUNDERPUR, DISTRICT-SAHARANPUR, UP
3537 VEE TECHNOLOGIES PVT LTD NO 71,SONA TOWERS,MILLERS ROAD,7TH FLOOR, BANGALORE
3538 VELLORE ACADEMY NO:508/A, VERSHEN COMPLEX 3RD FLOOR, MUTHURANGAM GOVT ARTS COLLEGE ROAD, OTTERI, VELLORE. TAMILNADU.
3539 VELS UNIVERSITY VELS INSTITUTE OF SCIENCE TECHNOLOGY AND ADVANCED STUDIES (VISTAS) ADDRESS : VELAN NAGAR, P V VAITHIYALINGAM ROAD, PALLAVARAM, CHENNAI - 600 117
3540 VEMULA BHASKAR FOUNDATION ELURU MINI BYPASS ROAD, GREEN CITY, PLOT NO 9.
3541 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE,JONNALAGADDA,NARASARAOPET,GUNTUR
3542 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE JONNALAGADDA(V), NARASARAOPET, GUNTUR DISTRICT
3543 VENUS COMPUTER EDUCATIONAL INSTITUTION 76, ALAGAR KOIL ROAD, GORIPALAYAM BUS STOP, MADURAI
3544 VFX ANIMATION COLLEGE # 28/1 SKT COMPLEX,KAKKALUR ROAD THERADI THIRUVALLUR DIST
3545 VGENUINE SOLUTIONS PRIVATE LIMITED FIRST FLOOR BUILDING 7 SIDCO IE RANGRETH
3546 VGENUINE SOLUTIONS PRIVATE LIMITED BUILDING 7 SIDCO RANGRETH
3547 VIBHA EDUCATIONAL DEVELOPMENT SOCIETY #2-31, VIDYA NAGAR, OPP. JNTU MAIN GAYE, ANANTAPUR, ANDHRA PRADESH.
3548 VIDHARBH RURAL RECONSTRUCTION FOUNDATION KONGHARA AT.KONGHARA POST.PIMPRI TQ.KELAPUR DIST YAVATMAL
3549 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3550 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3551 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NR. MUKHTANAND SOCIETY, NARMADANAGAR, BHARUCH.
3552 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3553 VIDHYADEEP SOCIETY P.O NARMADA NAGAR, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3554 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA
3555 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA VIDISHA
3556 VIDIYAL MAHALIR MEBATTU SANGAM 29K-RAMNAGAR, DEVAKOTTAI, SIVAGANGAI-DIST
3557 VIDIYAL MAHARIL MEMBATTU SANGAM 29K RAMNAGAR, DEVAKOTTAI SIVAGANGAI-DIST
3558 VIDYA SHRI GURU TEG BAHADUR TOWER NEAR KHALSA GIRLS SCHOOL NAINITAL ROAD HALDWANI NAINITAL
3559 VIDYA VAP TECHNOLOGY SHREE GURU TEG BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
3560 VIDYA GURU TEG BAHADUR TOWER, NEAR KHALSA SCHOOL, THANDI SADAK, SUBHASH NAGAR
3561 VIDYA NR KHALSA SCHOOL SUBASH NAGAR NAINITAL ROAD HALDWANI
3562 VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, COCHIN UNIVERSITY ROAD, CUSAT P.O, COCHIN
3563 VIDYADHIRAJA EDUCATION SOCIETY 27/3, ANAND NAGAR, KHANDELWAL MARG, MUMBAI
3564 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI
3565 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI 110096
3566 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE, PATPARGANJ, EAST DELHI
3567 VIDYA NIKETAN SEVABHAVI SANSTHA DONGARGAON DONGARGAON PO. DONGARPIMPALA TQ. GANGAKHED DIST. PARBHANI
3568 VIDYASAGAR ADEVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3569 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3570 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3571 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR 482003
3572 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463, KHANKA ROAD, LALLU POKHAR , MUNGER
3573 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463,MISHRA COLONY KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
3574 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED MISHRA COLONY, KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
