Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
3 982 PARKAL WARANGAL DISTRICT ANDHRA PRADESH 9-82 PARKAL WARANGAL DISTRICT ANDHRA PRADESH.
4 A2Z MULTISERVICES AND IT SOLUTIONS PVT LTD H.NO.201/7,DOCTORS COLONY,CIVIL LINES,BAREILLY MOB:9897033301
5 A2Z MULTISERVICES IT SOLUTIONS PVT LTD PLOT NO. 272, NH-30, HARDUA NAWABGANJ, BAREILLY
6 AAA AAA
7 AAA BBB JABBALPUR, KATHMANDU,
8 AAA SOCIETY A AA AAAAAAAAAAAAAA
9 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
10 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 NEAR BY DR. VIJAY GANDHI, BAIHAR ROAD C/O PANCHSHEEL COMPUTER BALAGHAT DIST- BALAGHAT
11 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 BAIHAR ROAD BESIDE OF DR GANDHI C/O PANCHSHEEL COMPUTER BALAGHAT DIST-BALAGHAT
12 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
13 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
14 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
15 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
16 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
17 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
18 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
19 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
20 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
21 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
22 AAKASH CONDUCTORS AND WIRES INDIA PRIVATE LIMITED 14-B, NEW INDUSTRIAL ESTATE, RAWABHATA, RAIPUR C.G.
23 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
24 AAMC TRAINING INDIA PRIVATE LIMITED AAMC TRAINING INDIA PRIVATE LIMITED 702-A, 7TH FLOOR, TOWER NO. 2, B-BLOCK PANCHSHEEL WELLINGTON, SECTOR-1, CROSSING REPUBLIK GHAZIABAD--
25 AAMC TRAINING INDIA PRIVATE LIMITED H.NO. 702-A, 7TH FLOOR , TOWER NO. 2 BLOCK -B, PANCHSHEEL WELLINGTON, SETOR-1, CROSSING REPUBLIK GHAZIABAD
26 AAMC TRAINING INDIA PRIVATE LIMITED 702-A, 7TH FLOOR, TOWER NO. 2 BLOCK B, PANCHSHEEL WELLINGTON, SECTOR-1- CROSSING REPUBLIK GHAZIABAD.
27 AAMC TRAINING INDIA PRIVATE LIMITED 026, SMARTWORKS BUSINESS CENTRE, LOGIX BUSINESS PARK, C-28,29 SECT-62 NOIDA-201309, INDIA
28 A AND A EDUCATIONAL AND IT SOLUTIONS PLOT NO.170, VENKATESWARA COLONY, PADMAVATI NAGAR, VIZIANAGARAM
29 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
30 AARAV MEDISHINE PRIVATE LIMITED 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.- DURG (C.G.)
31 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
32 AARNOVA TECHNOLOGIES PRIVATE LIMITED 1104,VIKRANT TOWER,RAJENDRA PLACE,NEW DELHI
33 AARNOVA TECHNOLOGIES PRIVATE LIMITED 1104, RAJENDRA PLACE, VIKRANT TOWER, NEW DELHI
34 AARNOVA TECHNOLOGIES PRIVATE LIMITED PLOT NO. 357-B, 2ND FLOOR, SECTOR-37, PACE CITY-II, UDYOG VIHAR, PHASE-VI, GURGAON
35 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
36 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
37 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
38 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
39 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
40 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
41 AARTHI A1 TRADERS 9D/14, 50 FEET ROAD, RAMAKRISHNAPURAM, KARUR
42 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
43 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
44 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
45 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
46 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
47 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
48 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
49 AAS HUMAN WELFARE SOCIETY VILLAGE DILRA RAIPUR AKKA DILARI RAMPUR ROAD MORADABAD
50 AASTHA EDUCATION AND WELFARE SOCIETY C/O,ABHAYKUMAR DANDAGE, F-5,SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
51 AASTHA EDUCATION AND WELFARE SOCIETY C/O, ABHAYKUMAR DANDAGE, SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
52 AASTHA EDUCATION AND WELFARE SOCIETY C/O ABAHYKUMAR DANDAGE F-5 SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
53 AASTHA SANSKRITIK EVAM SAMAJIK KALYAN SAMITI PLOT, NO. 160, 2ND FLOOR, ZONE-1 , M.P. NAGAR BHOPAL
54 AASTHA VIKAS TRUST 205 B 21ST CENTURY BUSINESS CENTER RING ROAD SURAT
55 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
56 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO.1, SUMSUL AARIFFA NAGAR, PERIYAR SALAI ROAD, KEELAVASAL, THANJAVUR
57 AATHI ANBU CHARITABLE TRUST 194/6,KASPA STREET, MELAPILLAYAR KULAM, TIRUNELVELI.
58 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
59 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
60 AAYUSHMAN SAMITY 2A- BASANT VIHAR COLONY,MAHAVIR NAGAR, RAIPUR CHHATISGARH
61 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
62 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
63 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
64 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
65 ABBASI EDUCATIONAL AND WELFARE TRUST C-1076, HASTSAL ROAD, UTTAM NAGAR,NEW DELHI
66 ABBASI EDUCATIONAL AND WELFARE TRUST A2/25B, FIRST FLOOR, HASTSAL ROAD, UTTAM NAGAR, NEW DELHI, NEAR HOLI CHOWK
67 ABC JHSDJHDFKLJDFKJHJKGD
68 ABC KALARA BURDWAN
69 ABC JKLJLJK
70 ABC BHOPAL
71 ABCD ADRS LINE 2
72 ABCD ABCDEFGHIJKLMNOP
73 ABCD ABCD
74 ABC FIRM LTD PATNA
75 ABCL EDUCATIONAL PRIVATE LIMITED 52/12, M.M.H. COLLEGE ROAD, MODEL TOWN WEST GHAZIABAD
76 ABCL EDUCATIONAL PRIVATE LIMITED 52/12 M.M.H. COLLEGE ROAD, MODEL TOWN WEST,GHAZIABAD
77 ABC PVT LTD PUNE
78 ABC TRUST LKCNSDKAJD
79 ABDIN EDUCATINAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
80 ABDIN EDUCATIONAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
81 ABD PVT LTD XYZ
82 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
83 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
84 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
85 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
86 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
87 ABET TRADELINK PRIVATE LIMITED C/O RANJEET KUMAR CHOUDHARY VATSAYAN, CHANKYAPURI, GAUSHALA ROAD, RAMGARH JHARKHAND 829122
88 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
89 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
90 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
91 ABHINAYTOSH MAHILA BAL VIKAS SAMITI SEVA HOSPITAL PREMISES, PADMAKAR NAGAR, MAKRONIA, SAGAR, MADHYA PRADESH
92 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
93 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
94 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
95 ABHYUDAY VEDANT SOCIETY VANDE MATARAM BHAVAN, CHURCH ROAD KUNKURI, DIST. - JASHPUR
96 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
97 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
98 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
99 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
100 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
101 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
102 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
103 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
104 ACAT EDUCATION PRIVATE LIMITED ACAT EDUCATION PRIVATE LIMITED,1ST FLOOR,RAJ COMPLEX,SANICHARA ASTHAN,DR. P.GUPTA ROAD,NEAR VIJAYA BANK,WARD-20,CHATTI,RATANPUR,BEGUSARAI (BIHAR,PIN-851101
105 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
106 ACCEL IT RESOURCES LIMITED NO.37 V FLOOR, CHATEAU D' AMPA BUILDING, NELSON MANICAKAM ROAD, AMINJIKARAI, CHENNAI, TAMILNADU
107 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
108 ACCESS SOLAR LTD PLOT NO.104, PRASHANTHI NAGAR, I.E.KUKATPALLY HYDERABAD – 500 072 TELANGANA, INDIA
109 ACCILERATOR SMARTGRO MARKETING PRIVATE LIMITED #1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARTHAHALLI
110 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
111 ACCURATE EDUCATION AND RESEARCH SOCIETY C-187,SURYANAGAR, GHAZIABAD, UP
112 ACE CONSULTING PRIVATE LIMITED NO.309 2ND FLOOR DEEP PLAZA OPPOSITE GURGAON COURT SOHNA ROAD GURGAON HARYANA 122001
113 ACE FOUNDATION SHAKTINAGARAPADA,NEAR POLICE STATATION, BHAWANIPATNA
114 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
115 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
116 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
117 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
118 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
119 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
120 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
121 ACTION FOR ADVANCEMENT OF SOCIETY A-30, MADHAV RAO SAPARE NAGAR, BIRGAON, RAIPUR, CHHATTISGARH
122 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
123 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
124 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
125 ACTTS INFOTECH SERVICES PRIVATE LIMITED WARD NO.11 TARANAGAR CHURU
126 ADAIKALA MADHA TECHNICAL INSTITUTE TRUST ADAIKALA MADHA TECHNICAL INSTITUTE, THOOTHUR MAIN ROAD, ELAKURICHI VILLAGE & POST, THIRUMANUR - VIA, ARIYALUR - TK & DT, TAMIL NADU STATE, PIN - 621715.
127 ADAM TEST_XYZ
128 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
129 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
130 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
131 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
132 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
133 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
134 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
135 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
136 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
137 ADARSH FOODS CITY STATION ROAD KHURJA
138 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
139 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
140 ADARSH SHIKSHAN PRASARAK MANDAL OSMANABAD PRASHASAKIYA BHAWAN SHRIPATRAO BHUSAE HIGH SCHOOL OSMANABAD MAHARASHTRA OSMANABAD-
141 ADARSH SHIKSHAN PRASARAK MANDAL OSMANABAD ADARSH SIHSHAN PRASARAK MANDAL, OSMANABD ADMINISTRATIVE BUILDING, SHRIPATRAO BHOSALE HIGH SCHOOL,CAMPUS TAMBRI VIBHAG, OSMANABAD
142 ADARSH SHIKSHAN PRASARAK MANDHAL ADIMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD MAHARASHTRA
143 ADARSH SHIKSHAN PRASARAK MANDHAL ADMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD
144 ADARSH SHIKSHAN SAMITI KARELI MAHADEV WARD KARELI
145 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7,SALUMBER,DIST.UDAIPUR(RAJ.)
146 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7, SALUMBER, DIST.UDAIPUR(RAJASTHAN)
147 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7,SALUMBER
148 ADARSH SHIKSHA SAMITI PATELWADA,WARD O.7,SALUMBER,DIST.UDAIPUR(RAJASTHAN)
149 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
150 ADARSH VIDHYA SAMITI 87 UTTAMGIRI COLONY,NEAR DOUBLE CROSSING, SHASTRIPURAM AGRA
151 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
152 ADEPT EDUSYS PRIVATE LIMITED HALL NO. 6,11 NO STOP,ARERA COLONY,BHOPAL,(M.P.)
153 ADEPTEDUSYSPVTLTD HALL NO.-6,11 NO. STOP,ARERA COLONY,BHOPAL(M.P.)
154 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
155 ADESHWAR SHIKSHAN SAMITI 26 MEDICAL COMPLEX, G.E ROAD RAIPUR,CHHATISGARH
156 ADESHWAR SHIKSHAN SAMITI 26 MEDICAL COMPLEX,G.E ROAD, RAIPUR, C.G
157 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
158 ADHARSHA MAHILA MANDALI PULLUR,KURNOOL MANDAL,DIST.AP
159 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
160 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
161 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
162 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
163 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
164 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
165 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
166 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
167 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
168 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
169 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
170 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
171 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
172 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
173 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
174 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
175 ADIVASI SOCIETY FOR HELPING ATTITUTE RAMAN PADA, KUTRA
176 ADIWASI DEOMOGRA EDUCATION SOCIETY AT POST PATHRAI, TALUKA AND DIST NANDURBAR
177 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
178 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
179 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
180 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
181 ADVANCED LIFE CARE MULTIDESCIPLINARY HOSPITAL PRIVATE LIMITED 26-KASIA ROAD CANTT CROSSING DAUDPUR GORAKHPUR U.P
182 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
183 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
184 ADVANCE INFORMATION AND MULTIMEDIA EDUCATION SOCIETY 53 A, MAIN ROAD KARRAHI, BARRA, KANPUR
185 ADVENT CHEMBIO PRIVATE LIMITED 21, QUEEN VIEWS, JUHU ROAD, MUMBAI
186 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
187 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
188 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
189 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
190 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
191 AGERSEN SEWA SAMITI RZC-187, MAHAVIR ENCLAVE, PALAM COLONY NEW DELHI-110045
192 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
193 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
194 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
195 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
196 AGRI AND SOCIO ECONOMIC DEVELOPMENT TRUST KALIAMMAN KOVIL NEAR, GENGUVARPATTY POST PERIYAKULAM
197 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
198 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
199 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
200 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
201 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
202 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
203 AIFA INFOTECH PVT LTD 572/2D, ADRSH NAGAR, NEW RAILWAY ROAD, OPP, AUTO STAND, GURUGRAM, HARYANA-122001
204 AIFA INFOTECH PVT LTD 572/2, AADRSH NAGAR, NEW RAILWAY ROAD, OPP. AUTO STAND, GURUGRAM HR
205 AIFA INFOTECH PVT LTD 572/2,ADARSH NAFAR, NEW RAILWAY ROAD, OPP. AUTO STAND,GURUGRAM HARYANA-122001
206 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
207 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
208 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
209 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
210 AIMTRON ELECTRONICS PVT LTD PLOT NO.1/A, G.I.D.C. ESTATE WAGHODIA
211 AIRWAAVE COMMUNICADO INDIA PRIVATE LIMITED NO.353,SRI DURGA ARCADE, 3RD FLOOR, 2ND MAIN ROAD, 8TH BLOCK JAYANAGAR, BANGALORE KA
212 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
213 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
214 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
215 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
216 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
217 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
218 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
219 AKASH COMBINES LIMITED PLOT NO 9, MALVIYA NAGAR BHOPAL
220 AKASH COMPUTERS SAKSHARTA MISSION AND EDUCATION CHARITBALE TRUST OFFICE NO 9-10, F.F. SAI BABA COMPLEX, POLICE STATION ROAD, PLOT NO 216, WARD 12-B,GANDHIDHAM
221 AKASH COMPUTERS SAKSHARTA MISSION AND EDUCATION CHARITBALE TRUST OFFICE NO 9-10, PLOT NO 216, WARD 12-B,SAI BABA COMPLEX,GANDHIDHAM,KUTCH.
222 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
223 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
224 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
225 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
226 AKRITI SAMAJIK SANSTHAN 3RD FLOOR, STAR GLAXY COMPLEX, NEAR- VERMASELL PETROL PUMP, DAKBUNGLOW ROAD, HAJIPUR, VAISHALI, BIHAR 844101
227 A K SAMANTARAY AND COMPANY PRIVATE LIMITED PLOT NO. 309/1801, SUB PLOT NO.1, SBI CAMPUS, SAILASHREE VIHAR, BHUBANESWAR
228 AKSARA SOCIAL SERVICE SOCIETY H.NO-9-82 PARKAL WARANGAL DISTRICT
229 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
230 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
231 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
232 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
233 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
234 ALAYAM WELFARE TRUST 117-B, PERIYAR NAGAR, PULIAKULLAM COIMBATORE-641045, TAMILNADU.
235 ALBAN COMMUNICATIONS INDIA PRIVATE LIMITED 502, AGH CHAMBERS, 379-381 NARSHI NATHA STREET, MASJID BUNDER(WEST) MUMBAI-400009, MAHARASHTRA
236 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
237 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
238 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
239 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
240 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
241 ALFURQAN COMPUTERS RAMBAGH PAYEEN SRINAGAR,KASHMIR OPPOSITE ZUM ZUM COMPLEX
242 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
243 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
244 ALHUDA PUBLIC SHIKSHA SEWA SAMITI VILL BANKATWA MAKOLIYA P/O TURHANI RAJJAB DISTT BAHARAICH UP 271802
245 ALIGN SKILLS EDUTECH W.NO. 6, NEAR CHUNA FATAK, HANUMANGARH
246 ALKA PAU LUDHIANA
247 AL KARIM BAHUUDDESHIYA SEVABHAVI SANSTHA AT POST PALI
248 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
249 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
250 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA
251 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
252 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
253 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
254 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
255 ALLIANCE CHARITABLE TRUST PLOT NO 13 & 14, FNO 101, PREMIA URBANA, PILLAR NO 208, UPPARPALLY, RAJENDRA NAGAR ROAD
256 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
257 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
258 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
259 ALL INDIA COUNCIL OF TECHNICAL EDUCATION AND TECHNOLOGY UTTRA KOWGACHI, VIVEKANANDA LANE, NEAR – SHAKTI SANGHA CLUB, P.O. - SHYAMNAGAR, P.S.- JAGATDDAL
260 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
261 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
262 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
263 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
264 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
265 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
266 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
267 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
268 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
269 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
270 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
271 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
272 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
273 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
274 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
275 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
276 ALL TIME SECURITIES PVT LTD 201 RG MALL, OPP. DHARAMKUNJ APPTT., SECTOR-9, ROHINI, DELHI
277 ALMIGHTY INTERNATIONAL SOCIETY OUTSIDE MANNA PHATAK, MALERKOTLA
278 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
279 ALPS SOLUTIONS PRIVATE LIMITED KHASRA NO-654/2,PILLAR NO-501,MUNDKA,DELHI
280 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
281 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
282 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
283 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
284 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
285 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
286 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
287 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
288 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
289 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
290 AMAZE ENGINEERS SOLUTION GAT NO. 679/2, OPP. BUS STOP, KURULI PHATA, KURULI, KHED, DIST PUNE-
291 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
292 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
293 AMBIKA PRATISHTHAN MAIN ROAD, SAILU TQ. SAILU DIST. PARBHANI
294 AMECH BUSINESS SOLUTION PRIVATE LIMITED A 22,2ND FLOOR, SECTOR-3 NOIDA
295 AMEYAA TECH SOLUTIONS PVT LTD PLOT NO. 219, H.NO. 8-2-293/82/A/219, PHASE 1, ROAD NO.17, JUBILEE HILLS, OPPSITE JIC EXIT GATE, HYDERABAD, TELANGANA