3575 VIJAYA SOCIAL EDUCATIONAL AND CULTURAL TRUST #986, 2ND MAIN,VIDYARANYAPURAM, MYSORE - 570 008
3576 VIJAY GANGA RURAL MEDICAL AND RESEARCH FOUNDATION AT/P – BHALWANI, TAL-PARNER, DIST-AHMEDNAGAR. MAHARASHTRA
3577 VIJAY KUMAR CONTRACTOR HO. NO. - 37, MODERN SAKET COLONY, HISAR.
3578 VIJAY LAXMI TRANSPORT PRIVATE LIMITED AT.GANDHI CHOWK PO- BRAJRAJNAGAR DIST-JHARSUGUDA ODISHA
3579 VIKALP SEWA SAMITI 94, PASCHIMI TARAUS
3580 VIKASH D-2/7, INDUSTRIAL ESTATE RASULGARH, BHUBANESWAR
3581 VIKASH EDUCATION SOCIETY H.NO 1648 URBAN ESTATE JIND
3582 VIKASSHEEL FOUNDATION GRAM PANCHAYAT BHAVAN KE PAS, SHIVTARAI, TAHSIL-KOTA, BILASPUR, CHHATISGARH.
3583 VIKRANT EDUCATIONAL AND SOCIAL WELFARE SOCIETY 3-B ASHIRWAAD, HARIOM COLONY, 7 NO CROSSING, MORAR,GWALIOR
3584 VILLAGE DEVELOPEMNT AND ENVIRONMENTAL ORGANISATION THE SECRETARY NEAR TO INDIAN OVERSEAS BANK., KADAYAMPATTY POST, OMALUR TK., SALEM DISTRICT TAMILNADU
3585 VILLAGE DEVELOPMENT TRUST 63/25, KAMARAJ NAGAR, 3RD STREET, CHOOLAIMEDU, CHENNAI. CECIL ROGERS SALES HEAD 9884922452 9677256296
3586 VILLAGE INDIA KALYAN SANSTAHN FRONT ON STATE BANK BINDKI(FATEHPUR)-212635
3587 VILLAGE INDIA KALYAN SANSTAHN KAUSHAL VIKAS PRASHIKSHAN KENDRA
3588 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI
3589 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI ,FATEHPUR-212635 U.P
3590 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI(212635)-FATEHPUR U.P
3591 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI (FATEHPUR)-212635
3592 VILLAGE MULTIMEDIA PVT LTD NO.4, 1ST FLOOR, SUNRISE BUILDING, OPP KLE COLLEGE ,2ND STAG
3593 VIMALA DEVI SEWA SANSTHAN LOHIYA NAGAR MAHARAJGANJ
3594 VIMALAGIRI VIDYAPEETAM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 686664
3595 VINAYAGAR PERARASAR TRUST VPT 2/71 SABANAYAGAR STREET MA UAIDAYAR POST KATTUMANNARKOIL TALUK
3596 VINDHYA CONSULTANTS AND SERVICES PRIVATE LIMIITED KOTHI GULJAR BAG,OPPOSITE MULTIPURPOSE SCHOOL,BHARATPUR(RAJ.)
3597 VIRAJ GLOBAL SECURITAS PVT LTD B 156 NEW ASHOK NAGAR , NEW DELHI
3598 VIRAT VOLUNTARY ORGANIZATION FOR RURAL AGRICULTUR VILLAGE DEVARGHATA TEH- DABHRA DIST-JANJHGIR CHAMPA C G
3599 VIRAT VOLUNTARY ORG RURAL AGRI AND TECHNOLOGY 47, SUKH SAGAR PHASE 3, PIPLANI BHOPAL
3600 VIRINCHI LIMITED PLOT NO 10, SRK COLONY, WEST MAREDPALLY, SECUNDERABAD
3601 VIRTUAL COMPUTER EDUCATION SHIV NAGAR NH-1A UDHAMPUR (J&K)
3602 VIRTUAL COMPUTER EDUCATIONAL SOCIETY SHIV NAGAR NH-1A
3603 VIRTUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 TILWARA ROAD APPOSITE HP PATROL PUMP SAGRA JABALPUR
3604 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE MANAGING BOARD ROSALPATTI VILLAGE VIRUDHUNAGAR POST 626 001
3605 VISHNU DAYAL SHIKSHA SAMITI 529K/197 SANT KABIR LANE KHURRAM NAGAR LUCKNOW 226022
3606 VISHNU DAYAL SHIKSHA SAMITI 529K/197, SANT KABIR LANE, KHURRAM NAGAR, LUCKNOW
3607 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL G.T. ROAD GHAZIABAD
3608 VISHWABHARATHI EDUCATIONAL DEVELOPMENT TRUST 117 NIZAMPET ROAD KUKATPALLY BRINDAVAN COLONY HYDERABAD
3609 VISHWA BHARATI EDUCATION AND RURAL DEVELOPMENT SOCIETY SAI BRANDAVAN, POLICE STATION ROAD, HOKARNA
3610 VISHWAGYAN BAHUDDESIA SEVABHAVI SANSTHA OPP. UMER MASJID, GAZIPURA, LATUR
3611 VISHWA HINDU EDUCATION SOCIETY NO 1-111/1 A PDA COLLEGE ROAD AIWAN E SHAHI GULBARGA KARNATAKA
3612 VISHWATMAK JANGLI MAHARAJ ASHRAM TRUST AT MOHILI POST AGHAI TAL SHAHPUR SIDT THANE
3613 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA
3614 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI-75.
3615 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI
3616 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXT., NEAR SECTOR-7, DWARKA, DELHI.
3617 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
3618 VISION A RURAL DEVELOPMENT SOCIETY 14-8/3 SDPT RAMAYAMPET MEDAK DITRICT TELANGANA
3619 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
3620 VISION SHIKSHA SAMITI DEOLI KHASRA NO. 1493/1136, NEAR JAHAZPUR CHUNGI NAKA UNCHA DISTT. BHILWARA
3621 VISION VOICE EDUCARE SOCIETY 111D/1 GARFA MAIN ROAD,JADAVPUR
3622 VISRI TECHNOLOGIES AND SOLUTIONS PLOT NO 89, VENKATESHWARA ENCLAVE, OPP:PRIYADARSHINI HOTEL, SUCHITRA X ROADS, SECUNDERABAD.AP
3623 VISWA BHARATHI TRUST HYDER NAGAR , KUKAT PALLI, HYD - 85
3624 VISWADEEPTHI EDUCATIONAL SOCIETY 20-151/A, JAILKHAN STREET, MITTOOR CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH
3625 VISWA SAI ADS FLAT NO 502, SIVA RESIDENCY, HINDI NAGAR, PANJAGUTTA, HYDERABAD
3626 VITRUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 OPP HP PERTOL PUMP TILWARA ROAD SAGRA JABALPUR
3627 VIVEKANANDA NAGAR PRAGATI VIVEKANANDA NAGAR, POST OFFICE:BABLA GOBINDAPUR PS: SANTIPUR DIST: NADIA WEST BENGAL 741404
3628 VIVEKANANDARURALANDURBANDEVELOPMENTASSOCIATION HNO 6-3-266,NEAR GEETA VIGNANA HIGH SCHOOL,RAMAGIRI,NALGONDA TELAGANA STATE
3629 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS , EMAIL :VSSU.IN@GMAIL.COM , WWW.VSSU.IN , PH +91 3174 277451 /9735706439
3630 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS DISTRICT, WEST BENGAL, PIN 743336
3631 VIVEKANAND TT COLLEGE WARD 07 BHADRA
3632 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD,
3633 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD
3634 VJ SECURITY LLP B 156, NEW ASHOK NAGAR, NEW DELHI
3635 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E),NAVI MUMBAI,MAHARASHTRA STATE
3636 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E) NAVI MUMBAI 400614
3637 VLCC HEALTH CARE LIMITED 64, HSIDC, SECTOR-18, MARUTI INDUSTRIAL AREA, GURUGRAM
3638 VMART PLOT NO. 862,UDHYOG VIHAR INDUSTRIAL AREA PHASE V
3639 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED FLAT NO.B, OLD NO. 9, NEW NO.2, LAKSHMI COLONY, (NEAR NORTH CRESCENT ROAD), T-NAGAR, CHENNAI
3640 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED WZ-22, ASALATPUR, JANAKPURI
3641 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NR AUCKLAND HOTEL LAKKAR BAZAR SHIMLA
3642 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NEAR AUCKLAND HOTEL LAKKAR BAZAAR SHIMLA
3643 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3644 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR. BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL.