296 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
297 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
298 AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-686/K/15, 4TH FLOOR, BANJARA HILLS, ROAD NO12,HYDERABAD.
299 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
300 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
301 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
302 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
303 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
304 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
305 AMRAWATI EDUTECH OPC PRIVATE LIMITED 89-P RAMJANKI NAGAR CHOWK BASHARATPUR GORAKHPUR
306 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
307 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
308 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
309 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
310 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
311 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
312 AMRUTHA FOUNDATION NO.306, D.B. ROAD, R.S..PURAM, COIMBATORE - 641002 TAMILNADU - INDIA
313 AMRUTHA FOUNDATION NO.306, D.B.ROAD, R.S.PURAM, COIMBATOR E- 641 002
314 AMS EDUCATIONAL TRUST : 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
315 AMS EDUCATIONAL TRUST 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
316 AMUDHASURABI NEAR INDIAN OIL BANK THIRUVALUVAR NAGAR, PENNAGARAM (PO) & TALUK, DHARMAPURI (DT), TAMILNADU
317 AMUDHA SURABI SEVAI MAIYAM 4/135 KULLANUR,HOHENAKKAL MAIN ROAD, PIKKAMPATTI, DHARMAPURI, TAMILNADU
318 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
319 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
320 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
321 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
322 ANANDAM EDUCATIONAL AND CHARITABLE TRUST NO.15/4 VIVEKANANDAR SALAI, THIRUVALLUVAR NAGAR, SALAVANPET,VELLORE.
323 ANANDAM EDUCATIONAL AND CHARITABLE TRUST NO.15/4 VIVEKANANDAR SALAI, THIRUVALLUVAR NAGAR, SALAVANPET, VELLORE
324 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
325 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
326 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
327 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
328 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
329 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
330 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
331 ANDHRA CARDIOLOGY ASSOCIATES PRIVATE LIMITED 6-3-248/1/1A, CARE HOSPITAL, ROAD NO.1, BANJARA HILLS, HYDERABAD-500034
332 ANDHRA MAHILA SABHA ANDHRA MAHILA SABHA DDMS,LITERACY HOUSE, AMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
333 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
334 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM, PERAMBALUR
335 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM
336 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
337 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
338 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
339 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
340 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
341 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
342 ANDLEEB WELFARE SOCIETY KHAG BUDGAM
343 ANEES MEMORIABLE EDUCATIONAL TRUST MUQUEEM PLAZA 1ST FLOOR BUMGUNDESHWAR CIRLCE BVB COLLEGE ROAD BIDAR 585403
344 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR,BUMGUNDESHWAR CIRCLE,BVBCOLLEGE ROAD BIDAR KARNATAKA,INDIA
345 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR ,BUMGUNDESHWAR CIRCLE,BVB COLLEGE ROAD BIDAR,KARNATAKA
346 ANFAR FOUNDATION 2ND FLOOR, ANFAR SHOPPING CENTRE, J.K. KEDIA ROAD, HOJAI, P.O. HOJAI, P.S. HOJAI, DISTRICT- NAGAON, ASSAM, INDIA
347 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
348 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
349 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
350 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
351 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
352 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
353 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
354 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE
355 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE, DHARAMPETH
356 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
357 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
358 ANJANEYA CHARITABLE AND EDUCATIONAL TRUST OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT BEHRAMPUR GANJAM
359 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
360 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
361 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
362 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
363 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
364 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO 3,DIGDOH HILLS ,HINGNA MIDC,NAGPUR
365 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO.3, DIGDOH HILLS,HINGNA MIDC, NAGPUR
366 ANKUSH SHIKSHAN SANSTHA ANKUSH SHIKSHAN SANSTHA, CRPF GATE, DIGDOH HILLS, HINGNA MIDC, NAGPUR, 440016
367 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
368 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
369 ANKUSH WELFARE SOCIETY D.NO;41-1/3-5 KRISHNA LANKA DVARAKA NAGAR VIJAYAWADA
370 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
371 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
372 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
373 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
374 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
375 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
376 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
377 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
378 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
379 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
380 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
381 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
382 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
383 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
384 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
385 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
386 ANNAMALAI ASDJFKL ADF ASDF AS F
387 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
388 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
389 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
390 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
391 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW MOBILE NO. 7985486626
392 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
393 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
394 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
395 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
396 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
397 ANTOYODAYA SAI KRIPA SEWA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA DISTT SAGAR
398 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
399 ANTYODAYA SAI KRIPA SEVA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA
400 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
401 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
402 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
403 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
404 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
405 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
406 ANUMEHA HEALTH CARE AND FASHION PVT LTD ANUMEHA VILLA (AHCC) P N BOSE COMPOUND NEAR KC ROY MEMORIAL HOSPITAL BESIDE BANARJEE LODGE LALPUR RANCHI JHARKHAND
407 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
408 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
409 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
410 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
411 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
412 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
413 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
414 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
415 APAAR C/O DR. M.C. BHATT, 7/12 RAMASHRAM, TAKANA ROAD
416 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
417 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
418 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
419 APEX EDUCATION AND DEVELOPMENT SOCIETY 2ND FLOOR,HOTEL VRUNDAVAN,OPP BUS STAND,DAHOD.GUJ
420 APEX EDUCATION AND DEVELOPMENT SOCIETY NEAR VOHRA MUSAFIR KHANA. STATION ROAD,DAHOD
421 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
422 APEX INDIA EDUCATION AND CHARITABLE TRUST APEX INDIA EDUCATION AND CHARITABLE TRUST, DOOR NO' 11 T337 ' T'K'PET' NEAR NADAR KALYANA MANDAPAM, GUDALUR, GUDALUR BAZAAR POST, NILGIRIS TN- 643212
423 APLOMB ABHILASHA BHAWAN MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA
424 APNA TELE LINK PRIVATE LIMITED SCO 1-12, 4TH FLOOR, PPR MALL, MITHAPUR ROAD JALANDHAR CITY
425 APOLLO ONLINE SERVICES PRIVATE LIMITED H.NO. 12-13-387, STREET NO.1, LANE NO.1 TARNAKA SECUNDERABAD
426 APPAREL AND LEATHER TECHNICS PRIVATE LIMITED KAIKONDRAHALLI, CARMELRAM POST NEAR BELLANDUR GATE, SARJAPUR ROAD, BANGLORE
427 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
428 APPWORX IT SOLUTIONS PRIVATE LIMITED NETSMARTZ HOUSE, PLOT NUMBER 10, RAJEEV GANDHI TECHNOLOGY PARK, CHANDIGARH
429 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
430 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
431 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
432 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
433 AQSA ALPSANKHYAK EDUCATION AND WELFARE SOCIETY AMEEN COLONY, DHAR ROAD PARBHANI
434 ARADHANA EDUCATIONAL AND CHARITABLE TRUST ARADHANA EDUCATIONAL CAMPUS, BHAVNAGR ROAD, BOTAD
435 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
436 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
437 ARAMCO SOLUTIONS PRIVATE LIMITED 1ST FLOOR, PENTAGAN, BEHIND BALDEV PLAZA, RFC LANE, GOLGHAR,GORAKHPUR – 273001 UTTAR PRADESH, INDIA
438 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
439 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
440 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
441 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
442 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
443 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
444 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
445 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
446 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
447 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
448 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
449 ARCENCIEL FOUNDATION H. NO. 85B, KHRIYA POKHARA BASHARATPUR, MEDICAL ROAD GORAKHPUR GORAKHPUR UP 273004 IN
450 ARCEUS INFOTECH PVT LTD 508, 5TH FLOOR, THE SUMMIT BUSINESS BAY (OMKAR), ANDHERI-KURLA ROAD, ANDHERI (EAST), MUMBAI - 400093
451 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
452 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
453 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
454 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR SHREE RAM BHAWAN PICNIC SPOT ROAD KHURAM NAGAR LUCKNOW
455 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
456 ARIHANT PROEDUCATION SOCIETY SCF-11,M.I.E,BAHADURGARH,DISTT.JHAJJAR,HARYANA
457 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
458 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
459 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
460 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
461 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
462 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
463 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
464 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
465 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
466 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
467 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
468 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
469 ARPAN WELFARE SOCIETY Z 2 CHOICE HOUSE NEAR HDFC BANK ZONE 1 MP NAGAR BHOPAL
470 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
471 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
472 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
473 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
474 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
475 ARSH INSTITUTE OF INFORMATION TECHNOLOGY AND RESEARCH LLP NEAR POST OFFICE VPO THUNAG
476 ARSH INSTITUTE OF INFORMATION TECHNOLOGY AND RESEARCH LLP NEAR POST OFFICE MAIN BAZAR THUNAG
477 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
478 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
479 ARTECH INFOSYSTEMS PRIVATE LIMITED INFOSPACE, B-2, TOWER 2, GROUND FLOOR, SECTOR 62, NOIDA
480 ARTECH INFOSYSTEMS PVT LTD GROUND FLOOR B2 TOWER 2 INFOSPACE SECTOR 62
481 ARTECH INFOSYSTEMS PVT LTD GROUND FLOOR B2 TOWER 2 INFOSPACE SECTOR 62
482 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
483 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
484 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
485 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
486 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
487 ARUNACHAL UNIVERSITY OF STUDIES NH-52, NAMSAI DISTRICT NAMSAI
488 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
489 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
490 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
491 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
492 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
493 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
494 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
495 ARUN SURYA SHIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA H.NO 13, GEETANJALI PARK, NEAR MAHARISHI VIDYA MANDIR SCHOOL,MANGLA, BILASPUR (C. G)
496 ARUN SURYA SIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA OM NAGAR, JARHA BHATA , BILASPUR C.G
497 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
498 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
499 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
500 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
501 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
502 ASD EDUCATIONAL CHARITABLE TRUST NO 2/141 GANAPATHY COMPLEX,BAZAAR ROAD,KANCHIPURAM,TAMILNADU
503 ASD EDUCATIONALCHARITABLE TRUST 2/141,BAZAAR ROAD
504 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
505 AS EDUCATION AND WELFARE SOCIETY VPO TIGRANA,DISTT-BHIWANI,HARYANA 127031
506 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
507 ASFSDA ASDF
508 ASHA HO. NO. 11 RADHAPURAM COLONY KANCHANPUR MATIYARI CHINHAT LUCKNOW
509 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
510 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
511 ASHASECURITYGUARDSERVICES L-2/482, VINEET KHAND, GOMTI NAGAR, LUCKNOW
512 ASHA SKILL DEVLOPMENT FOUNDATION WARD NO 28, FIRST FLORE KESAR PLAZA COMPLEX HANUMAN CHAUK BALAGHAT
513 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
514 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION G-24, 3RD FLOOR, VIJAY NAGAR SINGLE STOREY, DELHI
515 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
516 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
517 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
518 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
519 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
520 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
521 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
522 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
523 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
524 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
525 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
526 ASHTA UTKARSH SEVA SANSTHAN SAMITI 445, WARD NO 16, SEMNARI ROAD ASHTA
527 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
528 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
529 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
530 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
531 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
532 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
533 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
534 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
535 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
536 ASIAN INFOTECH EDUCATIONAL DEVELOPMENT SOCIETY ASIAN INFOTECH ZOOROAD TINIALI APURBA SINHA PATH BY LANE-05
537 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
538 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
539 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
540 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
541 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
542 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
543 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
544 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
545 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
546 ASPIRE DISRUPTIVE SKILL FOUNDATION 2ND FLOOR KAILASH -B OPP. DRINE IN CINEMA BESIDE HDFC BANK, DRIVE IN ROAD AHMADABAD -PIN-380054 GUJARAT.
547 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
548 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
549 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
550 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
551 ASSET HOMES PRIVATE LIMITED G-129,28/34A,PANAMPILLY NAGAR, KOCHI - 682036 , KERALA
552 ASSIST G. T. ROAD CHILAKALURIPET GUNTUR DISTRICT ANDHRA PRADESH
553 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
554 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
555 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
556 ASSOCIATION FOR PEOPLES ADVANCEMENT AND ACTION RESEARCH 7/12,RAMA ASHRAM TAKNA ROAD
557 ASSOCIATION FOR PEPOLES ADVANCEMENT AND ACTION RESEARCH C/O DR. M.C. BHATT, 7/12 RAMASHRAM, TAKANA ROAD
558 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
559 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
560 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
561 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
562 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
563 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
564 ASYLUM SECURITY AND INTELLIGENCE PRIVATE LIMITED GRAND CHANDRA APARTMENT, FRASER ROAD, PATNA BIHAR 800001
565 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
566 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
567 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
568 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
569 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
570 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
571 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
572 ATHMA DIVINE TRUST NO 80-A KONDASAMY ROAD RAMNAGAR COIMBATORE
573 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
574 ATMAN FOUNDATION GADHADA AT GADHADA GOPINATH BANLOGE BEHIND VARJ VIHAR SOCIETY GADHADA BOTAD ROAD DIST - BOTAD
575 ATMAN FOUNDATION GADHADA AT GADHADA GOPINATH BANLOGE BEHIND VARJ VIHAR SOCIETY GADHADA BOTAD ROAD DIST - BOTAD
576 ATMIY MANAGEMENT LLP AT GADHADA MOHANNAGAR SOCIETY OPP NEW BUS STATION DIST BOTAD
577 ATMIY MANAGEMENT LLP AT,GADHADA MOHANNAGAR SOCIETY OPP.NEW BUSSTATION DIST.BOTAD TALUKO - GADHADA
578 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
579 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
580 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
581 AURA EDUCATIONAL SOCIETY 60-9-10/4, PINNAMANENI PPLY CLONIC STREET, 7 TH LANE SIDHARTHA NAGAR, VIJAYAWADA
582 AURA EDUCATIONAL SOCIETY NO 60-9-10/4, TEJA BUILDINGS, SIDDHARTHANAGAR, PINNAMANENIPOLYCLINIC ROAD, VIJAYAWADA, KRISHNA DISTRICT
583 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
584 AUTOLITE INDIA LIMITED D 469 ROAD NO 9 A V K I AREA RAJASTHAN JAIPUR
585 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
586 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
587 AVISHKAR CONSTRUCTION COMPANY MAHARANA PRATAP WARD NEAR INGLE SQUARE CIVIL LINE GONDIA
588 AVJ INFOTECH PVT LTD AMIYO NIKETAN NAITY ROAD,BAGAN PARA,2ND FLOOR,P.O-NABAGRAM, PIN: 712246
589 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
590 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
591 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
592 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
593 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
594 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
595 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY
596 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, BEHIND KISAN BAZAR, JHANSI
597 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, JHANSI UP 284001
598 AVTAR WELFARE SOCIETY 538/5-C BANKER COLONY, JHANSI
599 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
600 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
601 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
602 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
603 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
604 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
605 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
606 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
607 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
608 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
609 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOT-ISE-KHAN
610 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN
611 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN DISTT MOGA PUNJAB
612 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
613 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
614 BABA JAKJDAS JHAKJB KNKDCKDN KJBSKBDSKN BSKBDKCB
615 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
616 BABA SAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE , PLOT NO 59/471 , P.S - SECTOR 12. BOKARO (JHARKHAND)
617 BABASAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE 59/471. PO + PS SECTOR 12. BOKARO
618 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
619 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
620 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
621 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
622 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
623 BADRINARAYAN SHIKSHA SAMITI KUNER,PAOTA,JAIPUR(RAJASTHAN)-303106
624 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
625 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
626 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
627 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
628 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
629 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
630 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
631 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
632 BAJRANGBALI SHAIKSHNIK EVAM SAMAJIK SEVA SANSTHAN POSTAL PARK NAVRATAN PUR MANDIR,P.O-GPO.P.S.-KANKARBAGH
633 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
634 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
635 BALAGH EDUCATION AND WELFARE SOCIETY 3RD FLOOR KHALID APARTMENT BADI OMTI JABALPUR M.P.
636 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
637 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
638 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
639 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
640 BALAJ TRUST CO LTD DGHDGGHDGDGGD
641 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
642 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
643 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
644 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
645 BALIRAJA BAHUUDESHIYE SEWABHAWI SANSTHA BEED AT PADMAVATI GALLI PARLI V TQ PARLI V DIST BEED 431122
646 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
647 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
648 BAL MAHILA VIKAS SAMITI 9-C MAHARAN PRATAP NAGAR OLD USHA COLONY LASHKAR GWALIOR
649 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
650 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
651 BAL VIKAS UTTHAN SAMITI I.T EDUCATION (BAL VIKAS UTTHAN SAMITI) NEAR O.B.C BANK AMBEHTA CHAND SAHARANPUR UTTAR PRADESH
652 BAL VIKAS UTTHAN SAMITI I.T EDUCATION (BAL VIKAS UTTHAN SAMITI) NEAR O.B.C BANK AMBEHTA CHAND SAHARANPUR U.P 247451
653 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
654 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
655 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
656 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
657 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
658 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
659 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
660 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
661 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
662 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
663 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
664 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
665 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
666 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
667 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
668 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
669 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
670 BASANTI DASH EDUCATIONAL TRUST HEAD OFFICE, HIG/A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
671 BASANTI DASH EDUCATIONAL TRUST BASANTI DASH EDUCATIONAL TRUST, A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
672 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
673 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
674 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
675 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
676 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
677 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
678 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
679 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
680 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
681 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
682 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
683 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
684 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80, SITE-5, UDYOG KUNJ, PANKI, KANPUR-208022,PH. NO.0512-2212083
685 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
686 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
687 BELA ROZGAR AND HEALTH CONSCIONS COMPANY IST FLOOR, SANT PLAZA, ABOVE CORPORATION BANK SHRIKANT VERMA MARG, NEAR RAMA MAGNETO MALL, BILASPUR, CHHATTISGARH
688 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
689 BENTOGREEN SKILL PRIVATE LIMITED 50L, WEST CHOWBAGA, P.S.-TILJALA, KOLKATA
690 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
691 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
692 BERHAMPORE NETAJI VIVEKANANDA ADARSHA SEVA SAMITY 74/1, ABDUS SAMAD ROAD, GORABAZAR, P.O. BERHAMPORE, DIST. MURSHIDABAD
693 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
694 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
695 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
696 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
697 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM AVINASHI ROAD, TIRUPUR
698 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM, AVINASHI ROAD, TIRUPUR
699 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM, AVINASHI ROAD, TIRUPUR
700 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
701 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
702 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
703 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
704 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
705 BFHJFF BDHD
706 BG SOFTWARE SOLUTIONS 6514A 2ND FLOOR KALYANI COMPLEX BUDIKERE ROAD KANAKAPURA
707 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
708 BHAGIRATHI TRANS CORPO PVT LTD # 2, ESSPEE TOWER, RAJENDRA NAGAR, DATTAPADA ROAD, BORIVALI (EAST)
709 BHAGIRATHI TRANSCORPO PVT LTD UNIT.2 , ESSPEE TOWER , RAJENDRA NAGAR , DATTAPADA ROAD , BORIVALI (E)
710 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
711 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
712 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
713 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
714 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
715 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
716 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
717 BHANSALI TRUST BHANSALI TRUST RADHANPUR HIGHWAY CROSS ROAD NEAR GAYATRI TEMPLE AT PO RADHANPUR
718 BHANSALI TRUST BHANSALI TRUST AND HOSPITAL, HIGHWAY CROSS ROAD, NEAR GAYATRI TEMPLE
719 BHANSALI TRUST BHANSALI TRUST, HIGHWAY CROSS ROAD, TO.RADHANPUR, DIST.PATAN
720 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
721 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
722 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
723 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
724 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
725 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
726 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
727 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
728 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
729 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
730 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
731 BHARATH FOUNDATION 9-10-232/1 FIRST FLOOR ABOVE CANARA BANK CHITTA ROAD
732 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
733 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
734 BHARATHIYA SEVA SAMSTHE NO.363, 7TH MAIN, BHUVANESHWARI NAGAR, T DASARAHALLI, BANGALORE
735 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
736 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
737 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
738 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
739 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
740 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
741 BHARAT SANCHAR NIGAM LIMITED RGMTTC BHARAT SANCHAR NIGAM LTD RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE OPPOSITE TO OLD AIRPORT GST ROAD MINAMBAKKAM CHENNAI
742 BHARAT SANCHAR NIGAM LIMITED RGMTTC BHARAT SANCHAR NIGAM LIMITED RGMTTC OPPOSITE TO OLD AIRPORT GST ROAD MINAMBAKKAM CHENNAI
743 BHARAT SANCHAR NIGAM LIMITED RGMTTC BSNL.RGMTTC,GST ROAD MINAMBAKKAM,OPP. TO OLD AIRPORT, CHENNAI-27
744 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
745 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
746 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
747 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
748 BHARAT VEERANGNA AWANTIBAI EDUCATIONAL SANTHAN D-16 SECTOR-9 VIJAY NAGAR GHAZIABAD
749 BHARAT VIKAS SAMITI CARMEL CHOWK, 7TH MILE, NEAR WADI POLICE STATION, AMRAVATI ROAD, NAGPUR
750 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
751 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
752 BHARTIYA EDUCATIONAL CHARITABLE TRUST 56 SETH KUMHARTOLI DORANDA
753 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
754 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
755 BHARTIYA SAMAJIK BAHUUDESHIYA VIKAS SANSTHA C/O. MANGAL KAWDU TELANG,VIKAS NAGAR, NEAR TAKSHAKISHLIYA BUDDHA VIHAR, BABUPETH CHANDRAPUR.
756 BHARTIYA SAMRUDDHI INVESTMENTS AND CONSULTING SERVICES LIMITED 3RD FLOOR, SURBHI ARCADE, BANK STREET, TROOP BAZAR, KOTI, HYDERABAD
757 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
758 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
759 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
760 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
761 BHAWANI MARKETING PRIVATE LIMITED SHIMA PLAZA,3RD FLOOR,BLOCK D, ULUBARI CHARIALI, GUWAHATI
762 BHELSA JAN KALYAN SAMITI PITAL MILL SQUARE, SAGAR ROAD VIDISHA(M.P.)
763 BHELSA JAN KALYAN SAMITI HOUSE NO-22, CHANDRA SHEKHAR ROAD PITTAL MILL VIDISHA (M.P)
764 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
765 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
766 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
767 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NEW RAIPUR
768 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NAYA RAIPUR
769 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
770 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
771 BHOJPUR GRAMIN VIKAS PARISHAD AT- SINGH COLONY, JAGDEV NAGAR, NEAR BAZAR SAMITI, PO: ARA, PS: ARA NAWADA, DISTT: BHOJPUR (BIHAR)
772 BHOJPUR MAHILA KALA KENDRA BAZARI SAH KA MANDIR ABAR POOL PAR ARA
773 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
774 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
775 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
776 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
777 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
778 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
779 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
780 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
781 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
782 BHUPINDRA SOCIETY REGISTERED OFFICE : SCF-34, DUKHNIWARAN SAHIB GURUDWARA MARKET, PATIALA, PUNJAB- 147001 CORPORATE OFFICE : SCO-19, 2ND FLOOR, SECTOR 26, MADHYA MARG, CHANDIGARH , 160019
783 BHUSHAN RAJIV INFRATECH PVT LTD CHAKLA-HARCHANDA ROAD,NEAR CHAKLA MORH,ORMANJHI,BIRSA MUNDA RESIDENSIAL SCHOOL BUILDING.