3645 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN BHOPAL
3646 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO.3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD BHOPAL
3647 VOC INDUSTRIAL TRAINING INSTITUTE VOC NAGAR,PATTALAMMAN KOVIL ST CHINNAMANUR
3648 VOCMAN INDIA PRIVATE LIMITED C 326, VIKAS PURI, NEW DELHI
3649 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
3650 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
3651 V S SHAH EDUCATION AND SOFTWARE PRIVATE LIMITED 1/14 PARUL APARTMENT, SHANTADEVI ROAD, NAVSARI
3652 V S SHAH EDUCATION AND SOFTWARE PVT LTD 1/14, PARUL APARTMENT SHANTADEVI ROAD NAVSARI. GUJARAT
3653 VVJ CHARITABLE TRUST 93G/6A/2, PALAI MAIN ROAD, OPP TVS SHOWROOM, THOOTHUKUDI-628002
3654 VYAVASAYA JANA CHAITANYA SAMITHI H.NO: 1-9-8/1/11, FLAT NO:303, B BLOCK, GIRISHIKHARA PLAZA, RAM NAGAR, HYDERABAD, TELANGANA
3655 VYUGA CONSULTING # 2905/3 & 4, HOTEL GANESH COMPLEX SRINIVASAM PILLAI ROAD, RAILADY THANJAVUR
3656 WAGONS LEARNING PRIVATE LIMITED A-8, A/7-8, 4TH FLOOR, SRUSHTI, OPPOSITE CORPORATION BANK, BANER ROAD, PUNE
3657 WAKE UP SKILLS PVT LTD VISHNU SOFTECH, 2ND FLOOR, SHRI DINESH COMPLEX, NEHRU CHOWK, AGRA ROAD, DEOPUR, DHULE
3658 WATERSHED ORGANISATION TRUST 'PRYAVARAN BUILDING' BEHIND MARKET YARD AHMEDNAGAR
3659 WATERSHED SUPPORT SERVICES AND ACTIVITIES NETWORK 12-13-452, STREET NO.1, TARNAKA, SECUNDRABAD
3660 WATRANA TRACTION COMPANY I-28,UPSIDC INDL.AREA,GREATER NOIDA-201306
3661 WATRANA TRACTION PRIVATE LIMITED G-3, SITE V, UPSIDC INDUSTRIAL AREA, GREATER NOIDA
3662 WBSCSTRDSEWA KULIANA, MALINCHA BELIABERAH
3663 WB SOFTECH 41/B/1 ASUTOSH MUKHERJEE ROAD P.S- BUDGE BUDGE P.O- BUDGE BUDGE BLOCK:- BUDGE BUDGE I KOLKATA, WEST BENGAL
3664 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH-700103
3665 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR, 24 PARGANA SOUTH, 700103.
3666 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR,24 PARGANA SOUTH-700103
3667 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH-700103
3668 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH ,700103
3669 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH - 700103
3670 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
3671 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
3672 WE ARE HUMAN FOUNDATION WE ARE HUMAN FOUNDATION WORKSHOP, C-68, MANGE RAM COMPLEX, LOWER GROUND FLOOR, MAHAVIR VIHAR, SECTOR-1, DWARKA, NEW DELHI.