784 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
785 BILASPUR FULE STATION VILLAGE-PARSADA DISTRICT-BILASPUR RAIPUR ROAD BILASPUR
786 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
787 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
788 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
789 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
790 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
791 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD M.P. INDIA 451228, DIST KHARGONE, MOB. 8717828884, 9993596700
792 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD DIST. KHARGONE M.P. INDIA MOB. NO. 8717828884
793 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
794 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
795 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
796 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4 MIDC INDUSTRIAL AREA WALUJ DIST AURANGABAD (MAHARASHTRA)
797 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4, M.I.D.C, INDUSTRIAL AREA, WALUJ, AURANGABAD, MAHARASHTRA
798 BISMI EDUCATIONAL TRUST NO1 2ND AND 3RD FLOOR AMUTHA COMPLEX NEW SANKARANPALAYAM ROAD TOLGATE VELLORE
799 BISWAAS BAHARANA.NIALI,CUTTACK
800 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
801 BIYANI SHIKSHAN SAMITI SECTOR. NO 3, VIDHYADHAR NAGAR, JAIPUR, RAJASTHAN
802 BIYANI SHIKSHAN SAMITI BIYANI SHIKSHAN SAMITI, R-4, SECTOR 3, VIDYADHAR NAGAR, JAIPUR
803 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
804 BLACKSMITH PROJECTS PRIVATE LIMITED JAGAT COMPLEX,PLOT NO. 354, 100 FEET ROAD, GHITORNI, NEW DELHI 110030
805 BLESSING AND HOPE MISSION HARINARAYANPUR, VIDYASAGARPALLY, SRIDHAR GHOSH ROAD, BURDWAN WEST BENGAL-713101
806 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
807 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
808 BLUEBLOOD VENTURES LIMITED ROOM NO. 101, P-27, MALVIYA NAGAR, NEW DELHI
809 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED #18, SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR, BANGALORE 560043
810 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED NO.18 SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR BANGALORE - 560043
811 BLUE COAST HOTELS LIMITED 263 C AROSSIM,CANSAULIM,GOA
812 BLUE COAST HOTELS LIMITED 263C AROSSIM,CANSAULIM,GOA
813 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
814 BLUORCHID INTERNATIONAL SERVICES PRIVATE LIMITED U-131,F/F UPADHAYAY BLOCK SHAKARPUR, NEAR LAXMI NAGAR METRO STATION.DELHI
815 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
816 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
817 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
818 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
819 BORAL NUTANHAT YOUTH COMPUTER TRAINING CENTRE C/6 RAJNARAYAN PARK,RANGKAL MORE, BORAL MAIN ROAD , P.O. BORAL,P.S. SONARPUR ,PIN -700154 REGISTERED OFFICE 58/3 MADHYAPARA , ROYNAGAR, P.O.& P.S. BANSDRONI,KOLKATA-700070
820 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA-403601
821 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA 403601
822 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR ASHRAM SOUTH DELHI
823 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR, ASHRAM SOUTH DELHI
824 BPS SHIKSHAN SANSTHAN ION DIGITAL ZONE,BHARTIYA INSTITUTE OF ENGG. &TECH.JAIPUR-BIKANER BYPASS,NEAR SANWALI CIRCLE. POST OFFICE-BAJAJ GRAM.TEH.&DISTT.-SIKAR(RAJASTHAN)-332001
825 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
826 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR
827 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
828 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
829 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
830 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED D-17,THACKER INDUSTRIAL ESTATE,N.M JOSHI MARG,CHINCHPOKALI MUMBAI - 400011
831 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
832 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
833 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
834 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
835 BRIGHT FUTURE ACADEMY SHYAM JI MARG ,KETKA ROAD SURAJPUR(CG)
836 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
837 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
838 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
839 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
840 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
841 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
842 BRIGHT STAR MUSLIM ASSOCIATION 42, INDIRA NAGAR, B.N.P. ROAD, DEWAS
843 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
844 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
845 BRIJ KISHORE JAGRITI SEWA SAMITI VILL AND POST BARGAWAN, TEHSIL MISHRIKH DISTRICT SITAPUR, UTTAR PRADESH
846 BRIJ KISHOR JAGRITI SEWA SAMITI VILL&PO.BARGAWAN DIST.SITAPUR PIN CODE.261151 BLOCK .PISAWAN TAHSIL.MAHOLI
847 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
848 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
849 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED NO 19 CHITALAPAKKAM MAIN ROAD,2ND FLOOR, NEHRU NAGAR ,CHROMPET, CHENNAI
850 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED 2ND FLOOR, NO 19, CHITALAPAKKAM MAIN ROAD,NEHRU NAGAR, CHITALAPAKKAM , CHROMPET
851 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED NO 19, CHITALAPAKKAM MAIN ROAD,2ND FLOOR, NEHRU NAGAR, CHROMPET,CHENNAI
852 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
853 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
854 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
855 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
856 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
857 B R KHOKHAR MEMORIAL SHIKSHAN SANSTHAN KUCHAMAN CITY KHATIYON KA MOHALLA , PADAMPURA ROAD,KUCHAMAN CITY
858 BROADLINE COMPUTER SYSTEMS NO. 7, 2ND FLOOR, KHADER NAWAZ KHAN ROAD, NUNGAMBAKKAM CHENNAI
859 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
860 BROTHERS OF ST GABRIEL EDUCATIONAL SOCIETY C/O DIRECTOR MONTFORT PLOT 256 TAKLI BHANSALI SAVNER ROAD PATANSAVANGI NAGPUR MAHARASHTRA
861 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
862 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
863 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
864 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
865 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
866 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
867 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
868 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
869 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
870 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
871 BUILDYOURSELF SEWA SANSTHA 546/718 SARFARAJGANJ LUCKNOW
872 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
873 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
874 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
875 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
876 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
877 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
878 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
879 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
880 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
881 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
882 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
883 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
884 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
885 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
886 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
887 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
888 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
889 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
890 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
891 CALLHEALTH SERVICES PRIVATE LIMITED 1-66/1/RI/08/8, 10TH & 11TH FLOOR, RAMKY GRANDIOSE, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD - 500032, TELANGANA
892 CAMBRIDGE PUBLIC EDUCATIONAL AND WELFARE TRUST VILL SAIDPUR PO SORMAR BAGHALA PS MORO DISTT DARBHANGA
893 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA; DISTRICT CENTRE, JASOLA, NEW DELHI-110025
894 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA DISTRICT CENTRE, JASOLA, NEW DELHI-110025
895 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
896 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
897 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
898 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
899 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
900 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
901 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
902 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
903 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
904 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
905 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY VINOD KUMAR SACHDEV ,SANJAY NAGAR KURUD, WARD 14, MAIN ROAD KURUD , DIST. DHAMTARI, CHHATISGARH 493663
906 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
907 CAREER DEVELOPMENT OPPORTUNITY AND TRAINING C DOT NO 7 ,ST MARYS BUILDING ,R.S.L GOLDEN APARTMENT ROAD (NEAR SELVARAJ TEXTILES) VILLANGUDI,MADURAI
908 CAREER EDUCATION AND TECHNICAL SOCIETY OPP. ITI,RANIA ROAD,SIRSA-125055,HARYANA
909 CAREER EDUCOM ACADEMY 70, JALVIAHAR COLONY, RAIPUR
910 CAREER EDUCOM ACADEMY 70, JALVIHAR COLONY, RAIPUR, CG, 492001
911 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
912 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
913 CAREER PLUS EDUCATIONAL SOCIETY H.O301/A37, 38, 39 IIIRD FLOOR ANSAL BUILDING, COMM.COMPLEX DR. MUKHERJEE NAGAR DELHI 110009 REGD.OFFF3/ 8 SEC11 ROHINI DELHI110085
914 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
915 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
916 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
917 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR CHHATTISGARH
918 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
919 CARE PRO BIOSCIENCE PRIVATE LIMITED I - 059 , SITE 5, KASNA IND AREA GAUTAM BUDDH NAGAR GREATER NOIDA UP
920 CARE PRO BIOSCIENCE PRIVATE LIMITED I - 059 , SITE 5, KASNA IND AREA GAUTAM BUDDH NAGAR GREATER NOIDA UP
921 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
922 CARE WORLD BAGHI MEHTAB NEAR BYPASS BRIDGE
923 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
924 CASA GRANDE PROP CARE PRIVATE LIMITED 40/129A, SHIVANI TOWERS, 2ND FLOOR, ECR, THIRUVANMIYUR, CHENNAI
925 CASA GRANDE PROP CARE PVT LTD NO 40/129A, SHIVANI TOWERS, 2ND FLOOR,ECR, THIRUVANMIYUR, CHENNAI
926 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
927 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
928 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
929 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
930 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
931 CDHU EEHDG
932 CDROME EDUCATION SOCIETY 101, PANSI HOUSE, NEAR PRAYAG SOCIETY BUILDING NO-4, LOK DHARA PHASE - 1, KALYAN (EAST)
933 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMADI HOUSE, MOHAMADALI ROAD, P.O. BOX, 13097, MASJID BUNDER (WEST), MUMBAI
934 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMMEDI HOUSE MOHAMMED ALI ROAD MOHARASHTRA MUMBAI
935 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
936 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
937 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
938 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
939 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
940 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
941 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
942 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
943 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
944 CENTER FOR COMMUNITY SOLIDARITY NO 27 AMIRTHAPURAM TIRUTTANI BRANCH CODE 1140
945 CENTER FOR COMMUNITY SOLIDARITY TRUST NO 27 BAZAAR STREET AMIRTHAPURAM TIRUTTANI
946 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
947 CENTER FOR RURAL DEVELOPMENT 1/2 SOUTH GARDEN, THUMAMKURCHI, NALLIPALYAM, NAMAKKAL
948 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD. OFFICE-VILL:HAIDADPUR(NEAR BISWASREE CLUB),P.O.:KHANTURA,P.S.:HABRA,GOBARDANGA,DIST:24PGS(N),PIN:743273 H.O.-GOBARDANGA,MUNICIPALITY SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO. 3 , 4 & 5
949 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD.OFFICE - VILL:HAIDADPUR, P.O:KHANTURA, P.S.:HABRA,DIST:NORTH 24 PARGANAS,PIN:743273 H.O.:MUNICIPAL SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO:3,4 & 5 , P.O:GOBARDANGA
950 CENTRAL EDUCATIONAL AND CHARITABLE TRUST CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI, THALAKKULATHUR POST KOZHIKODE
951 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR
952 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR KOZHIKODE
953 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
954 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
955 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
956 CENTRAL FOOTWEAR TRAINING INSTITUTE CFTI AGRA C-41 & 42, SITE-C, INDUSTRIAL AREA, SIKANDRA, AGRA
957 CENTRAL INSTITUTE OF DESIGN CENTRAL INSTITUTE OF TOOL DESIGN (A GOVERNMENT OF INDIA SOCIETY MINISTRY OF MSME) BALANAGAR, HYDERABAD
958 CENTRAL INSTITUTE OF TOOL DESIGN CENTRAL INSTITUTE OF TOOL DESIGN, NARASPUR CROSS ROADS, BALANAGAR, HYDERABAD
959 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
960 CENTRAL PEST CONTROL 25, SAIKRUPA, CENTRAL EXCISE COLONY, CHHATRAPATI SQUARE, NAGPUR
961 CENTRAL TOOL ROOM AND TRAINING CENTRE KOLKATA CENTRAL TOOL ROOM AND TRAINING CENTRE (CTTC) BONHOOGHLY INDUSTRIAL AREA KOLKATA-700108, WEST BENGAL
962 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
963 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
964 CENTRE FOR COMMUNITY SERVICE AND ALTRUISM NO.14,NEW STREET MANALIESTATE, PUDUPALAYAM MAIN ROAD, CUDDALORE.
965 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
966 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
967 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
968 CENTRE FOR MENTAL HYGIENE CHANGANGEI UCHEKON AIRPORT ROAD IMPHAL MANIPUR
969 CENTRE FOR MENTAL HYGIENE CHANGANGEI UCHEKON AIRPORT ROAD
970 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
971 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
972 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A1/1, INDUSTRIAL AREA, P.O-MUIDDINPUR JALESHER ROAD FIROZABAD
973 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1,INDUSTRIAL AREA, P.O:MUIDDINPUR,JALESHER ROAD FIROZABAD
974 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1 INDUSTRIAL AREA P.O - MUIDDINPUR JALESHAR ROAD FIROZABAD
975 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
976 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A
977 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH SAS NAGAR PUNJAB YUVA BHAWAN SECTOR 42A
978 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
979 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
980 CENTRE OF EDUCATION AND DISTANCE LEARNING SAHARA HOSPITAL BASEMENT, NEAR OBC BANK PATAUDI CHOWK, BASAI ROAD,GURUGRAM
981 CENTUM FOUNDATION 127, NEELAGAGAN, MANDI ROAD, SULTANPUR, MEHRAULI, NEW DELHI – 110030
982 CENTURION SCHOOL OF RURAL ENTERPRISE MANAGEMENT TRUST HIG 5 BDA DUPLEX PHASE 1 POKHARIPUT BHUBANESHWAR
983 CENTURION SCHOOL OF RURAL MANAGEMENT TRUST HIG 5 BDA DUPLEX PHASE 1 POKHARIPUT BHUBANESHWAR
984 CHAITANYA BHARAT SOCIAL PROMOTIONAL SOCIETY 142 A,POCKET B ,MAYUR VIHAR PHASE II NEW DELHI
985 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
986 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
987 CHANAKYA ACADEMY RING ROAD NO 1, NEAR SARONA BRIDGE, TATIBUND, RAIPUR CG
988 CHANAKYA FOUNDATION E.D-1/740,L.D.A COLONY,KANPUR ROAD,LUCKNOW
989 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
990 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
991 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
992 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
993 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
994 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
995 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
996 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
997 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
998 CHAPRA ARPITA COMPUTER ACADEMY CHAPRA RANABAND ROAD, CHRISTIAN PARA, P.O. BANGALJHI, DIST. NADIA, WEST BENGAL PIN 741123
999 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
1000 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
1001 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
1002 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
1003 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
1004 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
1005 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
1006 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
1007 CHATRAPATI SHIVAJI SEVABHAVI SANSTHA PATANGE COMPLEX NEAR MALLIKARJUN MANDIR RING ROAD MANWAT
1008 CHATRAPATI SHIVAJI SEVABHAVI SANSTHA CHATRAPATI SHIVAJI SEVABHAVI SANSTHA PATANGE COMPLEX NEAR MALLIKARJUN TAMPAL RING ROAD MANWAT MAHARASHTRA-431505 MAHARASHTRA TEL. NO.:9860788141
1009 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
1010 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
1011 CH CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1N-3 MIA, ALWAR
1012 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
1013 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
1014 CHERRYPICK INDIA CONSULTING AND BUISINESS SOLUTIONS PRIVATE LTD 2ND FLOOR, CARMEL TOWER, COTTON HILL, VAZHUTHACAUD
1015 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY DARGA ROAD BIJAPUR
1016 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY, DARGA ROAD BIJAPUR
1017 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY DARGA ROAD BIJAPUR
1018 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY, VIJETA NAGAR, NEXT TO RNS MOTORS,SHOLAPUR ROAD, VIJAYAPUR-586103
1019 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
1020 CHETNA ALLAHABAD ROAD KARWI
1021 CHETNA ALLAHABAD ROAD, KARWI
1022 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
1023 CHHATTISGARH TECHNOLOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FORNT OF GOVERNMENT HOSPITAL MAIN ROAD DONDILOHARA
1024 CHHATTISGRAH TECHNALOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FRONT OF GOVERNMENT HOSPITAL MANI ROAD DONDILOHRA
1025 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTISGARH CHANDRANAHU SIKHAN SAMITI ,NEAR BY SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
1026 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI BAGBAHARA ROAD SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
1027 CHHAYA EDUCATIONAL TRUST 2/144/2,RAWLI, AGRA , UTTAR PRADESH
1028 CHHAYA EDUCATIONAL TRUST 2/144/2, RAWLI, AGRA, UTTAR PRADESH
1029 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
1030 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
1031 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
1032 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
1033 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
1034 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
1035 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
1036 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
1037 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
1038 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
1039 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
1040 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
1041 CHILD CARE SOCIETY BEHIND SHIV MANDIR, NAGINA SINGH COLONY, GUDARI, CHAPRA
1042 CHILD CARE SOCIETY BEHIND SHIV MANDIR, NAGINA SINGH COLONY, GUDARI, CHAPRA
1043 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
1044 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
1045 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
1046 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
1047 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
1048 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
1049 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
1050 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
1051 CHORD CHILDWELFARE HOLISTIC ORGANIZATION FOR RURAL DEVELOPMENT PLOT.NO: 496, FLAT.NO: 106, NAGASURI ENCLAVE, GOKUL PLOTS, OPP. BLOOMING DALES SCHOOL, NEAR KPHB 9TH PHASE, KUKATPALLY, HYDERABAD, INDIA – 500072
1052 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
1053 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
1054 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
1055 CHOUDHARY CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1 N-3, M.I.A, ALWAR
1056 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
1057 CHOUHAN HOUSING PRIVATE LIMITED CHOUHAN RESIDENCY, RAJEEV NAGAR, MUKTIDHAM ROAD, AZAD CHOWK, SUPELA, BHILAI-490023, CHHATTISGARH
1058 CHOUHAN INFRA 301,SAHYADRI TOWER,18/A,SAPTGIRI NAGAR,NARENDRA NAGAR
1059 CH RAJPAL SINGH MEMORIAL SANSTHA 400/3, SHASTRI NAGAR, MEERUT
1060 CHRIST EDUCATION AND WELFARE SOCIETY 101, GORE BUILDING, SAHAJANAND CHOWK, BEHIND RAYMOND SHOP, NEAR ZOJOWALA COMPLEX, SANTOSHI MATHA ROAD, KALYAN WEST
1061 CHRIST EDUCATION AND WELFARE SOCIETY 606,A WING, 6TH FLOOR, VERTEX VIKAS BUILDING,NEAR ANDHERI METRO STATION, ANDHERI EAST, MUMBAI , MAHARASHTRA
1062 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
1063 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
1064 CITIZEN CARE INDUSTRIES PRIVATE LIMITED PRAKASH PALACE BASEMENT ,RAJEEV COLONY , NEAR FOOT OVER BRIDGE, N.H .- 8 GURGAON- 122004, HARYANA , INDIA
1065 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
1066 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
1067 CITY MAKERS PRIVATE LIMITED CITY MAKERS PVT.LTD G-1,VASUDEO CITY,OPP-RAJHANSH GUEST HOUSE, BENIBABU BAGICHA, RAJENDRA PATH,PATNA.
1068 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
1069 CKAKPARAN KANTAKHALI CHOKHER AALO WELFARE SOCIETY VILL : MOHANPUR, PO : SOUTH MOHANPUR, PS : MAGRAHAT, SUB-DIST : MAGRAHAT - II, DIST : SOUTH 24 PARGANAS, STATE : WEST BENGAL, PIN : 743610
1070 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
1071 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
1072 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
1073 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
1074 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
1075 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
1076 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
1077 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
1078 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
1079 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 306, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1080 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 306, 3RD FLOOR INTERNATIONAL TRADE TOWER, NEHRU PLACE
1081 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1082 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1083 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1084 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
1085 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
1086 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
1087 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
1088 COLLEGE TULLU ROAD KANISI DISTRICT GANJAM BEHRAMPUR OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT GANJAM BEHRAMPUR, 761008
1089 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY, BEHIND PT. RAVI SHANKAR UNIVERSITY, DUMAR TALAB, MOHBA BAZAR, RAIPUR
1090 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY BEHIND PT. R. S. UNIVERSITY CAMPUS, DUMAR TALAB (MAHOBA BAZAR), RAIPUR (C.G.)
1091 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
1092 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
1093 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
1094 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
1095 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
1096 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
1097 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
1098 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
1099 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
1100 COMMUNITY HEALTH EDUCATION SOCIETY NO. 21 5TH CROSS STREET, UNITED INDIA COLONY, KODAMBAKKAM
1101 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
1102 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK.
1103 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK
1104 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
1105 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
1106 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
1107 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD KUNDA HOUSE,MG ROAD, AURANGABAD, BIHAR
1108 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD 2ND FLOOR, KUNDA HOUSE, MG ROAD, AURANGABAD
1109 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
1110 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
1111 COMPUTER EDUCATION SOCIETY BELOW OF UNION BANK, NEAR SHAKTI CHOWK, BIJNOR (UP)
1112 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
1113 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1114 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1115 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1116 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1117 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1118 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
1119 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1120 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1121 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1122 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1123 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
1124 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
1125 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1126 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1127 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
1128 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
1129 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
1130 COODU TRUST H.83.R M.COLONY DINDIGUL
1131 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
1132 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
1133 COREMAGE ACADEMY 518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD JAMNAGAR
1134 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
1135 COREMAGE INFOTECH 518 INDRAPRASTH COMPLEX PANCHESHWAR TOWER ROAD JAMNAGAR
1136 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
1137 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
1138 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
1139 COUNCIL FOR SKILL UTILITY TRAINING ASSOCIATION 5FT FLOOR O2 BUSSINESS CENTER, RING ROAD NO 2, NEAR RELIANCE PETROL PUMP,GONDWARA, RAIPUR C.G.
1140 COUNCIL FOR SKILL UTILITY TRANING ASSOCIATION 5 TH FLOOR, O2 BUSINESS CENTER, GONDWARA,RING ROAD NO.-2, RAIPUR, C.G.
1141 COUNCIL OF EDUCATION AND SKILL DEVELOPMENT TRUST GALI NO. 12, AASHARAM ROAD, RAO TULA RAM VIHAR, RAMPURA, REWARI
1142 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
1143 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
1144 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
1145 CR DADHICH MEMORIAL SOCIETY BHATTU ROAD, NEAR PUNJABI SABHA HOSPITAL, FATEHABAD
1146 CR DADHICH MEMORIAL SOCIETY BHATTU ROAD, NEAR PUNJABI SABHA HOSPITAL, FATEHABAD
1147 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
1148 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
1149 CREATIVE FOUNDATION SHILLONGPATTY,SILCHAR,CACHAR,ASSAM
1150 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
1151 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
1152 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
1153 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
1154 CRYSTAL NETWORK SOLUTIONS B-30 , KAPIL VASTU COLONY JHALAWAR , RAJASTHAN
1155 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
1156 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
1157 CSI COMPUTECH INDIA PRIVATE LIMITED INNAVIMUMBAI (HO)CSI COMPUTECH (I) PVT. LTD.106, BUILDING 3, SECTOR 3,MILLENNIUM BUSINESS PARK, MAHAPENAVI MUMBAI-400701
1158 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
1159 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
1160 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1161 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1162 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1163 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1164 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
1165 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
1166 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
1167 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
1168 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
1169 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
1170 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
1171 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
1172 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
1173 CYBOTECH EDUSERVE PVT LTD GOLA ROAD, NEAR IMAMBARA, NAWADA, BIHAR
1174 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
1175 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
1176 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
1177 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
1178 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
1179 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
1180 DAKSH INFOSOFT PRIVATE LIMITED G-2, GS APARTMENT, NR. SUNSHINE HONDA, HAWA SADAK, CIVIL LINES, JAIPUR
1181 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
1182 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1183 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1184 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1185 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1186 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
1187 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
1188 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
1189 DALITSANGH H.NO-13 LATA MARG MITRA KUNJ SOHAGPUR DISTT- HOSHANGABAD (MADHYAPRADESH)
1190 DALIT SANGH HOUSE NO. 13 MITRA KUNJ LATA MARG SOHAGPUR DIST. HOSHANGABAD MP
1191 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
1192 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
1193 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
1194 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
1195 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
1196 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
1197 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1198 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
1199 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1200 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1201 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
1202 DARYAV ELECTRICAL AND H C E COMAPNY DARYAV MANJIL PHASE 3 INDRAPURI COLOY TIKAMGARH
1203 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
1204 DASHRATH MANJHI EDUCATIONAL CHARITABLE TRUST H/O : PRAKASH SINGH VILL : MIRZAPUR PO+PS : RISHYAP
1205 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
1206 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
1207 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
1208 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
1209 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
1210 DC SHIKSHAN SANSTHAN SIKAR
1211 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1212 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1213 DDUGKY MORD C TEST ALJBSDFLQJHF
1214 DDUGKY MORD C TEST1 LJHWDF
1215 DDUGKY MORD INC TEST2 NEW DELHI
1216 DDUGKY TEST25 AJSGFQJL
1217 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
1218 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
1219 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1220 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
1221 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1222 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1223 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
1224 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
1225 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
1226 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
1227 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
1228 DEEPAK GUPTA EDUCATION TRUST M-78 CONNAUGHT PLACE OPP FIRE STATION NEW DELHI
1229 DEEPAK GUPTA EDUCATION TRUST M 78 CONNAUGHT PLACE NEW DELHI
1230 DEEPAK WOMENS DEVELOPMENT SOCIETY ADDRESS OFFICE 1 ; GHOU MANHASAN JAMMU ADDRESS OFFICE 2 ; LANE NO.1 HUZURI BAGH ROAD TALLAB TILLO JAMMU
1231 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
1232 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
1233 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
1234 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1235 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
1236 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1237 DEEPSHIKHA MAHILA BAL UTTHAN SAMITI C/O KIRAN ITI COLLEGE,KIRAN NURSING HOME CAMPUS, HATWARA ROAD, 4 NO. DISPENSARY, SODALA, JAIPUR
1238 DEEP SMARAK SHIKSHAN SEVA SANSTHAN VILL HARPUR, PO BAGALI PIJARA
1239 DEEP SMARAK SHIKSHAN SEVA SANSTHAN YANTRA PRIVATE INDUSTRIAL TRAINING INSTITUTE, VILL HARPUR, PO BAGALI PIJARA
1240 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
1241 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
1242 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
1243 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
1244 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
1245 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1246 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1247 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
1248 DEMO ADDRESS LINE 1
1249 DEMO TEST CASE LINE ADDRESS 1233
1250 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
1251 DESTITUTE WELFARE TRUST I-228, PREM NAGAR –II, MAIN 40 FEET ROAD, KIRARI NORTH WEST DELHI 110086
1252 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
1253 DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY MAHAKAUSHAL NAGAR, BEHIND – SARASWATI H. S. SCHOOL, ADHARTAL, JABALPUR, MADHYA PRADESH, INDIA. PIN- 482 004
1254 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
1255 DEVELOPMENT INITIATIVE DEVELOPMENT INITIATIVE, SRIRAMCHANDRAPUR, P.O.-SAKHIGOPAL, PURI, ODISHA
1256 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
1257 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
1258 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI WARD NUMBER 12 INDERGARG DATIA
1259 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI INDERGARH SEVDA DATIA(M.P.)
1260 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI, WARD NO. 12 INDERGARH
1261 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
1262 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
1263 DFHDFHFH KJDVNMDV,M DV
1264 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
1265 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
1266 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1267 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1268 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1269 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1270 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1271 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1272 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
1273 DHANVI CHARITABLE AND EDUCATIONAL TRUST SHOP NO 39 ADITYA COMPLEX NEAR KASAK CIRCLE BHARUCH
1274 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
1275 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
1276 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
1277 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1278 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1279 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1280 DHAYA EDUCATION AND CHARITY FOUNDATION NEWBUSSTAND BUILDING SANTHANAPURAM FIRST STREET PUDUKKOTTAI
1281 DHAYA EDUCATION AND CHARITY FOUNDATION NEW BUS STAND BUILDING OXFORD CATERING COLLEGE CAMPUS SANTHANATHAPURAM STREET PUDUKKOTTAI-01 TAMILNADU
1282 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
1283 DHRUV GLOBALS LIMITED 14,MILESTONE,MATHURA ROAD ,FARIDABAD
1284 DHYANA HITHA EDUCATIONAL SOCIETY ELURU SHABAD VILLAGE AND MANDAL, RANGAREDDY DIST, TELANGANA STATE
1285 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
1286 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
1287 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
1288 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
1289 DIGITAL LYNC TECHNOLOGIES PVT LTD PLOT NO. 627, SURVEY NO. 40,KHAJAGUDA, NAGA HILLS RD, MADHURA NAGAR COLONY, GACHIBOWLI,HYDERABAD, TELANGANA
1290 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
1291 DIGITAL SHIKSHA AND ROJGAR VIKAS SANSTHAN VPO BAGRI TH PEEPLU DISTRICT TONK RAJASTHAN
1292 DIGITAL SKILL EDUCATION WELFARE SOCIETY WARD NO. 08 PLOT NO. 0153/1481/1413 PRABHAT SKILL TRAINING & COMPUTER SANSTHAN NH. 24 PILIBHIT ROAD RITHORA
1293 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK RAMPUR
1294 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR MILAK RAMPUR UP
1295 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK DISTT RAMPUR UP
1296 DIKSHA SAMAJ SEWA SOCITY MOH NAI BASTI ASDULLAPUR MILAK RAMPUR
1297 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
1298 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
1299 DIN DAYAL EDUCATION AND WELFARE TRUST D-4, KEASARBHAVANI SOCIETY, NR.MAHARANA PRATAP NAGAR, GODADARA, SURAT
1300 DIN DAYAL EDUCATION AND WELFARE TRUST D-4 ,KESHARBHAVANI SOCIETY , GODADARA NAHER,GODADARA,SURAT
1301 DISHA DISHA LANE, HISAR ROAD, SIRSA
1302 DISHA DISHA SIRSA DISHA LANE, HISAR ROAD, SIRSA- 125055
1303 DISHA DISHA SIRSA ,DISHA LEN, FRINDES COLONY,BIHAIND PREETAM PALECE ,SIRSA PIN NO. 125055
1304 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
1305 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
1306 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
1307 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
1308 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
1309 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
1310 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
1311 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
1312 DISHA SHIKSHAN AVAM KALYAN SAMITI BRILINT COMPUTER TRILOKI NAGAR NEAR RAILWAY STATION CHHINDWARA
1313 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
1314 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
1315 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
1316 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
1317 DIVINE COLLEGE OF COMPUTER LEARNING HOUSE NO 786 ALAPUR ,MAIN MARKET ALAPUR KUNDA PRATAPGARH 229408
1318 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
1319 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
1320 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
1321 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1322 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1323 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
1324 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
1325 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
1326 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
1327 DIVYSAGAR SOCIETY 108, SR. MIG,NEAR ALLAHABAD BANK, KOTRASULTANABAD,
1328 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
1329 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
1330 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
1331 D K NAGARATHI EDUCATIONAL TRUST NO:103, RADHA AVENUE, SRI DEVI GARDEN, VALASARAVAKKAM, CHENNAI-87.
1332 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
1333 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
1334 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
1335 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
1336 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1337 DMW CNC CENTRE 89 A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1338 DNYANDEEP RASHTRIY SAMAJIK AND SHAIKSHNIK VIKAS SANSTHA A/P- OND, TAL-KARAD, DIST-SATARA, MAHARASHTRA
1339 DNYANDEEP RASHTRIY SAMAJIK VA SHAIKSHNIK VIKAS SANSTHA AT/POST-OND, TAL-KARAD, DIST-SATARA.
1340 DNYANESHWARI SHIKSHAN PRASARAK MANDAL C/O,SUNIL TAMBARE NIVAS,SHAHU NAGAR,BEED
1341 DNYANESHWARI SHIKSHAN PRASARAK MANDAL SUNIL TAMBARE NIVAS, SHAHU NAGAR,BEED.
1342 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
1343 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
1344 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
1345 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
1346 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
1347 DOOR DRISHTI 365 BANK COLONY DEVIL VILLAGE
1348 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
1349 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
1350 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED DQ ENTERTAINMENT (INTERNATIONAL) PRIVATE LIMITED 644, AURORA COLONY, ROAD NO. 3,, BANJARA HILLS, HYDERABAD - 500034, ANDHRA PRADESH, INDIA
1351 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED DQ ENTERTAINMENT (INTERNATIONAL) LIMITED 644, AURORA COLONY. ROAD NO. 3., BANJARA HILLS, HYDERABAD - 500034.
1352 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED 644, AURORA COLONY ROAD NO 3 BANJARA HILLS HYDERABAD
1353 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
1354 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
1355 DR AMBEDKAR MEMORIAL SOCIAL WELFARE AND EDUCATIONAL TRUST AT/PO-JAGDA, ROURKELA, PS-JHIRPANI, DIST-SUNDARGARH
1356 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
1357 DR A SANKARA SUBRAMANIAN GRG PLYTECHNIC COLLEGE KUPPEPALAYAM S.S KULAM (PO) COIMBATORE
1358 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
1359 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
1360 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
1361 DRAUN SHIKSHA SAMITI CHOLL ROAD MANDLESHWAR DIST. KHARGONE (MP)
1362 DRAUN SHIKSHA SAMITI CHOLI ROAD MANDLESHWAR DIST KHARGONE (MP)
1363 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1364 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1365 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
1366 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
1367 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1368 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1369 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
1370 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
1371 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
1372 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
1373 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
1374 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
1375 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1376 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1377 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
1378 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1379 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1380 DRISTI WELFARE FOUNDATION BASANT VIHAR MADIYAON LUCKNOW
1381 DR KALAM EDUCATIONAL FOUNDATION GANDHI CHOWK, GHORASAHAN
1382 DR KALAM EDUCATIONAL FOUNDATION GANDHI CHOWK, GHORASAHAN
1383 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1384 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
1385 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1386 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
1387 DR K R DOSHI TRUST K.R.DOSHI SANKUL, OPP. T.V.KENDRA, GHOGHA CIRCLE, BHAVNAGAR.
1388 DR MOREPEN LIMITED 220 ANTRIKSH BHAWAN ,22 K.G. MARG BARAKHAMBA ROAD NEW DELHI
1389 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
1390 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
1391 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
1392 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
1393 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
1394 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
1395 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
1396 DR VIRENDRA SWARUP EDUCATIONAL FOUNDATION 15/96,CIVIL LINES,KANPUR,UTTAR PRADESH
1397 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
1398 DSHNFJGFD FDHGF FDSGHFDJ GH F
1399 DUM DUM PARK UNNAYANI SAMANNAY 172, LAKE TOWN, BLOCK-A, FLAT NO. 2, KOLKATA
1400 DUPATI SRI EDUCATIONAL SOCIETY H NO 87-1345-10-1, ENGINEERS COLONY,KURNOOL,AP
1401 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
1402 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1403 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1404 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1405 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1406 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
1407 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA, P.O- PANAGARH BAZER, DIST- BURDWAN
1408 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
1409 DURGAPUR SOCIAL AND EDUCATIONAL TRUST MSAV-32, URVASHI (BENGAL AMBUJA), CITY CENTRE, DURGAPUR, DIST- PASCHIM BARDHAMAN, WEST BENGAL, PIN: 713216
1410 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
1411 DURG EDUCATION AND CHARITABLE SOCIETY DURG EDUCATION & CHARITABLE SOCIETY C/O CHHATTISGARH ENGINEERING COLLEGE BORSI-DHANORA ROAD, DHANORA, DURG
1412 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
1413 DURJAN SAL EDUCATIONAL TRUST RAM SINGH COLLEGE OF ENGG.AND TECHNOLOGY,NAGLA SIKANDAR TUNDLA-ETAH ROAD,FIROZABAD
1414 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
1415 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
1416 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
1417 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
1418 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
1419 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
1420 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
1421 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
1422 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
1423 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1424 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1425 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
1426 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
1427 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
1428 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
1429 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
1430 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
1431 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
1432 ECARTES TECHNOLOGY PVT LTD 4805/24,BHARAT RAM ROAD,DARYAGANJ
1433 ECARTES TECHNOLOGY PVT LTD 4805/24,BHARAT RAM ROAD,DARYAGANJ,NEW DELHI
1434 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
1435 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
1436 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
1437 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
1438 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
1439 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
1440 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
1441 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
1442 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
1443 EDS GADEPAN KOTA
1444 EDUCATIONAL RESEARCH AND HUMAN DEVELOPMENT COMMITTEE TRUST 1/33A,MAIN STREET, ENATHI , KIDATHIRUKKAI(POST)
1445 EDUCATIONAL SYSTEM AND WELFARE SOCIETY 61 CIVIL LINES NEAR ISLAMIYA GIRLS INTER COLLEGE BAREILLY 243001
1446 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
1447 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
1448 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
1449 EDUFUN FOUNDATION TRUST BEHIND MADHUSUDAN PLAZA, NAVGRAH SOCIETY, DHANERA
1450 EDU INSTITUTE ADDRESS
1451 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
1452 EDUSOL EDUCATIONAL AND WELFARE SOCIETY PLOT NO. 740, SECTOR - 82, JLPL INDUSTRIAL PARK, MOHALI
1453 EDUSPARK INTERNATIONAL PRIVATE LIMITED MOTILAL NAGAR-1 SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104, MAHARASHTRA, INDIA
1454 EDUSPARK INTERNATIONAL PRIVATE LINITED MOTILAL NAGAR-1, SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104
1455 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
1456 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
1457 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
1458 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
1459 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
1460 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
1461 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
1462 EKLAVYA DEVELOPMENT SOCIETY VILLAGE POST-KANTOLI TEHSIL- MALPURA DISTRICT-TONK RAJASTHAN 304502
1463 EK ONKAR CHARIATABEL TRUST NIRMAL KUTEYA, VILLAGE SEEECHEWAL, POST OFFICE RUPEWAL, TEHSIL SHAHKOT, DISTT. JALANDHAR, PUNJAB
1464 EK ONKAR CHARIATABEL TRUST VILLAGE SEECHEWAL, POST OFFICE RUPEWAL, TEHSIL SHAHKOT, DISTT. JALANDHAR
1465 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
1466 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
1467 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
1468 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
1469 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
1470 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX.DHAKURIA,KOLKATA-700068
1471 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
1472 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
1473 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
1474 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1475 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX,NR.CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1476 EMERTXE INFORMATION TECHNOLOGIES 83, FARAH TOWERS, 1ST FLOOR, MG ROAD, BANGALORE
1477 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
1478 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
1479 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
1480 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
1481 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1482 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1483 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
1484 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
1485 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
1486 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
1487 ENTHRALLTECH PRIVATE LIMITED 3 KACHARE CLASSIC, 1ST FLOOR, NEAR KARNATAKA HIGH SCHOOL, ERANDWANE, PUNE, MAHARASHTRA
1488 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
1489 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
1490 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
1491 ENVIRONMENTAL ACTION TRUST 168, CHERANMMA NAGAR,VILANKURICHI,COIMBATORE
1492 ENVIRONMENTAL ACTION TRUST 58,KAMARAJ STREET EXTERN,NARASIMMAPURAM NEW PLACE,KUNIYAMUTHUR,COIMBATORE
1493 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
1494 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
1495 E PARIVARA SAGAR NIVASA SPM ROAD SAGAR 577401
1496 E PARIVARA SAGARA NIVASA SPM ROAD SAGAR 577401
1497 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
1498 EPITOME HOLDINGS PRIVATE LIMITED 217, 2ND FLOOR, ANTRIKSH BHAWAN, 22 K.G. MARG NEW DELHI
1499 ERAM TECHNOLOGIES PVT LTD III FLOOR INKEL TOWER, ANGAMALY SOUTH PO, NEAR TELK ANGAMALY
1500 ERAM TECHNOLOGIES PVT LTD III FLOOR, INKEL TOWER, ANGAMALY
1501 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1502 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1503 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1504 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1505 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1506 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1507 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1508 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1509 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1510 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1511 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1512 ESTEX TELECOM PRIVATE LIMITED ESTEX HOUSE 38, DLF INDUSTRIAL AREA KIRTI NAGER
1513 ESTEX TELECOM PRIVATE LIMITED ESTEX TELECOM PVT. LTD., ESTEX HOUSE,38, KIRTINAGAR, DLF INDUSTRIAL AREA, NEAR SYNDICATE BANK, NEW DELHI
1514 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1515 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1516 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1517 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1518 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1519 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1520 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1521 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1522 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1523 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1524 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1525 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1526 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1527 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY SHOP 1 NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1528 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1529 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1530 EXPERT SKILL DEVELOPMENT PRIVATE LIMITED 163 C BLOCK NEW MANDI SIRSA ( HARYANA )
1531 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1532 EXPLORE IT SERVICES PRIVATE LIMITED FLAT NO.42,JALVAYU VIHAR SECTOR 7,VIDHADHAR NAGAR,JAIPUR(RAJ.)
1533 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1534 FAANS CONSULTANTS PVT LTD C#6,LIGHT HOUSE HILL ROAD,OPPOSITE KASTHURBA MEDICAL COLLEGE,HAMPANKATTA
1535 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1536 FACE INDIA TRUST FACE INDIA TRUST,141B/5B OM GAYATRI NAGAR POST TELIYARGANJ DISTRICT ALLAHABAD UP 211004 PH 0532 2544222
1537 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1538 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1539 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1540 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1541 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1542 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1543 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1544 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1545 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1546 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1547 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1548 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1549 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1550 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1551 FALKAN PVT LTD COURT ROAD MAGAM, BUDGAM, J&K
1552 FARIDSAB WELFARE SOCIETY ADARSH COMPUTER, OPP. JANTA HIGH SCHOOL, DB PATIL COMPLEX, NAIGAON
1553 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1554 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1555 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1556 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1557 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1558 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1559 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1560 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1561 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1562 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1563 FIDERE FACILITIES MANAGEMENT PVT LTD 7 CLUB DRIVE ROAD, MG ROAD, GHITTORNI NEW DELHI-1110030
1564 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1565 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1566 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1567 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1568 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1569 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1570 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1571 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1572 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1573 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1574 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1575 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1576 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1577 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1578 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1579 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1580 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1581 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1582 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS REGISTER :- 61, DESHBANDHU APARTMENT, KALKAJI CONTACT DETAIL C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1583 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1584 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS UDAAN REGISTERED OFFICE O61, DESHBANDHU APARTMENT, KALKAJI, NEW DELHI 110019 CORPORATE OFFICE :- C-27, DAYANAND COLONY, LAJPAT NAGAR IV, NEW DELHI 110024
1585 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS UDAAN C-27, DAYANAND COLONY
1586 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1587 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1588 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1589 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1590 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1591 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1592 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1593 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1594 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1595 FUTURE BUILD NADAF BUILDI 2ND FLOOR NEAR RAHUL HOTEL BUS STAND ROAD HUKKERI 591309
1596 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1597 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA , DIST BULANDSHAHAR
1598 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA AULINA
1599 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1600 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1601 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1602 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1603 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1604 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1605 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1606 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1607 GAIA CONSULTING AND SOLUTION PVT LTD NO 19,1ST FLOOR,1ST MAIN ROAD,KAMARAJ NAGAR,THIRUVANMIYUR, CHENNAI - 600041, TAMILNADU
1608 GAIA CONSULTING AND SOLUTION PVT LTD NO.2, PRAKASAM STREET, BAKTHAVACHALAQPURAM, AVADI, CHENNAI - 600 054, TAMILNADU, INDIA
1609 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1610 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1611 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1612 GAJBA RESEARCH AND TRAINING INSTITUTE PVT LTD LANE NO 02, SANTOSH NAGAR, BEHIND KATRAJ LAST BUS STOP, NEAR DELIGHT BAKERY, PUNE
1613 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1614 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1615 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1616 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1617 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1618 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1619 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1620 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1621 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1622 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1623 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1624 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1625 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1626 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1627 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1628 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1629 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1630 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1631 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1632 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1633 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1634 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1635 GANGA DEVI MEMORIAL TRUST PRABHUNATH NAGAR CHAPRA GROUND FLOOR GDMT CAMPUS
1636 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1637 GANPAT UNIVERSITY GANPAT UNIVERSITY, GANPAT VIDYANAGAR
1638 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1639 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1640 GARV FOUNDATION AGAR NAGAR RAILWAY ROAD, NABHA
1641 GARV SHIKSHAN SANSTHA PURAI BHILAI
1642 GARV SHIKSHAN SANSTHA MALVIYA NAGAR DURG PURAI, UTAI, BHILAI
1643 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1644 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1645 GAURAV MEMORIAL TRUST E/5 VARDHMAN CITY PATEL NAGAR RAISEN ROAD BHOPAL 462021
1646 GAURI EDUCATIONAL SOCIETY 28-LAXMI NAGAR, SANJAY NAGAR BYPASS ROAD BAREILLY (UTTAR-PRADESH)
1647 GAUTAM BUDH HEALTH CARE FOUNDATION C-1 SECTOR 12 NOIDA
1648 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1649 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1650 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1651 GAYAK MARKETING PRIVATE LIMITED 40, MUMBAI ROAD,BANSWARA, RAJASTHAN
1652 GAYAK MARKETING PRIVATE LIMITED 40 INDUSTRIAL AREA DAHOD ROAD, BANSWARA, RAJASTHAN
1653 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1654 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1655 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1656 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1657 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1658 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTI PARK SOCIETY B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1659 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1660 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1661 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1662 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1663 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1664 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1665 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1666 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1667 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1668 GENUINESOFT ST.HINDUCOLLEGE ROAD
1669 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1670 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1671 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1672 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1673 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1674 GET SOURCE EDUCATION PRIVATE LIMITED 324-C,MODEL TOWN
1675 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1676 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1677 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1678 GFHDYHDBAH VSGYCGDHFGSDY
1679 GFHDYHDBAH QSDWEFWE
1680 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1681 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1682 GIMIT E SERVICES GIMIT BUILDING H-11 SOUTH EXTENTION PART 1
1683 GI POWER CORPORATION LIMITED GI POWER CORPORATION LIMITED 91A MITTAL COURT, NARIMAN POINT, MUMBAI 400021
1684 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1685 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1686 GITANJALI FOUNDATION VILLAGE BARABAGAN POST OFFICE BARABAGAN POLICE STATION SURI
1687 GITANJALI FOUNDATION GITANJALI BUILDING, VILL-BARABAGAN, PO-BARABAGAN, PS-SURI,
1688 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1689 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1690 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1691 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1692 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1693 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1694 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1695 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1696 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1697 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1698 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1699 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1700 GK FOUNDATION 36/B KALKAJI NEW DELHI
1701 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1702 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1703 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1704 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1705 GLOBAL EDUCATIONAL TRUST 17/483 SREEKANTEAWARA COMPLEX PUTHIYAMBALAM PUTHIYARA PO
1706 GLOBAL EDUCATIONAL TRUST 17/483 SREEKANTESWARA COMPLEX BEHIND INDOOR STADIUM PUTHIYAMBALAM
1707 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1708 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1709 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1710 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1711 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1712 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1713 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1714 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1715 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX, DAKBANGLOW CHOWK, OPP.PUNJAB & SINDH BANK, PATNA - 1
1716 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY PARIJAT COMPKEX, 1ST FLOOR,OPP - PUNJAB & SINDH BANK, DAKBUNGLOW CHOWK, PATNA, BIHAR
1717 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX,DAKBANGLOW CHOWK,OPP. PUNJAB & SINDH BANK, PATNA - 1
1718 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1719 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1720 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1721 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1722 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1723 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1724 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE, RAMBAGH ROAD, MUZAFFARPUR BO: 2ND FLOOR, MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1725 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1726 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1727 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1728 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1729 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1730 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1731 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1732 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1733 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1734 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1735 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1736 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101,
1737 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1738 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1739 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1740 GLOWDOWN SERVICES PRIVATE LIMITED MADHUKUNI, 2 FLOOR, BANK COLONEY, NEAR UNION BANK OF INDIA
1741 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1742 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1743 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1744 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1745 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1746 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1747 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1748 GOBARDHANDANGA EDUCATION SOCIETY VILL & PO-GOBARDHANDANGA,PS-SAGARDIGHI,DIST-MURSHIDABAD
1749 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,P.O.+P.S.-CHANDRAKONA TOWN
1750 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR,PO+PS-CHANDRAKONA
1751 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
1752 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR.PO+PS-CHANDRAKONA ,DIST-PASCHIM MEDINIPUR
1753 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1754 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1755 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1756 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTAL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERELA
1757 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTEL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERALA
1758 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTAL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULAM, SOUTH RAILWAY STATION, COCHIN KERALA
1759 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTEL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERALA
1760 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1761 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1762 GOMAL JAN SEWA SANSTHAN JANKI NAGAR, WARD NO- 07, NAGAR PANCHAYAT KUSHINAGAR
1763 GOODWORTH FOREX AND SERVICES PVT LTD A-276, BASEMENT, SHIVALIK, NEW DELHI
1764 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1765 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1766 GOPAL KIRAN SIKSHA AVAM SANSKRITIK SAMITI NIMRAJE SADAN, NEW MOHAN NAGAR, THATIPUR
1767 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1768 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1769 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1770 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST JONIHA FATEHPUR
1771 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANTHAN VILL & POST JONIHA FATEHPUR
1772 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1773 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1774 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1775 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1776 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1777 GOYAL CELLULAR INDIA PRIVATE LIMITED SCF 184, NEAR BSNL OFFICE, HUDA COMPLEX, ROHTAK
1778 GOYAL CREATION PVT LTD OFFICE A-150(B),AMBAJI INDUSTRIAL AREA.SANTPUR,ABUROAD
1779 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1780 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1781 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1782 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1783 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1784 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1785 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1786 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1787 GRAMDEEP MADHUBANI VILL - GOSAITOL, POST - RAGHOPURBALAT,VIA - RAMPATTI, DIST. - MADHUBANI, BIHAR.