3673 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3674 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3675 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3676 WELCOME P LTD SIVA ST, MADURAI
3677 WELFARE ORGANISATION FOR RURAL LEAGUE DEVELOPMENT VEJENDLA POST ,CHEBROLU M GUNTUR DIST
3678 WELFARE SERVICES ERNAKULAM PONNURUNNI, VYTILA, ERNAKULAM, KERALA, INDIA
3679 WENS LINK ALHAJ COMMERCIAL COMPLEX, 1ST FLOOR, NEAR AGV BANK, NH-15, P.O.- BECHIMARI, DISTRICT.- DARRANG, STATE- ASSAM
3680 WENS LINK AMAN COMPLEX, 1ST & 2ND FLOOR, NH-15, KHARUPETIA
3681 WEST BENGAL SC AND ST RURAL DEVELOPMENT AND SOCIO ECONOMICS WELFARE ASSOCIATION GOPIBALLAVPUR , PASCHIM MEDINIPUR
3682 WE THE PEOPLE ROOM NO. 102, D211, LAXMANSINGH COMPLEX I, MUNIRKA, NEW DELHI 110067
3683 WHIZZY WORLD SURTEING VB COLLEGE ROAD RAINAWARI
3684 WINGSEDUCATIONS I-II 229/7 SANGAM VIHAR NEW DELHI
3685 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.195,EMKAY COMPLEX, KANGAYAM ROAD,TIRUPUR
3686 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.36,PRABHU NAGAR,RAKKIYAPALAYAM PIRIVU,TIRUPUR
3687 WISDOM EDUCATIONAL AND CHARITABLE TRUST 36 PRABHU NAGAR RAKKIYAPALAYAM PIRIVU KANGAYAM ROAD TIRUPUR 641606
3688 WITNUT COMPUTING PRIVATE LIMITED G77/2, SF, SHAHEEN BAGH, AF ENCLAVE-II, OKHLA, NEW DELHI
3689 WOMEN AND CHILDREN WELFARE SOCIETY 15/8, BIG STREET CHEYYAR
3690 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
3691 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGR, KURINJIPADI, CUDDALORE
3692 WOMEN EMPOWERMENTAND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
3693 WOMEN ENTERPRENEURS OF KARNATAKA ASSOCIATION #6, BESIDE ESHWAR TEMPLE, ESHWAR NAGAR, AMARGOL, OPP.APMC HUBLI
3694 WOMEN ENTREPRENEURSHIP DEVELOPMENT INSTITUTE WEDI CPK COMPLEX, NEAR ARYASAMAJ, RAM MOHAN ROAD, KOZHIKODE
3695 WOMEN INTERNATIONAL NETWORK WIN D-8/8, RIGHT SIDE, PARYAVARAN COMPLEX,SAID-UL-A-JAIB,SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
3696 WOMEN INTERNATIONAL NETWORK WIN D-8/8, PARYAVARAN COMPLEX, SAID-UL-A-JAIB, SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
3697 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI, KISHAN PURA, PANIPAT
3698 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI KRISHAN PURA PANIPAT
3699 WOMENS WELFARE SOCIETY 5-9-102/3, 1ST FLOOR, PUBLIC GARDEN ROAD, NAMPALLY, HYDERABAD
3700 WORLD WIDE SECURITY ORGANIZATION B-6, VIDHYA NAGAR HOSHANGABAD ROAD BHOPAL , MADHYA PRADESH
3701 XECUTE HR SOLUTIONS PVT LTD #307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON – 122018
3702 XECUTE HR SOLUTIONS PVT LTD 307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON
3703 XI TECHNOLOGIES PVT LTD 4TH FLOOR, CHAKMIR, BUDGE BUDGE TRUNK ROAD, MAHESHTALA, KOLKATA – 700 141
3704 XYZ XYZ
3705 XYZ SSIISI SSSSF SDG SDG SG
3706 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE-411005
3707 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, CTS NO-95 A, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE
3708 YASH BAHU UDDESHIYE SEVA BHAVI SANSTHA TULSAI NIVAS, JALALPUR ROAD, NEAR ARUNODAYA RESIDENCY, PARLI VAIJNATH, DIST : BEED, MAHARASHTRA
3709 YASH EDUCATIONAL SOCIETY III-H/146, NEHRU NAGAR, GHAZIABAD
3710 YASH EDUCATION SOCIETY A/P. NIRA, TAL PURANDAR, DIST : PUNE MAHARASHTRA
3711 YASHWANT SHIKSHAN SANSTHA 11, FIRST FLOOR, BACK OF SAMBHAJI NAGAR KAMAN,NEAR SHIVRAJ PETROL PUMP NH- 4 SATARA PIN- 415004.
3712 YATHARTH GURUKRUL COMPUTER SHIKSHAN SAMITI INDORE ROAD DEPALPUR
3713 YELLOW HOME HEALTH CARE PVT LTD 1-63-5-8B, KAVURI HILLS, JUBILEE HILLS POST
3714 YESH BAHUUDDESHIYA SEWABHAVI SANSTHA RAMPURI BK AT.POST.RAMPUTI BK, TQ.MANWAT DIST.PARBHANI HEAD OFFICE RAHUL NAGAR, PARBHANI
3715 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH.