1788 GRAMDEEP MADHUBANI GOSAITOLA, PO - RAGHOPUR BLAT, VIA- RAMPATTI, DIST.- MADHUBANI, BIHAR
1789 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1790 GRAMIN BAL EVAM MANAV VIKAS SAMITI AT JAGIRMAHESHKHUNT GRAM, PO: HALDHARA HAAT, PANCHAYAT: LAXMIPUR, BLOCK: KURSAKANTA, DISTT: ARARIA, PINCODE: 854331 (BIHAR)
1791 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1792 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL, SADPURA NEW COLONY, NEAR SADPURA KABRISTAN, NEEM CHOWK, MUZAFFARPUR -842002, BIHAR
1793 GRAMIN LOK SEVA SANSTHA GUMMALKONDA AT GUMMALKONDA POST ASARALLI TAH SIRONCHA DIST GADCHIROLI-442505
1794 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1795 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR
1796 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR, GUJARAT-384315
1797 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1798 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1799 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1800 GRAMIN UTHAN MANAV SANSTHAN VILL-MANDI DANTOUR,TALUKA-KHAJUWALA,DISTBIKANER, RAJASTHAN
1801 GRAMIN UTHAN MANAV SANSTHAN VILL-MANDI DANTOUR,TALUKA-KHAJUWALA,DISTBIKANER, RAJASTHAN-334023
1802 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1803 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1804 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1805 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1806 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1807 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1808 GRAMIN VIKAS SEVA SANSTHAN VILL POST TARIA LACCHIRAM KUSHINAGAR U.P
1809 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD, NEAR KOTWALI, SAHARA INDIA 02ND FLOOR, MOHALLA- MULIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1810 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD NEAR KOTWALI SAHARA INDIA OFFICE 02ND FLOOR, MOHALLA- MURLIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1811 GRAMIN VIKAS SEWA SAMITI MOHALLA- SHAKITI NAGAR POST- GANDHI NAGAR DISTRICT- BASTI, UTTAR PRADESH
1812 GRAMIN VIKAS SHIKSHAN SANSHTA GRAMIN VIKAS SHIKSHAN SANSHTA ORGANISED CAREER COMPUTER AND TECHNICAL INSTITUTE, FIRST FLOOF, STATE BANK TO GOVT. HOSPITAL ROAD, BANOSA,TQ. DARYAPUR, DIST. AMRAVATI.
1813 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1814 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1815 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1816 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1817 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1818 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1819 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1820 GRAM SHIKSHAN EVAM VIKAS SAMITI VILL +POST KAHLA MALIHABAD LUCKNOW
1821 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1822 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1823 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1824 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1825 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1826 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1827 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1828 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1829 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1830 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, 100 FT.. ROAD, AMRITSAR
1831 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1832 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1833 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1834 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1835 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1836 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1837 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1838 GREEN INDIA FOUNDATIONAL TRUST 4/66-1 SUMANGALINAGAR, PURATHAUDI, TRICHY.
1839 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1840 GREENMILE CONSULTANCY SERVICES PRIVATE LIMITED 2/5, GOLDEN ARCADE, NACHATRA HOMES NEAR ZEE SCHOOL, HOSUR
1841 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1842 GREEN THINK VENTURES PVT LTD WEBEL BHAWAN, MONIBHANDAR, 4TH FLOOR EP & GP BLOCK, SALTLAKE, SECTOR V
1843 GREEN VIEW EDUCATIONAL AND SKILLS INDIA PVT LTD PRADHAN COMPLEX THAKUR MARKET MAIN ROAD MAIRWA DHAM MAIRWA SIWAN BIHAR
1844 GRG POLYTECHNIC COLLEGE GRG POLYTECHNIC COLLEGE KUPPEPALAYAM S.S. KULAM POST COIMBATORE
1845 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1846 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1847 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1848 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1849 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR PHASE-1, DELHI.
1850 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR, PHASE-1, DELHI.
1851 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1852 GROWTH FOUNDATION OF INDIA L-46A, MALVIYA NAGAR NEW DELHI-110017
1853 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1854 G T TRUST 693 BAZZAR STREET, ATTUR,SALEM
1855 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1856 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1857 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1858 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1859 GUJARAT ASSOCIATION FOR RURAL AND URBAN DEVELOPMENT M 11 SUMAN TOWER SECTOR 11 CH ROAD GANDHINAGAR
1860 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1861 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1862 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1863 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1864 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1865 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1866 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1867 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1868 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1869 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1870 GUNJ SHIKSHA SEWA EVAM VIKAS SAMITI ATHNER COLLEGE ROAD ATHNER DIST- BETUL (M.P.)
1871 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1872 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1873 GURU EDUCATIONAL TRUST NO-2/229E, SALEM MAIN ROAD, B. NADOOR. BOMMIDI, DHARMAPURI-635301.
1874 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1875 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1876 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1877 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1878 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1879 GURUKRUPA EDUCATIONAL TRUST MAHABAHU ENCLAVE, PLOT NO. 1753/3, AT - KALARAHANGA, POST - KIIT SQUARE, BHUBANESWAR, KHORDHA, ODISHA
1880 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1881 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1882 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1883 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1884 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1885 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1886 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1887 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
1888 GVK EMERGENCY MANAGEMENT AND RESEARCH INSTITUTE MEDCHAL ROAD, DEVARYAMZAL, SECUNDERABAD, TELANGANA
1889 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1890 GYANARPAN SAMAJ SEVI SANSATHAN IN FRONT OF SUPTESHWAR GANESH MANDIR RATAN NAGAR ROAD JABALPUR
1891 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1892 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1893 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
1894 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1895 GYAN KALP CHARITABLE TRUST INDIC HEIGHTS, AT/PO-MUKTAPUR, KHORDHA
1896 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1897 GYAN SAROVAR SHIKSHA EVAM JAN KALYAN SAMITI 5, NEAR GAS AGENCY, S.A.T.I ROAD
1898 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1899 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1900 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1901 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1902 HAIR RAISERZ SCO 27, SECTOR 15C, CHANDIGARH
1903 HAIR RAISERZ LLP SCO 27, SECTOR 15C CHANDIGARH
1904 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1905 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
1906 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1907 HANKER SOLUTIONS PVT LTD B610, LOGIX TECHNOVA, SECTOR 132, NOIDA
1908 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1909 HAPPINESS FOR ALL WELFARE AND EDUCATION SOCIETY 1ST FLORE SAMADHAN CAREER ACADEMY TANDON BAGICHA DAMOH 470661
1910 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1911 HAPPY WELFARE SOCIETY PLAT NO 11 PURWANCHAL NAGAR ALOK DUBEY ROAD KALYANPUR LUCKNOW
1912 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1913 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1914 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1915 HARIBALA TRUST 2/173,HARIBALA ILLAM, T PUDUR, SIVAGANGAI TAMILNADU
1916 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1917 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1918 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1919 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1920 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1921 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1922 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1923 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1924 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1925 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1926 HARSHAMITRA ONCOLOGY PRIVATE LIMITED 1273-13, KALINGIPATTI SALAI BLOCK VIRALIMALAI ILLUPPUR TALUK PUDUKKOTTAI TN 621316 IN
1927 HARSHAMITRA ONCOLOGY PRIVATE LIMITED HARSHAMITRA ONCOLOGY PVT LTD, 1273-13,KALINGAPATTI SALAI BLOCK, VIRALIMALAI, ILUPPUR TALUK
1928 HARSH PVT LTD SDFAAFDSSDF
1929 HARYANA ESTATE SOLUTIONS HARYANA ESTATE SOLUTIONS,SHOP NO.-1,GROUND FLOOR,NEAR FOOD HUB SEC 37,MAIN SECTOR ROAD,BASAI ENCLAVE EXTN. ,GURGAON 122001
1930 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1931 HASAN EDUCATIONAL SOCIETY HASAN EDUCATIONAL SOCIETY MAIN ROAD VPO JAULA TEHSIL BUDHANA DIST MUZAFFARNAGAR UTTAR PRADESH PIN 251309
1932 HATE KALAME SHIKSH KENDRA AUSHGRAM ROAD, GUSHKARA KALITALA, PURBA BARDDHAMAN, WEST BENGAL
1933 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1934 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1935 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1936 HEAD HELD HIGH FOUNDATION 22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1937 HEAD HELD HIGH FOUNDATION VILLA 21-22, PALM MEADOWS, PHASE-1, RAMAGONDANAHALLI, WHITEFILED ROAD, BANGALORE
1938 HEAD HELD HIGH FOUNDATION NO.22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1939 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
1940 HEALTH AND EDUCATION FOR ALL HEAL HEAL PARADISE, THOTAPALLI, AGIRIPALLI, KRISHNA DISTRICT,ANDHRA PRADESH
1941 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1942 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1943 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1944 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1945 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1946 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1947 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1948 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
1949 HEERA HOSPITALITY PRIVATE LIMITED S.NO. 298, DHULE ROAD, NANDURBAR
1950 HEERA HOSPITALITY PRIVATE LIMITED SAI SEVA HOSPITAL, DHULE ROAD, NANDURBAR, MAHARAHSTRA
1951 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1952 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414,BLOCK NO 22/23/24/25 HUMNABAD ,BIDAR
1953 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414 BLOCK NO 22,23,24,25
1954 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1955 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1956 HELPING HAND WELFARE SOCIETY REG.OFFICE VILL SARSOPAR POST BHUSWAL BU DIST GORAKHPUR 273403 HEAD OFFICE- BHITAHA, KAURIRAM GORAKHPUR-273413
1957 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
1958 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1959 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1960 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1961 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1962 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1963 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
1964 HEROTOM INFRASTRUCTURE PRIVATE LIMITED HEROTOM INFRASTRUCTURE PRIVATE LIMITED J 71, GALI NO-4, LAXMI NAGAR - 110092, DELHI, INDIA
1965 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
1966 HEWTECH SYSTEM C-2, JAIPRAKASH NAGAR ASHIYANA, PATNA, BIHAR
1967 HGS INTERNATIONAL SERVICES PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI
1968 HGXDNG CBGNCBNMCNFMHXFVM
1969 HHHH 43434
1970 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1971 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1972 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1973 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1974 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1975 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1976 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1977 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1978 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1979 HINDUJA OUTSOURCING SOLUTIONS INDIA PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI - 400018, MAHARASHTRA, INDIA
1980 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1981 HINDUSTANI TANZEEM FROGHE ILMOFUN FLAT NO. 202, KALYANI COMPLEX, LANGERTOLI CHAURAHA, PATNA - 800004
1982 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1983 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
1984 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1985 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1986 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1987 HIRANYAM VIKAS SANSTHAN 2/C, MAHIMA TOWER, OPPOSITE CHANDNI CHOWK APARTMENTS, PIPLOD, SURAT, GUJARAT.
1988 HIRANYAM VIKAS SANSTHAN 2/C, MAHIMA TOWER, PIPLOD SURAT GUJARAT
1989 HIREEX CAREER SOLUTIONS SHOP NO 1 AND 2 KAPEESH MALL, M G ROAD MULUND WEST MUMBAI 400080
1990 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1991 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1992 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1993 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1994 HLL MANAGEMENT ACADEMY HLL MANAGEMENT ACADEMY TC 4/1607, KESTON ROAD, KOWDIAR P O, TRIVANDRUM
1995 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
1996 HOLISTIC CORPORATE SERVICES PRIVATE LIMITED 5 HETAL APT, 1ST FLOOR, NEAR DEEPALI TRAVELS, NS ROAD, MULUND - WEST
1997 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1998 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1999 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
2000 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
2001 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
2002 HOPE INDIA CA-5,GOVINDO NIWAS SANYUKTA APPARTMENT KOLKATA
2003 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
2004 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
2005 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
2006 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
2007 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
2008 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
2009 HRDS INDIA HRDS INDIA DOOR NO: XIV/273, NEAR POST OFFICE, CHANDRANAGAR,PALAKKAD,KERALA
2010 HRDS INDIA THE HIGHRANGE RURAL DEVELOPMENT SOCIETY HRDS INDIA, XIV/273, NEAR POST OFFICE, CHANDRANAGAR, PALAKKAD, KERALA, INDIA
2011 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
2012 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG H. NO.52 PATHALGAON LINEPARA PATHALGAON
2013 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
2014 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
2015 HR SQUARE LLP PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
2016 HSADALO FFSE
2017 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
2018 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
2019 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
2020 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
2021 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
2022 HUMANITY WELFARE SOCIETY 860/22, LANE NO. 2 AMBA VIHAR MUZAFFARNAGAR
2023 HUMANITY WELFARE SOCIETY 860/22, LANE NO.2, AMBA VIHAR MUZAFFARNAGAR
2024 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
2025 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
2026 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
2027 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
2028 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
2029 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
2030 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
2031 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
2032 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
2033 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
2034 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
2035 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
2036 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
2037 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
2038 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
2039 ICCO C-19/A, FIRST FLOOR GREENPARK EXTENSION NEW DELHI
2040 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
2041 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
2042 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
2043 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA VILLAGE DHAKULI ZIRAKPUR, MOHALI
2044 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA, DHAKOLI ZIRAKPUR, MOHALI PUNJAB
2045 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
2046 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
2047 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
2048 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
2049 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
2050 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
2051 ICTPMU DDUGKY TEST NEW DELHI
2052 ICTPMU TEST11 NEW DELHI110001
2053 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
2054 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
2055 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
2056 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
2057 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
2058 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
2059 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
2060 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
2061 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
2062 IIAE EDUCATIONAL SOCIETY REGD OFFICE: 104-C, FLOWER ENCLAVE, DUGRI, LUDHIANA CORP OFFICE: SCF 20, 2ND FLOOR, PHASE 1, URBAN ESTATE, DUGRI, LUDHIANA
2063 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
2064 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
2065 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
2066 IITS EDUCATIONAL AND HEALTH TRUST NEAR HDFC BANK COLLEG ROAD KULGAM
2067 IITS EDUCATIONAL AND HEALTH TRUST NEAR HDFC BANK
2068 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
2069 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
2070 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
2071 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
2072 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
2073 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
2074 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2075 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2076 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2077 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
2078 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2079 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2080 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE PULWAMA J&K
2081 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2082 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
2083 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
2084 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
2085 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
2086 IMPS EDUCATIONAL TRUST VIDYAPITH ROAD, DESHBANDHUPARA, SILIGURI,
2087 IMPS EDUCATIONAL TRUST BIDYAPITH ROAD, DESHBANDHUPARA,SILIGURI,
2088 IMPULSIVE SOCIAL AWARENESS COMMITTEE WARD NO 02 JAWALAMUKHI MOHLLA SIHORA DIST.JABALPUR M.P.
2089 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
2090 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
2091 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
2092 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
2093 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2094 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2095 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2096 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2097 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2098 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2099 INDIA LIVESTOCK ORGANIC CO 572/2,ADRASH NAGAR, NEW RAILWAY ROAD, GURGAON, HARYANA-122001
2100 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, POST-HATIBERIA,HALDIA
2101 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
2102 INDIANEERS MEDIA PRIVATE LIMITED A-494, SHAHPURA, BHOPAL, MADHYA PRADESH
2103 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
2104 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
2105 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR SHIBPUR BOTANIC GARDEN HOWRAH
2106 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR POST OFFICE BOTANIC GARDEN SHIBPUR HOWRAH WEST BENGAL
2107 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
2108 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
2109 INDIAN INSTITUTE OF HARDWARE TECHNOLOGY LIMITED #15, SRI LAKSHMI COMPLEX, 4TH FLOOR , ST MARKS ROAD BANGALORE-560001
2110 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
2111 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
2112 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
2113 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
2114 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
2115 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2116 INDIAN MEDICAL TRUST NIMS UNIVERSITY DELHI JAIPUR HIGHWAY JAIPUR
2117 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2118 INDIAN MEDICAL TRUST 4, GOVIND MARG, NEAR MOTI DUNGRI CIRCLE, JAIPUR
2119 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2120 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
2121 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
2122 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
2123 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
2124 INDIAN TECHNICAL INSTITUTE A UNIT OF NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION CAMPUS:NALAPARA,NEW VIP,LOKHRA,GUWAHATI-781040,ASSAM REGISTERED OFFICE:16NO TINIALI,ABOVE ALLAHABAD BANK,KAMLABARI,ROAD,DULIAJAN-786602,DISTRICT-DIBRUGARH,ASSAM
2125 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PRIVATE LIMITED B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BR 800004 INDIA
2126 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PVT LTD B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BIHAR INDIA
2127 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
2128 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
2129 INDO AMERICAN FRIENDS GROUP TEHSIL ROAD , SALON , RAEBARELI , UTTERPRADESH
2130 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
2131 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
2132 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
2133 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
2134 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5003 PHASE-4,GIDC,VATVA MEHMDABAD ROAD,AHMEDABAD-382445 GUJARAT
2135 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5000/ PHASE - 4 GIDC, VATVA, MEHMEDABAD ROAD, AHMEDABAD, GUJARAT
2136 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
2137 INDOSYS WELFARE SOCIETY OPP. UNIVERSITY CAMPUS, TALWANDI SABO
2138 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
2139 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
2140 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
2141 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
2142 INDRAKAMAL CHARITABLE TRUST MUKHERRJEE, HATA, ARA, BHOJPUR, BIHAR, INDIA
2143 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
2144 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
2145 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
2146 INDUS CORE EDUCATION FOUNDATION G-7,KARAN GREENS ,MUMBAI BANGALORE HIGHWAY, NEAR ROSARY INTERNATIONAL SCHOOL, WARJE
2147 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
2148 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
2149 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
2150 INDUS FOUNDATION 156-GA, UMAR PUR NIWA, NEAE NEHRU PARK,DHOOMANGANJ, ALLAHABAD,U.P.-211001, INDIA
2151 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
2152 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
2153 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
2154 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
2155 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
2156 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
2157 INFOSOFT COMPUTER EDUCATION 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, NEAR DAY & NIGHT JN., SRIKAKULAM
2158 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
2159 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
2160 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
2161 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
2162 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
2163 INITIATIVE FOR SOCIAL DEVELOPMENT AND EDUCATION WELFARE SOCIETY B-311, YASHWANT SHOPPING CENTER , CARTER ROAD NO. 7 BORIVALI (EAST), MUMBAI -400066
2164 INITIATIVE FOR SOCIAL DEVELOPMENT AND EDUCATION WELFARE SOCIETY CURE ACADEMY D 3 CHARKOP ANITA CHS LTD SECTOR 6 PLOT NO 612 RSC 52 CHARKOP KANDIVALI WEST MUMBAI 400067
2165 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
2166 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
2167 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
2168 INNODUST TECHSOLUTION PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR,SAHIDNAGAR, BHUBANESWAR, 751007
2169 INNODUST TECHSOLUTION PRIVATE LIMITED S3/75/1,MANCHESWAR INDUSTRIAL ESTATE, RASULGAD,BHUBANESWAR,751010
2170 INNODUST TECHSOLUTIONS PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR, SAHIDNAGAR, BHUBANESWAR, ODISHA
2171 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED, 21-1-60, 3RD FLOOR JANDYALA VAARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA, TENALI - 522201, GURNTUR DISTRICT, ANDHRA PRADESH, INDIA
2172 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED 21-1-60,3RD FLOOR JANDYALA VARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA,TENALI
2173 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
2174 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
2175 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR 21ST. CENTURY PLAZA, SECTOR 8 COMM CENTRE, NEAR ICICI BANK ROHINI, DELHI
2176 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR, 21ST. CENTURY PLAZA, SECTOR 8 COMM. CENTRE, ROHINI, DELHI
2177 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
2178 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
2179 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
2180 INODE TALENT INSTITUTE PRIVATE LIMITED 3RD FLOOR, SEETHYS TOWER, VALLATHOL JUNCTION, THRIKKAKARA
2181 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
2182 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
2183 INSIGHT TV NEWS NETWORK PRIVATE LIMITED 314, AKANSHA BUILDING, 2, PRESS COMPLEX, M.P. NAGAR, ZONE-1, BHOPAL
2184 INSPIREDGE IT SOLUTIONS PRIVATE LIMITED H.NO: 1-111-19, PLOT NO 142, SECTOR 8, MVP COLONY, VISAKHAPATNAM
2185 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2186 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2187 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2188 INSTITUTE OF COMPUTER MANAGEMENT SCIENCE AND TECHNICAL EDUCATION RAZVI BUILDING MIRZA KAMIL HAWAL
2189 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
2190 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
2191 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
2192 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
2193 INSTITUTE OF ENVIRONMENT AND ECO DEVELOPMENT SHYAM NAGAR COLONY, MAURYAPATH, P.O.- B.V.COLLEGE, KHAJPURA, PATNA(BIHAR)
2194 INSTITUTE OF GOOD MANUFACTURING PRACTICES INDIA PRIVATE LIMITED H-119, SECTOR-63, NOIDA (UTTAR PRADESH) 201307
2195 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA
2196 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA-700049
2197 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35.M.B ROAD, UDAYPUR,BELGHARIA,KOLKATA
2198 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
2199 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
2200 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
2201 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FLOUR SIRMOUR CHOUK REWA M.P.