3716 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1, MOTILAL NEHRU NAGAR (EAST) BHILAI
3717 YOUNGSTERS ASSOCIATION YOUNGSTERS ASSOCIATION # 2/489,2ND FLOOR, OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL, NAGARAJPET, KADAPA -516001, CON: 08562-222083, FAX: 08562-222149
3718 YOUNGSTERS ASSOCIATION #2/489,OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL,NAGARAJPET,KADAPA -516001, CON:08562-222083,FAX:08562-222149.
3719 YOUTH ACTION FOR RURAL DEVELOPMENT RANI BHASKAR NILAYAM, 6-3-668/10/20, 1ST FLOOR, NEAR VENKATESHWARA SWAMY TEMPLE, DURGANAGAR COLONY, PANJAGUTTA, HYDERABAD, TELANGANA STATE
3720 YOUTH BASE DEVELOPMENT SOCIETY C- 1087, TIGRI COLONY
3721 YOUTH EDUCATIONAL SOCIETY HARIDWAR BYPASS ROAD, NEAR RISPANA PUL OPP. AKASHWANI BHAWAN DEHRADUN UTTARAKHAND
3722 YOUTH EFFORTS FOR SOCIETY YES TRUST NO 47, 1ST FLOOR KEB COLONY UDAYAGIRI MYSORE
3723 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3724 YOUTH EMPOWERMENT SOCIETY 44 PRAHALAD COLONY, NEAR BY VISHNU GARDEN , SANGANER THANA , JAIPUR
3725 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3726 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3727 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3728 YOUTH INDIA SAKSHARTA MISSION BHITAR KAMTA, GOSANIMARI, DINHATA COOCH BEHAR, WEST BENGAL
3729 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
3730 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
3731 YOUTH UPTURN VOLUNTARY ASSOCIATION 16-3-245, 3RD FLOOR, TRENDSET TOWERS, RAMALINGAPURAM, NELLORE.
3732 YPJ EDUCATIONAL SOCIETY D.NO.1-9-837/2 TOP OF HIND BAKERY, POCHAMMAGALLY, NIZAMABAD DISTRICT, TELANGANA STATE
3733 YPR MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH
3734 YUVADESH SHIKSHA EVAM SAMAJIK KALYAN SAMITI C/O SHOURYA CONSULTANCY,GROUND FLOOR,JYOTI CINEPLEX,M P NAGAR,ZONE I BHOPAL
3735 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
3736 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
3737 YUVA JAGRUTI MANCH B-2/22, WALLFORT ENCLAVE, BEHIND RAMKRISHNA HOSPITAL, PACHPEDI NAKA, RAIPUR
3738 YUVA SANKALP BAHUUDDESHIYA SANSTHA WORD NO. 12, MOHAPA, TAL KALAMESHWAR, DIST NAGPUR
3739 YUVA SANKALP BAHUUDDESHIYA SANSTHA NAGPUR PLOT NO. 28, GOPAL NAGAR, NAGPUR
3740 YUVASHAKTI FOUNDATION 8 /4 , LAKSHA , PURNANAGAR ,BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE-411019
3741 YUVASHAKTI FOUNDATION 8/4 , PURNANAGAR , NEAR RTO , CHINCHWAD , PUNE
3742 YUVASHAKTI FOUNDATION 8/4 , LAKSHA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
3743 YUVASHAKTI FOUNDATION 8/4 , LAKSHYA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
3744 YUVA TRAINING AND PLACEMENTS RAMALINGAPURAM, TRENDSET TOWERS,3RD FLOOR,NELLORE-524001
3745 YUVA VIKAS SOCIETY 26,DEENDAYAL UPADHYAY MARG,ITO,NEW DELHI
3746 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR JAMMU AND KASHMIR
3747 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR, JAMMU AND KASHMIR
3748 ZENITH CAREER WINGS 51-A,NEHRU STREET , RAMNAGAR, COIMBATORE
3749 ZENITH NEEDS MULTMEDIA T.S.NO:3074-3075, GNANA ARUL PLAZA 1ST FLOOR, RAJA RANI COMPLEX, KEELA RAJA VEETHI, PUDUKKOTTAI DISTRICT.
3750 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL HYDERABAD
3751 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL
http://rural.nic.in    http://aajeevika.gov.in    http://nird.org.in http://www.nabcons.com http://ddugky.gov.in