2202 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT HO:GI-31,ANUKAMPA-II,KALINDIPURAM PHASE II,ALLAHABAD-211011 48/9,SRK TOWER,ELGIN ROAD,CIVIL LINES ALLAHABAD-211001 U.P.
2203 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT 48/9,SRK TOWER,ELGIN ROAD ,CIVIL LINES,ALLAHABAD-211001 U.P.
2204 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
2205 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
2206 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
2207 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
2208 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
2209 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY, REG NO: TSR/TC/503/2014, P O PERINJANAM THRISSUR KERALA
2210 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SERVICE SOCIETY REG NO: TSR/TC/503/2014 P O PERINJANAM THRISSUR KERALA
2211 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY OPP.GOVT UP SCHOOL PERINJANAM P O THRISSUR DIT
2212 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
2213 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
2214 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
2215 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
2216 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
2217 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
2218 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
2219 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
2220 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
2221 INTELLISENSE INFOTECH PRIVATE LIMITED DSM 448, 449 DLF TOWER, SHIVAJI MARG, MOTI NAGAR, NEW DELHI
2222 INTELNET IT SOLUTIONS PRIVATE LIMITED 20/1 ASHUTOSH CHOWDHURY AVENUE, 2ND FLOOR, KOLKATA, WEST BENGAL, INDIA
2223 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
2224 INTERNATIONAL CENTRE FOR ENTREPRENEURSHIP AND CAREER DEVELOPMENT SECTOR E-1/41, LANE 11C, STERLING CITY, BOPAL, AHMEDABAD
2225 INTERNATIONAL CENTRE FOR ENTREPRENEURSHIP AND CAREER DEVELOPMENT SECTOR E-1/41, LANE 11C, STERLING CITY, BOPAL, AHMEDABAD
2226 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
2227 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
2228 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
2229 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
2230 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
2231 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
2232 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
2233 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET,POLUR TOWN,TIRUVANNAMALAI DITRICT,TAMILNADU.
2234 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET, POLUR TALUK,TIRUVANNAMALAI DISTRICT, TAMILNADU.
2235 INTERNATIONAL RURAL EDUCATION AND CULTURAL ASSOCIATION INRECA SANSTHAN INRECA SANSTHAN, INRECA COMPLEX RAJPIPLA ROAD DEDIAPADA DIST NARMADA GUJARAT
2236 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2237 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
2238 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2239 INTERNATIONAL TRACEABILITY SYSTEM LIMITED 3RD FLOOR, SHREE SHARDA FORTUNE TOWER,198/2/1, EAST OF KAILASH, NEW DELHI
2240 INVISION CMPUTER EDUCATION SOCIETY CHHATTISGARH GIRISH KUMAR SAHU INVISION COMPUTER MATIYA ROAD DONGARGAW
2241 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
2242 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
2243 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
2244 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
2245 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
2246 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
2247 ISECT WELFARE AND EDUCATION SOCIETY BARAN NEAR KUMHARON KA MANDIR VISHNU VYAYAMSHALA SABJI MANDI KI TEK BARAN 325205
2248 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
2249 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
2250 ISHAN JAN SEVA SANSTHAN K-206,YASHODA NAGAR,KANPUR
2251 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
2252 ISHWARDAS MEMORIAL SHIKSHA ANUSANDHAN EVAM PRASHIKSHAN SANSTHAN KHASRA NO. 1522 WARD NO. 05 NEAR PHED OFFICE LADNUN NAGAUR RAJASTHAN 341306
2253 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
2254 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
2255 ISTI EDUCATION PRIVATE LIMITED E-15, BASEMENT, LAJPAT NAGAR-I, NEW DELHI
2256 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
2257 IT LITERACY MISSION CHARITABLE SOCIETY PAMMAM COMPLEX, NEAR MUTHUMARIAMMAN TEMPLE, SATHRAM JN NEDUMANGAD, TRIVANDRUM, KERALA
2258 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
2259 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
2260 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2261 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2262 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2263 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2264 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
2265 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
2266 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
2267 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
2268 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
2269 IVYS DESIGN PRIVATE LIMITED 46-SINDHU NAGAR PATEL PATH MURALIPURA JAIPUR RAJ.
2270 JAAT INSTITUTE OF INFORMATION TECHNOLOGY VPO BHARATIA THANA BALDEV TEHSIL MAHAVAN DISTRICT MATHURA STATE UTTAR PRADESH PIN 281302 M NO 8755202277
2271 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
2272 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
2273 JADISH MISHRA SIKSHA PRACHAR PRASAR SAMITI JADISH MISHR SHIKSHA PRACHAR PRASAR SAMITI, SONDA(EAST), SALEMPUR ROAD, DIST- DEORIA, CITY-DEORIA, UP
2274 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE;26GANESH CHANDRA AVENUE KOLKATA MAILING ADDRESS;BUDGE BUDGE INSTITUTE OF TECHNOLOGY BUDGE BUDGE KOLKATA
2275 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE :26,GANESH CHANDRA AVENUE,KOLKATA 700013 MAILING ADDRESS: BUDGE BUDGE INSTITUTE OF TECHNOLOGY, BUDGE BUDGE, KOLKATA
2276 JAGANNATH GUPTA FAMILY TRUST NISCHINTAPUR, BUDGE BUDGE
2277 JAGAN NATH GUPTA MEMORIAL EDUCATIONAL SOCIETY PLOT NO-4, SECTOR-3, ROHINI, DELHI
2278 JAGAN RAJ PROFESSIONAL STUDIES PVT LTD 223,PRATAP NAGAR HOUSING SOCIETY,VASHISHATH MARG,VAISHALI NAGAR,JAIPUR,RAJ.
2279 JAGDAMBA TECHNICAL SOCIAL ORGANISATION AT & PO BHAMBLA TEH SARKAGHAT DISTT MANDI HP
2280 JAGDISH MISHRA SIKSHA PRACHAR PRASAR SAMITI JADISH MISHR SHIKSHA PRACHAR PRASAR SAMITI,SONDA(EAST), SALEMPUR ROAD, DIST- DEORIA, CITY-DEORIA,UP
2281 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
2282 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
2283 JAGO GAON JAGO GAON PRIVATE ITI VILLAGE-DAMODARPUR,POST-PASOPUR,BLOCK-BHAGWANPUR,DISTRICT-BEGUSARAI,BIHAR
2284 JAGO GAON REGISTERED OFFICE-47A,B2,SEWAK PARK,UTTAM NAGAR,NEW DELHI FIELD OFFICE-VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR, ADMIN OFFICE-HOUSE NO- A2/7/31,PLOT NO-23,PH-V, AYA NAGAR EXT,NEW DELHI-110047
2285 JAGO GAON VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR
2286 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
2287 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2288 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2289 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2290 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2291 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2292 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2293 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2294 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2295 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
2296 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
2297 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
2298 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
2299 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
2300 JAHNAVI TECHNICAL EDUCATIONAL SOCIETY JAHNAVI INSTITUTE OF MULTIMEDIA TECHNOLOGY C/O JAHNAVI DIGITAL STUDIO, BRIDGE ROAD, NEAR 7 ROAD JUNCTION, OPP : SBI ATM, SRIKAKULAM-532001 ANDHRA PRADESH
2301 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
2302 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
2303 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1 GOMTI NAGAR, LUCKNOW, UP
2304 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1, GOMTINAGAR
2305 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
2306 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
2307 JAI MAMAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN CHOWK, DAYALBAND
2308 JAIN COMPUTER ACADEMY SAMITI WARD NO 01 MAHATMA GANDHI WARD BANDA BELAI
2309 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
2310 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
2311 JAIN WELFARE TRUST 107, OLD DHANMANDI, SRI GANGANAGAR
2312 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRIGANGANAGAR RAJ-335001
2313 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
2314 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR
2315 JAISHREEHARI JANKALYAN AVAM SHIKSHA PRASAR SMITI NEAR BY ATTA CHAKKI ,H.NO 1,BLOCK-A,SHASTRI NAGAR BHIND ,MADHYAPRADESH
2316 JAI SIKSHAN SAMITY WARD NO. 21 BHALESAR ROAD, MAHASAMUND
2317 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2318 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2319 JAMMU AND KASHMIR INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION LTD DIC COMPLEX EXHIBITION GROUND JAMMU
2320 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
2321 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
2322 JANAMBHUMI PRAGATI SAMAJ VILL SHASTRINAGAR PO BALADMARI PS AND DISTRICT GOALPARA
2323 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
2324 JANASNEHI SOCIAL WELFARE SOCIETY SHIGGAON JANASNEHI SOCIAL WELFARE SOCIETY BVK PLAZA NEAR JMFC COURT COMPLEX, MAIN ROAD HANGAL-581104
2325 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
2326 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
2327 J AND K INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANISATION LIMITED DIC COMPLEX, EXHIBITION GROUND JAMMU
2328 J AND K YOUTH DEVELOPMENT FORUM BAKTOO COMPLEX BEEHAMA GANDERBAL
2329 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2330 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2331 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
2332 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2333 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2334 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
2335 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
2336 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
2337 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
2338 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
2339 JAN KALYAN SAMITI JAIN
2340 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
2341 JAN KALYAN SHIKSHA SAMITI A-1413/3
2342 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
2343 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
2344 JANKI DEVI EDUCATIONAL WELFARE SOCIETY 74/35, RAJPUR ROAD, OPP. HOTEL MADHUBAN DEHRAUN
2345 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
2346 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
2347 JANMAT VIKASH PRAGTI PATH SAMITI BEHIND OF SBI BANK A.B ROAD KOLARAS SHIVPURI MADHYA PRDESH
2348 JAN SAHARA SARAI VILL + PO- SARAI, PS - MANER, DIST - PATNA
2349 JAN SAHARA SARAI VILL + PO - SARAI,PS - MANER, DIST- PATNA
2350 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
2351 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
2352 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
2353 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
2354 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2355 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2356 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
2357 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
2358 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
2359 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
2360 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM NORTH PARAVOOR ERNAKULAM DISTRICT
2361 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
2362 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
2363 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
2364 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
2365 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
2366 JANVIKAS FOUNDATION KMJ HOSPITAL ROAD SHASTRI WARD
2367 JAN VIKAS KRANTI VILLAGE-DEOGHAR, POST+ BLOCK-JAGDISPUR , DIT- BHOJPUR ( BIHAR)
2368 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
2369 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
2370 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
2371 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
2372 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
2373 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2374 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
2375 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2376 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
2377 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
2378 JAYA SKILLS OPC PRIVATE LIMITED TULSI NAGAR COLONY,KHADI BHANDAR CHOWK
2379 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
2380 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
2381 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
2382 JAY RAJHARA BABA SHIKSHAN SAMITI DALLIRAJHARA SHOP NUMBER-39,BSP COMPLEX,DALLI RAJHARA IN FRONT OF JALA RAM MANDIR
2383 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
2384 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
2385 JB PLASTOCHEM PRIVATE LIMITED JAIN FOOD COMPOUND, GUT NO. 43/B/2, N. H. NO. 06, SAVKHEDA (BK.)
2386 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
2387 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2388 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2389 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU, KOZHIKODE.
2390 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2391 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE,JAMIATH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2392 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
2393 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2394 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
2395 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2396 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
2397 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
2398 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
2399 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
2400 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
2401 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
2402 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
2403 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
2404 JEEVANTI SEWA SAMITI 9, CIVIL LINES VIDISHA
2405 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
2406 JET KNITWEARS LTD 119/410-B-1, DARSHAN PURWA, KANPUR, UTTAR PRAESH -208012
2407 JET KNITWEARS LTD 119/410-B-1, DARSHAN PURWA, KANPUR, UTTAR PRAESH -208012
2408 JFJGF 9ODPJ
2409 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
2410 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
2411 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
2412 JINDAL INFRA SOLUTION LIMITED 214, AMBA TOWER DC CHOWK SEC-9 ROHINI
2413 JINDAL INFRA SOLUTIONS LIMITED 214,2ND FLOOR AMBA TOWER D.C. CHOWK SEC-9 ROHINI NEW DELHI
2414 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
2415 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
2416 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
2417 JIVAN JYOTI TRUST CHRISTIAN COLONY BEHIND C.N.I. CHURCH, PANDIT NEHRU VIDYA VIHAR, BEHRAMPURA, AHMEDABAD GUJRAT
2418 JIVAN JYOTI TRUST CION NAGAR NR MUKTIFOZ CHURCH, BEHRAMPURA, AHMEDABAD, GUJARAT
2419 JIVAN JYOTI TRUST CHRISTIAN COLONY BEHIND C.N.I. CHURCH BEHRAMPURA AHMEDABAD
2420 JIVAN JYOTI TRUST CION NAGAR NR MUKTIFOZ CHURCH, BEHRAMPURA, AHMEDABAD, GUJARAT
2421 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
2422 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
2423 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI BANDIPORA JAMMU AND KASHMIR
2424 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI
2425 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
2426 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
2427 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
2428 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
2429 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2430 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2431 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
2432 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
2433 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD.
2434 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2435 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2436 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2437 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2438 JOY HOTEL AND RESORTS PRIVATE LIMITED PLOT NO 33-34 INDUSTRIAL AREA PHASE 2 CHANDIGARH
2439 JOY HOTEL AND RESORTS PRIVATE LIMITED PLOT NO 33-34 INDUSTRIAL AREA,PHASE 2 ,CHANDIGARH
2440 J P FOUNDATION SANSTHA CHAMPESWAR COLONY CHAKSU, WARD NO. 19, CHAKSU, JAIPUR
2441 J P FOUNDATION SANSTHA KASTURI DEVI COLLEGE PHAGI MODE CHAKSU JAIPUR
2442 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
2443 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
2444 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
2445 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2446 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2447 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
2448 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
2449 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
2450 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
2451 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
2452 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
2453 JUPITER CRAFTS PLOT NO 55 – A, E.P.I.P., PHASE I, JHARMAJRI,BADDI,DISTT-SOLAN, HIMACHAL PRADESH
2454 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
2455 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
2456 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
2457 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2458 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2459 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2460 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2461 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2462 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2463 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
2464 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING 3RD FLOOR, ZODIN SQUARE
2465 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
2466 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
2467 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
2468 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
2469 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
2470 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
2471 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2472 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2473 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2474 KAIZEN METAL FORMING PRIVATE LIMITED 132 SITE 5, KASNA INDUSTRIAL AREA, GREATER NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
2475 KAKUMANI EDUCATIONAL SOCIETY PARAMESWARA MANGALAM,PUTTUR,CHITTOOR(DIST), ANDHRA PRADESH
2476 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
2477 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
2478 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2479 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2480 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
2481 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
2482 KALEKE LIVETECH SERVICES PRIVATE LIMITED SCO 5,6 FIRST FLOOR, LANDRA ROAD,SOHANA, SEC. 78,SAS NAGAR, MOHALI - 140308
2483 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
2484 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
2485 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
2486 KALPATARU GRAMODYOG SAMITI JUNIOR HIG 9 KEHKASHA APT KOH-E-FIZA BHOPAL
2487 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
2488 KALPTARU EDUCATION SOCIETY KANTI ENCLAVE SAMITI DREAM VALLEY COLLEGE , NEAR RAILWAY SPRING FACTORY NH-10 SITHOLI GWALIOR (M.P.)
2489 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
2490 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
2491 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
2492 KALVI INSTITUTE PRIVATE LIMITED NO.9-1-66, DOUBLE AGRAHARAM STREET, SHOLAVANDAN, MADURAI, TAMIL NADU - 625214
2493 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2494 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2495 KALYANI WELFARE SOCIETY WARD NO. 21, PANJABI GURUDWARA ROAD, GHARAULA MOHALLA, SHAHDOL
2496 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
2497 KALYANSUNDARAM WELFARE AND EDUCATIONAL TRUST G01, VASUDEO CITY,RAJENDRA PATH, BENI BABU KA BAGAICHA,NEAR ASHIYANA HYUNDAI SHOWROOM, PATNA BIHAR
2498 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
2499 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
2500 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
2501 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2502 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
2503 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2504 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
2505 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
2506 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
2507 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
2508 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
2509 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED HOUSE NO-15,PLOT NO-1149,GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA
2510 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
2511 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
2512 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
2513 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
2514 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
2515 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GHALIB GHS, PITAMPURA NEW DELHI
2516 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GROUND FLOOR GHALIB APARTMENT PITAMPURA NEW DELHI
2517 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2518 KANCHAN INDIA LIMITED 5-O-5 RC VYAS COLONY BHILWARA
2519 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2520 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2521 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
2522 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2523 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2524 KANCHAN INDIA LIMITED AN ISO 9001:2008, 14001:2004 CERTIFIED COMPANY) (SPINNING DIVISION) 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2525 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2526 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
2527 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
2528 KANHA BHARAT VIKASH EVAM JANKALYAN SAMITI HAVELI ROAD BEHIND SHAKTI CINEMA
2529 KANPUR SUBHASH SHIKSHA SAMITI 127/470, W-1, SAKET NAGAR, KANPUR
2530 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
2531 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
2532 KARCHER CLEANING SYSTEMS PRIVATE LIMITED D-120, SEC-63, NOIDA, GHAZIABAD, UTTAR PRADESH
2533 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
2534 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
2535 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
2536 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
2537 KARMYOGI EMPOWERMENT ORGANIZATION 45 NAHADEVAS NEAR OLD SWA
2538 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
2539 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
2540 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2541 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2542 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
2543 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
2544 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
2545 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, 4TH CROSS STREET, RAGAVENDIRA CITY, VADALUR
2546 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, 4TH CROSS STREET RAGAVENDIRA CITY VADALUR KURINJIPADI TALYK
2547 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, RAGAVENDIRA CITY VADALUR
2548 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
2549 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
2550 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
2551 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
2552 KASHA GOUD EDUCATIONAL SOCIETY VINAYAKA NAGAR NIZAMABAD
2553 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
2554 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
2555 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
2556 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
2557 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
2558 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
2559 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
2560 KATYANI ENERGY SOLUTION PRIVATE LIMITED HEAD OFFICE: A-86, 3RD FLOOR, MCD NO. – 944, ARJUN NAGAR, KOTLA MUBARAKPUR, NEW DELHI
2561 KATYANI ENERGY SOLUTION PVT LTD WZ 490/A BRITANNIA CHOW SRI NAGAR NEW DELHI
2562 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2563 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2564 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HRAYANA, 122001
2565 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2566 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2567 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2568 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
2569 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
2570 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
2571 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
2572 KAUTALA VIVEKANANDA SOCIAL DEVELOPMENT SOCIETY VILL- KAUTALA, P.O- D/GANGADHAR PUR, P.S- DHOLA HAT
2573 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
2574 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
2575 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
2576 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
2577 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
2578 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
2579 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
2580 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
2581 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2582 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2583 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2584 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2585 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2586 KAYZEY SOCIETY MAWNGAP MAWSMAI
2587 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
2588 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
2589 KENDRIYA BHANDER B-1 SHYAMALI HOUSING ESTATE, SALT LAKE CITY, KOLKTA
2590 KERALA HOLY CROSS SISTERS SOCIETY HOLY CROSS INSTITUTE THRIKKAKARA P.O KOCHI, ERNAKULAM DISTRICT, KERALA
2591 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
2592 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
2593 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR, P.S-PANCHLA, DIST-HOWRAH
2594 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR,
2595 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR,
2596 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
2597 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
2598 KGVK NEORI VIKAS RUKKA RANCHI
2599 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
2600 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
2601 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
2602 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
2603 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP KIICT BUILDING NEAR REST HOUSE, INFRONT OF WRD OFFICE MAIN ROAD PAWANI BALODABAZAAR,RAIPUR-493338
2604 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP IICT BUILDING NEAR REST HOUSE INFRONT OF WRD OFFICE MAIN ROAD PAWANI BLOCK BILAIGARH DISTRICT BALODABAZAAR
2605 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP IICT BUILDING NEAR REST HOUSE INFRONT OF WRD OFFICE MAIN ROAD PAWANI BLOCK BILAIGARH DISTRICT BALODABAZAAR
2606 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
2607 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
2608 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
2609 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
2610 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
2611 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
2612 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2613 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2614 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
2615 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
2616 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2617 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
2618 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2619 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
2620 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
2621 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
2622 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
2623 KIRANMAYI SOCIO EDUCATIONAL SOCIETY H. NO. 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA-520008, A.P.
2624 KIRANMAYI SOCIO EDUCATIONAL SOCIETY 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA
2625 KIRANMAYI SOCIO EDUCATIONAL SOCIETY H. NO. 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA A.P.
2626 KISANKARTS AGRO MANAGEMENT PRIVATE LIMITED VILLAGE DHALUABARI WEST POST GHUGHUMARI DISTRICT COOCHBEHAR WEST BENGAL 736170
2627 KISANKARTS AGRO MANAGEMENT PRIVATE LIMITED DHALUABARI WEST POST GHUGHUMARI PANISHALA
2628 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
2629 KISAN SEWA SANSTHAN MAHESH BHAWAN, AWAS VIKAS COLONY, KATRA, BASTI U.P.-272001
2630 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
2631 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
2632 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
2633 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
2634 KITES SKILLS PRIVATE LIMITED 6-122/2, ABOVE LIC OFFICE, VISAKHA ROAD, PENDURTHI, VISAKHAPATNAM
2635 KITES SKILLS PRIVATE LIMITED 18-52, VELAMATHOTA, PENDURTHI, VISAKHAPATNAM, ANDHRA PRADESH
2636 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
2637 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
2638 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
2639 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
2640 K L FITNESS OPC PRIVATE LIMITED K L FITNESS OPC PRIVATE LIMITED III FLOOR, BUILDING NO. 1, BEDI GARDEN, JINDAL HOSPITAL ROAD, HISSAR - 125001, HARYANA, INDIA
2641 K L FITNESS OPC PRIVATE LIMITED K L FITNESS OPC PRIVATE LIMITED III FLOOR, BUILDING NO. 1, BEDI GARDEN, JINDAL HOSPITAL ROAD, HISSAR - 125001, HARYANA, INDIA
2642 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
2643 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
2644 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
2645 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
2646 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
2647 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2648 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2649 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
2650 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
2651 KOKAN BHUMI PRATISHTHAN 25 & 26, AJAY SHOPPING CENTRE, T H K MARG, MATUNGA ROAD (WEST), MUMBAI
2652 KOKAN BHUMI PRATISHTHAN 25 & 26, AJAY SHOPPING CENTRE, T H K MARG, MATUNGA ROAD (WEST), MUMBAI
2653 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
2654 KOLKATA VOCATIONAL ACADEMY PULIN AVENUE, P.O- RAJBARI, KOLKATA- 700081
2655 KOMAL CONSTRACTION COMPANY MAIN BAZAR ROAD, DANTA, TEHSIL DANTARAMGARH,DIST. SIKAR RAJSTHAN PIN 332701
2656 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
2657 KORAZON TECHNOLOGIES PRIVATE LIMITED KORAZON TECHNOLOGIES PVT. LTD. IMRAN COMPLEX 1ST FLOOR OPPOSITE WOODLAND RESTAURANT,ULUBARI ,G.S ROAD GWAHATI.
2658 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
2659 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
2660 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
2661 K RAM FOUNDATION 118-C, POCKET-F, PHASE-2, MAYUR VIHAR, DELHI
2662 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
2663 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
2664 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
2665 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2666 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2667 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
2668 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
2669 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
2670 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
2671 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
2672 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
2673 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
2674 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
2675 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
2676 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
2677 KRITI EDIFY PRIVATE LIMITED NAYA TOLA, SARISTABAD, GARDANIBAGH, PATNA.
2678 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
2679 KRUSHI VIKAS PRATISTHAN KH 304, AT/POST BARADPAUNI,THADIPAUNI, TALUKA NARKHED, DISTRICT- NAGPUR, MAHARASHTRA
2680 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
2681 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
2682 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
2683 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
2684 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
2685 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
2686 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
2687 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
2688 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
2689 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
2690 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
2691 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A1/28 JANAK PURI, MAIN NAJAFGARH ROAD, OPPOSITE METRO PILLAR NO. - 626, NEW DELHI - 110058
2692 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28 JANAKPURI, FLAT NO:2, MAIN NAJAFGARH ROAD, NEW DELHI - 110058
2693 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28,JANAKPURI FLAT NO.2,OPPOSITE TO METRO PILLAR NO. 626, NEW DELHI
2694 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28 FLAT NO.2 JANAKPURI NEW DELHI
2695 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
2696 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
2697 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2698 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2699 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
2700 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
2701 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD, PARGANA DIST- SHIVPURI (MP)
2702 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD PARGANA
2703 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD ,PARGANA, DISTT SHIVPURI,
2704 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS POWAI
2705 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS IIT BOMBAY POWAI
2706 LAAN E GOVERNANCE AND EDUCATION PVT LTD 404, 6-3-667/4, SIRIMALLE TOWERS, JAFFAR ALI BAGH, SOMAJIGUDA, HYDERABAD
2707 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2708 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2709 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
2710 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
2711 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
2712 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
2713 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
2714 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
2715 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
2716 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
2717 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
2718 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
2719 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
2720 LAL BAHADUR SHIKSHA SAMITI KATKAR TEHSIL HINDAUN, DIST. KARAULI, RAJSTHAN PINCODE 322234
2721 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
2722 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
2723 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UTTAR PRADESH
2724 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UP, INDIA
2725 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE, 2ND FLOOR, KOLKATA
2726 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE, 2ND FLOOR, KOLKATA
2727 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE 2ND FLOOR
2728 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
2729 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
2730 LATE APPASAHEB SHRAWAN CHINDHU WANI GRAMIN SEVABHAVI SANSTHA DHULE 14 AYODHYA NAGAR ,NEAR MANGALMURTI COLONY ,BEHAND SHREERAM MANDIR,WEST SIDE OF G.T.P STOP DEOPUR DHULE
2731 LATE LALA BARU MAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA
2732 LATE LALA BARUMAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING BAJRANG MARKET SIRSA CHANDIGARH ROAD UKLANA MANDI HISAR
2733 LATELALABARUMALGOYALSOCIALWELFAREEDUCATIONALSOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA-125113
2734 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2735 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2736 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
2737 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
2738 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
2739 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2740 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2741 LBS LNS HBJHCDJNSJBSBCANM
2742 LC EDUCATION SOCIETY 9-A, GALI NO 12, JAWAHAR NAGAR, HISAR - HARYANA
2743 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
2744 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
2745 LC EDUCATION SOCIETY 9-A, GALI NO.12, JAWAHAR NAGAR, HISAR
2746 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
2747 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
2748 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
2749 LEAF TRUST 385/15,JS PLAZA,SAB MAIN ROAD,ATHANI ,ANTHIYUR TALUKA
2750 LEAF TRUST 103A,KARUPPUSAMY KOVIL ST, NALLIGOUNDANPUDUR, KOOTHAMPOONDI POST, ANTHIYUR TALUKA,ERODE DT,TAMILNADU
2751 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
2752 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
2753 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
2754 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
2755 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
2756 LEED SOCIAL WELFARE SOCIETY E-40, MANIPURAM SOCIETY, BITTAN MARKET, BHOPAL.
2757 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
2758 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
2759 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYA NAGAR NEW DELHI
2760 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYANAGAR NEW DELHI 110017
2761 LEMON ELECTRONICS PRIVATE LIMITED M 79, GROUND FLOOR MALVIYA NAGAR NEW DELHI
2762 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYA NAGAR NEW DELHI
2763 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
2764 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
2765 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
2766 LIFE CIRCLE HEALTH SERVICES PRIVATE LIMITED T HUB, IIIT HYDERABAD CAMPUS, GACHIBOWLI
2767 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
2768 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
2769 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
2770 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
2771 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD.
2772 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
2773 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
2774 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
2775 LIGHTNING INDIA FOUNDATION FOR EXCELLENCE GIRDHARI NAGAR, JAROTHI ROAD NEAR BHARAT GAS GODOWN HAPUR UTTAR PRADESH
2776 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
2777 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2778 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2779 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
2780 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
2781 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
2782 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
2783 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
2784 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2785 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2786 LIQUID HOLDINGS PRIVATE LIMITED 217,2ND FLOOR,ANTRIKSH BHAWAN,22 K.G MARG,NEW DELHI-110001
2787 LITCHITREE SKILLS AND SOLUTIONS PVT LTD MIG(S)-1,PRAGATI ENCLAVE,NEAR ST.XAVIAR HIGH SCHOOL,BHUBANESWAR
2788 LITERACY HOUSE ANDHRA MAHILA SABHA LITERACY HOUSE, DDMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
2789 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
2790 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
2791 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
2792 LOGISTICS SECTOR SKILL COUNCIL LOGISTICS SKILL COUNCIL IIT MADRAS RESEARCH PARK, UNIT–E, 10TH FLOOR KANAGAM ROAD, TARAMANI
2793 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
2794 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
2795 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA.
2796 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA
2797 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
2798 LOK SEVA KENDRA VILL - KARPI, KARPI SHERPUR MAIN ROAD, PO.- KARPI, DIST.- ARWAL, BIHAR
2799 LOK SEVA KENDRA VILL KARPI, SHERPUR ROAD,DIST.- ARWAL, BIHAR
2800 LOK SEVA KENDRA VILL - KARPI SHERPUR MAIN ROAD, ARWAL, BIHAR.
2801 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
2802 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
2803 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO-7 NEAR PNB BANK ROADWAYS BUS STAN ROAD ROBERTSGANJ
2804 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO- 7 ARYA NAGAR ROBERTSGANJ SONEBHADRA
2805 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS BUS STAND ROAD ROBERTSGANJ SONEBHADRA
2806 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
2807 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
2808 LORVEN MEDICARE PRIVATE LIMITED H.NO 16/11/D/22 NEAR STATE BANK OF INDIA MOOSARAMBAGH
2809 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
2810 LOVE AND CARE SOCIAL ORGANIZATION FOR DEVELOPMENT 3658, PALPAKURIA ROAD, KAZIPARA, BARASAT,24 PGS (N), KOLKATA -700125, (W.B), INDIA
2811 LOYAL ENVIRONMENTAL AWARENESS AND PROTECTION SOCIETY 115,116,PUDUCHERRY IT PARK, PEC CAMPUS,PILLAICHAVADY,ECR ROAD, PUDUCHERRY -605014
2812 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
2813 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
2814 LTA SCHOOL OF BEAUTY PVT LTD 101/102 PRARTHANA STAR, SAHARA ROAD, ABOVE S MART DEPARTMENTAL STORE, NEAR ANDHERI EAST STATION
2815 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
2816 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
2817 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
2818 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
2819 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
2820 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
2821 LUIT VALLEY ENGINEERING PRIVATE LIMITED H. NO. 51 & 52, M. E. ROAD, BYE LANE 01, PALTAN BAZAR, GUWAHATI 781008 ASSAM, INDIA
2822 LUTHFA FOUNDATION 48B, DR. SUNDARI MOHAN AVENUE, P.S- BENIAPUKUR, KOLKATA
2823 LUTHFA FOUNDATION 48B, DR. SUNDARI MOHAN AVENUE, P.S- BENIAPUKUR, KOLKATA
2824 LUTHFA FOUNDATION LUTHFAA POLYTECHNIC INSTITUTE, P.O: MOLANDIGHI, P.S: KANKSA, DURGAPUR-713212
2825 LUTHFA FOUNDATION LUTHFAA POLYTECHNIC INSTITUTE, P.O: MOLANDIGHI, P.S: KANKSA, DURGAPUR, PASCHIM BURDWAN, WEST BENGAL
2826 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN 164, BRAHMNAGAR COLONY LEHARGIRD SIPRI BAZAR JHANI U.P.
2827 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN MAHARANA PRATAP NAGAR GUMNAWARA PICHHOR ROAD JHANSI
2828 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2829 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2830 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2831 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
2832 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
2833 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2834 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
2835 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2836 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
2837 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
2838 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
2839 MAA PARMBA BHAGAWATI DEVI SEWA SAMITI GRAM JAKHANIA POST JAKHANIA DISTRICT GHAZIPUR UP
2840 MAA PURNAGIRI JAN KALYAN SAMITI H.NO.-3 VANGOAN NITHOLI ROAD (NEAR OM SWEET BHANDHAR) ETAH U.P
2841 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
2842 MAA SARADA KRISHI VIGYAN MANDIR NAZARGANJ,NEAR-3 NO PUMP HOUSE PO-MIDNAPORE
2843 MAA SARASVATI SHIKSHAN SANSTHAN NINDOLA KHEJROLI,TEH-CHOMU,DIST-JAIPUR RAJ
2844 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
2845 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
2846 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
2847 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2848 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2849 MAA UMA ELECTRONIC TRAINING INSTITUTE HIG-102,PUSHPUM APPARTMENT, NEAR BHARAT TALKIES BHOPAL M.P.
2850 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
2851 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
2852 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
2853 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
2854 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
2855 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST CUDDALORE
2856 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST, CUDDALORE.
2857 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
2858 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
2859 MAESTROS TECHNICAL SERVICES PRIVATE LIMITED STPI CAMPUS, GROUND FLOOR, OLD BUILDING ,PATLIPUTRA PATNA
2860 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF EAST STREET, PUNE
2861 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF. EAST STREET, PUNE
2862 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2863 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2864 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
2865 MAGNUM SUPER DISTRIBUTORS INDIA PRIVATE LIMITED KALANIKETAN - I, VAISHALI NAGAR, KOTRA SULTANABAD, BHOPAL
2866 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
2867 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
2868 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
2869 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2870 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2871 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
2872 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2873 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2874 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP BEHLOT BYPASS ROAD INFRONT OF DEHAT THANA GANJ BASODA VIDISHA
2875 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
2876 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
2877 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH HNO 27 WARD NO 02 AWASPARA VILL POST PARSADA TEH JAIJAIPUR DIST JANJGIR CHAMPA
2878 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH VILL POST PARSADA TEH JAIJAIPUR DIST JANJGIR CHAMPA CHHATTISGARH
2879 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH HNO-27,WARD NO 02,AWASPARA VILL-POST PARSADA,TEH-JAIJAIPUR,DIST-JANJGIR CHAMPA CHHATTISGARH
2880 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
2881 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
2882 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY GHAZIABAD, U.P.
2883 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
2884 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
2885 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
2886 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
2887 MAHARASHATRA INDUSTRIAL TRAINING CENTER KOLHAPUR PATIL COMPELX 3RD FOOR, NEAR BHAGYAREKHA TOKIES ICHALKARNJI TAL- HATKANGALE DIST KOLHAPUR
2888 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
2889 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
2890 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
2891 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
2892 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
2893 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2894 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2895 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2896 MAHARASHTRA VYAVSAY PRASHIKSHAN MANDAL 740,'E' WARD, SHAHUPURI 3RD LANE KOLHAPUR 416001
2897 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
2898 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
2899 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
2900 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
2901 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
2902 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
2903 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA NIVAS,SANATHANAM WARD,ALAPPUZHA.
2904 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA ITI BUILDINGS,SANATHANAM WARD,WEST OF YMCA,KERALA,ALAPPUZHA.
2905 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
2906 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2907 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
2908 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2909 MAHAVIR SHIKSHA SAMITI 29 WAZIR CHAND COLONY KARNAL 132001 HARYANA
2910 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, N.H. – 58, DELHI HARIDWAR BYPASS ROAD, MEERUT.
2911 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, NH-58, DELHI HARIDWAR , BYPASS ROAD, MEERUT.
2912 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, N.H. – 58, DELHI HARIDWAR BYPASS ROAD
2913 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, NH-58, DELHI HARIDWAR BYPASS ROAD, MEERUT
2914 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2915 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2916 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
2917 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
2918 MAHENDRANATH EDUCATIONAL AND SOCIAL WELFARE ASSOCIATION VILL+PO-PRATAPDIGHI, PS-PATASHPUR, DIST-PURBA MEDINIPUR
2919 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
2920 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
2921 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2922 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
2923 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2924 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2925 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
2926 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR, NEAR POWER HOSUE ROAD INDRA COLONY BARMER
2927 MAHILA MANDAL BARMER AGOR MAIN CC ROAD, NEAR SAINIK VISHRAM GRAH, INDIRA COLONY
2928 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR NEAR POWER HOUSE ROAD INDRA COLONY
2929 MAHILA MANDAL BARMER AGOR NEAR POWER HOUSE ROAD, INDRA COLONY, BARMER (RAJ)
2930 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR, NEAR NEW POWER HOUSE INDRA COLONY
2931 MAHILA UTTHAN SANSTHAN AHMAD NAGAR NEAR CHANDNA DISTT. BARABANKI
2932 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
2933 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
2934 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
2935 MAHIMA FIBRES PVT LTD 406, CORPORATE HOUSE, 4TH FLOOR 169 R.N.T. MARG INDORE MP
2936 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
2937 MAHISHADAL RAJ COLLEGE NAAC ACCREDITED GRADE A COLLEGE MAHISHADAL RAJ COLLEGE, POST OFFICE: MAHISHADAL, DISTRICT: PURBAMEDINIPUR, PIN: 721628, WEST BENGAL.
2938 MAHNAR FAL SDABZI MAHNAR MAHNAR VAISHALI
2939 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
2940 MAHOBIA COMPUTER INSTITUTE SOCIETY GYAN TARANG PARISAR, BALOD ROAD, HALDI, RAJNANDGAON, C.G.
2941 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
2942 MAITREYEE SHIKSHAN SANSTHAN VPO-RAYAN BADI,TEH-RIYAN BADI, DIST-NAGAUR RAJASTHAN
2943 MALABAR AGGREGATES PRIVATE LIMITED MALABAR AGGREGATES PRIVATE LIMITED, OZHKUR, KONDOTTY, MALAPPURAM DT., KERALA.
2944 MALABAR EDUCATIONAL SOCIETY MALABAR EDUCATIONAL SOCIETY OPP.GRIFI SUPER MARKET EDODI VATAKARA KOZHIKODE KERALA 673101
2945 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
2946 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
2947 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
2948 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
2949 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
2950 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2951 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2952 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
2953 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2954 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
2955 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2956 MAMTA PARADISE PRIVATE LIMITED BHAGWATI NAGAR NIWARU ROAD JHOTWARA JAIPUR
2957 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
2958 MANAH GRAMIN EVAM SAMAJ SEVA SAMITI NEAR JANPAD PANCHYAT BORODIPA PUSSORE
2959 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
2960 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2961 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2962 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
2963 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
2964 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
2965 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
2966 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2967 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2968 MANAV MITRA HOUSE NO-287 SAMTA COLONY RAIPUR C.G.
2969 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
2970 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
2971 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
2972 MANAV VIKAS SEWA SANGH 1 SUDAMA PARK GAS RAHAT WORKSHED GOVIND GARDEN BHOPAL
2973 MANBHAWAN KALYAN SAMITI B-2/144, ASHIYANA PHASE-II, KANTH ROAD MORADABAD
2974 MANBHAWAN KALYAN SAMITI B-2/144, ASHIYANA PHASE-II, KANTH ROAD, MORADABAD
2975 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
2976 MANGAL JAN KALYAN SAMITI AGRASEN WARD NO.-8 PO-LORMI DISTT-MUNGELI MO.-9893452562
2977 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
2978 MANI ADRS
2979 MANI KASHYAP ADRS XYZ
2980 MANI KASHYAP ADDRESS LINE 1
2981 MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, UDAYAVANI ROAD, MANIPAL
2982 MANIPAL MEDIA NETWORK LIMITED MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, TILE FACTORY ROAD, UDAYAVANI ROAD, MANIPAL
2983 MAN MANAGEMENT SERVICES PERVITED LIMITED MAN MANAGEMENT SERVICES PVT. LTD.,PLOT NO-4,SECTOR NO.6,SANPADA, NAVI MUMBAI,MAHARASHTRA.
2984 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
2985 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
2986 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
2987 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
2988 MANNAT ADD LINE 2
2989 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V-EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2990 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V - EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2991 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
2992 MANSOORI ACADEMY MOHAMMADI SARAY NEAR HAJI JI KI DARGAH, AMROHA-244221 DIST- AMROHA U.P.
2993 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
2994 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
2995 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
2996 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
2997 MANUH GLOBAL TECHNOLOGIES PRIVATE LIMITED 49-28-13 MADHURANAGAR VISAKHAPATNAM
2998 MANUMATA BAHUUDDESHIYA SANSTHA JALGAON 10, SAMARTH COLONY, ABOVE UNION BANK ATM, MJ COLLEGE ROAD, JALGAON DIST. JALGAON - 425001
2999 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
3000 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
3001 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
3002 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
3003 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
3004 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
3005 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
3006 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
3007 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
3008 MARG DARSHAN MANAV SEWA SANSTHAN TEACHER COLONY SALEMPUR DEORIA
3009 MARG DARSHAN MANAV SEWA SANSTHAN WARD NO 7 SUGAHI TEACHER COLONY SALEMPUR
3010 MARIAN COLLEGE KUTTIKKANAM AUTONOMOUS PRINCIPAL MARIAN COLLEGE KUTTIKKANAM (AUTONOMOUS) KUTTIKKANAM (PO) PEERMADE IDUKKI (DIST) KERALA STATE
3011 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
3012 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
3013 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
3014 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
3015 MARUDHAR EDUCATION SOCIETY MARUDHAR CAMPUS, NH-11, JAIPUR ROAD, RAISAR, BIKANER
3016 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
3017 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
3018 MARUTI SUZUKI INDIA LIMITED MARUTI SUZUKI TRAINING ACDEMY, MARUTI SUZUKI INDIA LIMITED,PALAM GURGAON ROAD, GURGAON
3019 MA SARBAMANGALA SOCIETY FOR CULTURAL AND EDUCATION PANAGARH, P.O- PANAGARH BAZAR,DIST:- BURDWAN, PIN-713148 ,
3020 MA SARBAMANGALA SOCIETY FOR CULTURAL AND EDUCATION PANAGARH,P.O-PANAGARH BAZAR,DIST:-PASCHIM BARDHAMAN
3021 MAS CALLNET INDIA PRIVATE LIMITED A-94/10 SECTOR-58 NOIDA
3022 MASK MAGIC REGD OFFICE H.NO. F-1/172 SUNDARNAGARI, NANDNAGARI DELHI N.E 110093 ADMIN OFFICE. H.NO. D-27 SHASTRINAGAR GHAZIABAD 201002 UP
3023 MAS SHIKSHAN PRASHIKSHAN SEWA SANSTHAN PLOT NO 15,16,17 MINI INDUSTRIAL ESTATE TENDUAI KALAN AMBEDKAR NAGAR
3024 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
3025 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
3026 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
3027 MASTER MINDS SOLUTIONS 2ND FLOOR, 17-1-383/95, VIJAYANAGAR COLONY ,HYDRABAD(SOUTH)
3028 MASTER MINDS SOLUTIONS P.NO:14,GANDI REDDY COLONY,BADANGPET,RANGAREDDY-500058
3029 MASTER MINDS SOLUTIONS 2ND FLOOR, 17-1-383/95, VIJAYANAGAR COLONY, HYDRABAD (SOUTH)
3030 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
3031 MATA KITAB KAUR MEMORIAL WELFARE SOCIETY OPPOSITE ITI,SURATGHAR ROAD, HANUMANGHAR JN. RAJSTHAN
3032 MATHA EDUCATIONAL SOCIETY MATHA EDUCATIONAL SOCIETY #12-21-13/1, BESIDE FIRE STATION NEAR GOKAVARAM BUS STAND, ARYAPURAM RAJAHMUNDRY
3033 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
3034 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
3035 MATHAN KANCHANA CHARITABLE TRUST NO 151, POTHIKULAM VILLAGE,KADALADI TALUK,RAMANATHAPURAM DISTRICT.
3036 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITI SUNHERA ROAD SABALGARH MORENA M.P.
3037 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITTI 224,NIMBAJI KI KHO NEAR MATA MANDIR JIWAJI GNJ LASHKAR GWALIOR
3038 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KLAYAN SAMITI 224,NIMBAJI KI KHO LASHKAR GWALIOR
3039 MATOSHRI PRATISHTHAN NANDED MATOSHRI PRATISHTHAN GROUP OF INSTITUTIONS, JIJAU NAGAR, OFF LATUR NANDED HIGHWAY, KHUPSARWADI, POST VISHNUPURI, NANDED- 431606 (MS).
3040 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
3041 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
3042 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
3043 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
3044 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVNI NAGAR PAITHAN TQ.PAITHAN DIST.AURANGABAD
3045 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVANI NAGAR PAITHAN TQ. PAITHAN DIST.AURANGBAD
3046 MAULANA HUSSAIN AHMAD MADANI CHERITABLE TRUST SECRETARY,MAULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST,QUASIMPURA ROAD, DEOBAND, SAHARANPUR DIST.
3047 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
3048 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
3049 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
3050 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
3051 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
3052 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
3053 MAYATECH SOLUTIONS PRIVATE LIMITED A-1/8, SUMIT COMPLEX, VIBHUTI KHAND, GOMTINAGAR, LUCKNOW, UTTAR PRADESH
3054 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
3055 MAYOCARE HEALTH PRIVATE LIMITED 538, IST FLOOR, TRANSPORT NAGAR, NEAR DHARMVEER MURTI,IN FRONT OF MUNDERA MANDI, ALLAHABAD
3056 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
3057 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
3058 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
3059 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
3060 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
3061 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
3062 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
3063 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
3064 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
3065 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
3066 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET
3067 MEDIWORLD EDUCATIONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEW DELHI
3068 MEDIWORLD EDUCATIOONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEAR FATHER AGNEL SCHOOL
3069 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
3070 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
3071 MEERA INSTITUTE OF TECHNOLOGY AND MANAGEMENT PRIVATE LIMITED 538/5-C, BANKERS COLONY JHANSI
3072 MEERA PROFESSIONAL EDUCATIONAL AND WELFARE SOCIETY FAZILKA ROAD, ABOHAR(PB)
3073 MEERA PROFESSIONAL EDUCATIONAL AND WELFARE SOCIETY FAZILKA ROAD, ABOHAR (PB.)
3074 MEERA SAHIB EDUCATIONAL WELFARE SOCIETY 64/19, VEER NAGAR, MANSA
3075 MEERA SAHIB EDUCATIONAL WELFARE SOCIETY MEERA SAHIB EDUCATIONAL WELFARE SOCIETY, ELECTRA INSTITUTE, VEER NAGAR, MANSA
3076 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
3077 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
3078 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
3079 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
3080 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
3081 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
3082 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
3083 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
3084 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
3085 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
3086 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
3087 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
3088 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
3089 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
3090 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
3091 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
3092 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
3093 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159 5TH. FLOOR INDUSTRY HOUSE H.T. PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
3094 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159, 5TH. FLOOR INDUSTRY HOUSE H.T.PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
3095 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
3096 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
3097 MER PEDAGOGY PVT LTD NO 289, TTK ROAD, MANICKAM AVENUE, ALWARPET, CHENNAI
3098 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
3099 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
3100 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
3101 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
3102 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
3103 METORES ISPAT PRIVATE LIMITED METORES ISPAT PRIVATE LIMITED, O-12, CIVIL TOWNSHIP, ROURKELA ORISSIA
3104 METROBIT NETWORKS PRIVATE LIMITED #6 - 8, GOKUL COMPLEX, NEAR SANKALP RESTURANT, GURUKUL, DRIVE IN ROAD, AHMEDABAD
3105 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
3106 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI,BEHIND HOTEL MAAN,GULAB BAGH ROAD, UDAIPUR
3107 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI BEHIND HOTEL MAAN , GULAB BAGH ROAD, UDAIPUR
3108 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
3109 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
3110 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
3111 M G CHARITABLE TRUST EAST POINT CAMPUS JNANA PRABHA VIRGO NAGAR POST BANGALORE
3112 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
3113 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
3114 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
3115 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA
3116 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA 560004 IN
3117 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
3118 MIDNAPUR UNIQUE EDUCARE EDUCATIION WELFARE SOCIETY VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
3119 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
3120 MIGS EDUCTECH PRIVATE LIMITED A-86, DDA SHED, OKHLA INDUSTRIAL AREA, PHASE-2, NEW DELHI
3121 MILAT FOUNDATION BEEHAMA GANDERBAL
3122 MILE MULTIMURPOSE FOUNDATION WARDHA
3123 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
3124 MILKY FASHION CLOTHES PRIVATE LIMITED B-68, CHANAKYA PLACE, JANAKPURI, DELHI
3125 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
3126 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
3127 M INDIA VIKASH SAMITI PLOT NO–C\11, CENTRE MARKET, SECTOR-12A, BOKARO STEEL CITY, JHARKHAND
3128 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
3129 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
3130 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
3131 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
3132 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
3133 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
3134 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
3135 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
3136 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
3137 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
3138 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
3139 MISAWITE TECHNOLOGIES PRIVATE LIMITED I-701, I BLOCK GOVINDPURAM
3140 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
3141 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
3142 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
3143 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
3144 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
3145 MITRA HOLISTIC HELTH SOCIETY #39/601-2,PATEL ROAD,ARAVIND NAGAR,KADAPA-516001
3146 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
3147 MITR PROMOTERS PRIVATE LIMITED 139,NOBEL ENCLAVE,SECTOR-22,BEHIND ROTARY PUBLIC SCHOOL,GURGAON,HARYANA-122001.
3148 MITTAL WELFARE SOCIETY CHATTISGARH 2ND FLOOR OF UNION BANK GOURI SHANKAR MANDIR(GSM) ROAD,SUNDAY MARKET RAIGARH
3149 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
3150 MMCC SKILL FOUNDAION S.C.O-192,195 SECTOR-16
3151 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
3152 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
3153 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
3154 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
3155 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
3156 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
3157 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
3158 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
3159 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
3160 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
3161 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
3162 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
3163 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
3164 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
3165 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
3166 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
3167 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
3168 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
3169 MOHAMMADIA EDUCATIONAL AND WELFARE SOCIETY CHAND COLONY, POST PHULWARI SHARIF, DIST PATNA BIHAR 801505
3170 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
3171 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
3172 MONDAL CONSTRUCTION COMPANY LIMITED UTTARAYAN STATION ROAD CHINSURAH R.S. HOOGHLY, WEST BENGAL
3173 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
3174 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
3175 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D,3RD BLCOK,3RD STAGE, BASAVESHWAR NAGAR, BANGALORE
3176 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
3177 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
3178 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
3179 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D, 3RD BLOCK, 3RD STAGE, BASAVESHWARA NAGAR, BANGALORE.
3180 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D, 3RD BLOCK, 3RD STAGE, BASAVESHWARA NAGAR,BANGALORE
3181 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST REGD P O MOODLAKATTE KUNDAPURA TALUK UDUPI DISTRICT KARNATAKA
3182 MORD TEST ND
3183 MORD TEST1 SBJFLJ
3184 MORD TEST2 ADVCDS
3185 MORD TEST NEW DELHI ND
3186 MOREPEN LABORATRIES LIMITED 4TH FLOOR ANTRIKSH BHAWAN,22 K.G. MARG BARAKHAMBA ROAD NEW DELHI
3187 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
3188 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
3189 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
3190 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
3191 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
3192 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
3193 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
3194 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
3195 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
3196 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
3197 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
3198 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
3199 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
3200 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
3201 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3202 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST SECRETARY, MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD DEOBAND, SAHARANPUR DIST UP
3203 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3204 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST SECRETARY, MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST,QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3205 MOUNT EVEREST BREWERIES LIMITED 106A SHYAM BAZAR STREET 1ST FLOOR KOLKATA WEST BENGAL 700005
3206 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
3207 MOZAVI TECHNOLOGIES PVT LTD 26-27, MADHAVHILL NEAR TAKHTESHWAR TEMPLE,BHAVNAGAR-364001
3208 MOZAVI TECHNOLOGIES PVT LTD MOZAVI TECHNOLOGIES PVT LTD 26-27 MADHAVHILL NEAR TAKHTESHWAR TEMPLE WAGHAVADI ROAD BHAVNAGAR
3209 MPB CONSTRUCTION PRIVATE LIMITED KAMLA BHAWAN, 138 ADARSH VIHAR, JOOHAMAL SCHOOL ROAD, SAINIK COLONY, BYE PASS, JAMMU (J&K)
3210 MPB CONSTRUCTION PRIVATE LIMITED KAMLA BHAWAN, 138 ADARSH VIHAR, JODHAMAL SCHOOL ROAD, SAINIK COLONY, BYPASS, JAMMU (J&K)
3211 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
3212 MS IMAGINE INSTITUTE OF FELLOWSHIP AND LEARNING IIFL 57 AADARSH COLONY NEAR MAAN PETROL PUMP MUZAFFAR NAGAR
3213 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3214 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
3215 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
3216 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
3217 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3218 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3219 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
3220 MS POPULAR AGENCIES 60 B/69B, HEWETT ROAD, ALLAHABAD
3221 MS RAJ ASSOCIATES B1/181, VINEET KHAND, GOMTINAGAR, LUCKNOW (U.P.)
3222 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R K COMPLEX , OPP ARRS SLIKS , HOSUR KRISHNAGIRI , TAMIL NADU 635109. CELL : 9442372741.
3223 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
3224 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
3225 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
3226 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
3227 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
3228 MUKTAI SHIKSHAN PRASARAK MANDAL PULUJWADI TAL-PANDHARPUR DIST-SOLAPUR
3229 MUKTI INDIA FOUNDATION A-105,FIRST FLOOR, ABOVE BANK OF INDIA , OPP. PILLOR NO 749, UTTAM NAGAR
3230 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
3231 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
3232 MUSKAN D-6/54, THIRD FLOOR, SECTOR-6 ROHINI, DELHI-110085
3233 MUSKAN D-6/54, THIRD FLOOR, SECTOR-6 ROHINI, DELHI
3234 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
3235 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
3236 MVIGYAN CONSULTING PRIVATE LIMITED 137-E,PKT,KONDLI,GHAROLI,MAYUR VIHAR, PHASE-III, DELHI
3237 MVIGYAN CONSULTING PRIVATE LIMITED NO-137-E, PKT-A2, KONDLI, GHAROLI MAYUR VIHAR PH-III DELHI DL 110096
3238 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
3239 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
3240 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
3241 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
3242 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
3243 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
3244 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
3245 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
3246 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
3247 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
3248 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
3249 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
3250 NALANDA BAHU UDDESHIYA SHIKSHAN SANSTHA GEWARDHA AT POST GEWARDHA TAH KURKHEDA DISTRICT GADCHIROLI
3251 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
3252 NALANDA EDUCATION AND RESEARCH CHARITABLE TRUST C/O - SG INSTITUTE OF SYSTEMATIC EDUCATION VILLAGE + P.O. - MURGAWAN,
3253 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
3254 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
3255 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
3256 NANAK SINGH RAWAT SHIKSHA SAMITI C-232, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
3257 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR. MHOW, TEHSIL MHOW DISTT. - INDORE
3258 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
3259 NANAK SINGH RAWAT SHIKSHA SAMITI C-2252, JAWAHAR NAGAR MHOW, TEHSIL MHOW DISTT. INDURE (M.P.)
3260 NANAK SINGH RAWAT SHIKSHA SAMITI C-252,JAWAHAR NAGAR,MHOW,TEHSIL-MHOW,DISTT. INDORE
3261 NANDAN DENIM LIMITED SURVEY NO 198/1 203/2 SAIJPUR GOPALPUR,PIRANA ROAD,PIPLAJ,AHMEDABAD
3262 NANDAN DENIM LIMITED SURVEY NO.198/1 & 203/2,SAIJPUR,GOPALPUR PIRANA ROAD,PIPLAJ,AHMEDABAD,GUJARAT
3263 NANDI SHIKSHA AWAM SAMAJIK SANSTHAN BRAHMPURI COLONY,DEOBAND SAHARANPUR
3264 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
3265 NARASHINGAPUR NIBEDITA EDUCATIONAL SOCIETY AND SOCIAL WELFARE NARASHINGAPUR, SAGARPARA, JALANGI, MURSHIDABAD, 742306
3266 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
3267 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
3268 NARAYAN EDUCATIONAL SOCEITY FIRST FLOOR DESIGN COMPLEX, IN FRONT OF BDA COMPLEX,PILIBHIT ROAD BAREILLY, UP INDIA-243001
3269 NARAYAN INSTITUTE OF COMPUTER SCIENCE 885, VINOD NAGAR, COURT ROAD, NEAR BANK OF INDIA
3270 NARAYAN INSTITUTE OF COMPUTER SCIENCE 885, VINOD NAGAR, COURT ROAD, NEAR BANK OF INDIA, ETAWAH, UTTAR PRADESH
3271 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
3272 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
3273 NARAYAN TRAINING SERVICES NO 546 OPP RUCHI GARDENS ,B H ROAD PRASHANTHNAGAR,NAGAPPA BLOCK , GOWRIBIDANUR,CHIKKABALAPUR DISTRICT , KARNATAKA
3274 NARAYAN TRAINING SERVICES NO 546,OPP RUCHI GARDENS, BH ROAD , PRASHANTHNAGAR, NAGAPPA BLOCK , GOWRIBIDANUR , CHIKKABALLAPUR DISTRICT ,KARNATAKA - 561208
3275 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
3276 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
3277 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
3278 NARPAVAI EDUCATIONAL AND CHARITABLE TRUST NO 1-75, CHEKKADI STREET, KEELA KADAYAM, KADAYAM- 627415. TIRUNELVELI - TAMILNADU
3279 NARPAVAI EDUCATIONAL AND CHARITABLE TRUST NO 1/75, CHEKKADI STREET, KEELA KADAYAM, KADAYAM. TIRUNELVELI DIST
3280 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
3281 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
3282 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
3283 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION 28/1, D.L.ROY ROAD, BOWBAZAR,KRISHNAGAR,NADIA
3284 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION D.L.ROY ROAD, BOWBAZAR, PO-KRISHNAGAR, PS-KOTWALI, DIST-NADIA, WEST BENGAL
3285 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION 28/1, D.L.ROY ROAD, BOWBAZAR,KRISHNAGAR, NADIA,WEST BENGAL
3286 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
3287 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
3288 NATIONAL COUNCIL FOR CHURCH AND SOCIAL ACTION INDIA GEORGE AVENUE, SRCCE CAMPUS, A-CAMP, KURNOOL – 518004
3289 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
3290 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
3291 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
3292 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
3293 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
3294 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION KP ROAD ANANTNAG KASHMIR 192101
3295 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION ANANTNAG NEAR MART INFOTECH COLLEGE ANANTNAG
3296 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION C/O MART INFOTECH COLLEGE ANANTNAG NEAR BUS STAND ANANTNAG
3297 NATIONAL EDUCATION AND WALFARE SOCIETY DEGLOOR NEAR BSNL TOWER,TEACHER COLONY,UDGIR ROAD,DEGLOOR DIST.NANDED
3298 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3299 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3300 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3301 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
3302 NATIONAL EDUCATION SOCIETY 3RD FLOOR CITY CENTER TOWER KRISHNA NAGAR
3303 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
3304 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
3305 NATIONAL HUMAN RURAL DEVELOPMENT INSTITUTE NHRDI AT/PO-BALIPATNA, VIA-BHUBANESWAR, DIST-KHURDA, ORISSA, [INDIA]
3306 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
3307 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
3308 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
3309 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
3310 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
3311 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
3312 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY AKAMPAT, IMPHAL EAST
3313 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
3314 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
3315 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
3316 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
3317 NATIONAL INSTIUTE OF LIFE SKILLS 76-18-63, GONGRESS OFFICE ROAD, GOVERNORPET, VIJAYAWADA
3318 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
3319 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
3320 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
3321 NATIONAL PARAMEDICAL SCIENCES SOCIETY CHAUDHARY COLONY,GOVT COLLEGE ROAD,INDRI,DISTT- KARNAL
3322 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
3323 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
3324 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
3325 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
3326 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
3327 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
3328 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
3329 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
3330 NATIONAL WOMEN DEVELOPMENT TRUST 53 GRAMMASAVADI STREET CUMBUM
3331 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
3332 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
3333 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
3334 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
3335 NATURAL AGROTECH RESEARCH AND PROCESSING SERVICE BLOCK 5 DIC/LBI OPP TUIBONG POST OFFICE
3336 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO,66 B SENGALUNEARODAI STREET, KANCHIPURAM - 631502, TAMIL NADU
3337 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
3338 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
3339 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
3340 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
3341 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
3342 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
3343 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
3344 NAVACHETHANA MALLAPPALLY INSTITUTE
3345 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
3346 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
3347 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3348 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3349 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3350 NAV BHARAT FOUNDATION 3852/9, 2ND FLOOR, KANHAIYA NAGAR, DELHI
3351 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
3352 NAVIGATION EDUCATIONAL AND WELFARE SOCIETY WARD 4 BARTHARA ROAD KHOJAWARE WALA KUWAN KE PASS GOHAD DISTT- BHIND MP
3353 NAV JAGRAN YUVA MANCH VILL+PO-LAUKAHA NEAR BSNL TOWER BLOCK-KHUTAUNA DIST-MADHUBANI BIHAR-847421
3354 NAV JAGRAN YUVA MANCH VILL+PO:-LAUKAHA NEAR BSNL TOWER,BLOCK-KHUTAUNA DIST-MADHUBANI BIHAR -847421
3355 NAV JAGRAN YUVA MANCH VILL+PO-LAUKAHA NEAR BSNL TOWER, BLOCK -KHUTAUNA DIST -MADHUBANI BIHAR-847421
3356 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
3357 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
3358 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
3359 NAV JYOTI WEFARE SOCIETY MESAUDHA,WARD NO.-10,PIPRAHI
3360 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
3361 NAVKAR EDUCATION TRUST NAVKAR PLOT NO.634/9/A, OPP. VASUNDHARA BUS STOP, GULBAI TEKRA, AHMEDABAD, GUJARAT
3362 NAVKAR EDUCATION TRUST NAVKAR PLOT NO. 634/9/A, OPP. VASUNDHARA BUS STOP, GULBAI TEKRA, AHMEDABAD, GUJARAT INDIA
3363 NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE, GADHINGLAJ TAL GADHINGLAJ
3364 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
3365 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
3366 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
3367 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
3368 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
3369 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3370 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3371 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3372 NAVRAJ EDUCATIONAL SOCIETY B-19, RIYAL RESIDENCY, NEAR SHAHPURA THANA, GULMOHAR, BHOPAL
3373 NAVRAJ EDUCATIONAL SOCIETY C-1, SAHYOG PARISAR, GULMOHAR COLONY. TRILANGA, BHOPAL 462039
3374 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
3375 NAV SAHYADRI EDUCATION SOCIETY NAV SAHYADRI EDUCATION SOCIETY, 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3376 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
3377 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
3378 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
3379 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3380 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3381 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS AZAD NAGAR DIGHA BAGICHA DIGHAT GHAT PATNA
3382 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS AZAD NAGAR DIGHA BAGICHA DIGHT GHAT PATNA BIHAR
3383 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS , AZAD NAGAR DIGHA BAGICHA PATNA
3384 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS , AZAD NAGAR DIGHA BAGICHA PATNA
3385 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
3386 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
3387 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
3388 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3389 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3390 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
3391 NCFT EDUCATIONS PRIVATE LIMITED 122 A/2 IIND FLOOR, OPP.VAIKALPALAM BUS STOP TRIVANDRUM ROAD, PALAYAMKOTTAI, TIRUNELVELI DIST, TAMILNADU.
3392 NCFT EDUCATIONS PRIVATE LIMITED 122 A/2 IIND FLOOR, OPP.VAIKALPALAM BUS STOP, TRIVANDRUM ROAD, PALAYAMKOTTAI, TIRUNELVELI DIST. TAMIL NADU.
3393 NCLM SHIKSHAN SANSTHAN 546, KHALSI LINE KYDGANJ ALLAHABAD
3394 NCLM SHIKSHAN SANSTHAN 546 K.L KYDGANJ BANK OF BARODA BUILDING ALLAHBAD UTTAR PRADESH
3395 NDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -30203
3396 N D MEMORIAL SHIKSHAN SANSTHAN SANTI NAGAR NIMBOL ROAD JAITARAN
3397 N D MEMORIAL SHIKSHAN SANSTHAN JAITARAN SANTI NAGAR NIMBOL ROAD JAITARAN
3398 N D MEMORIAL SHIKSHAN SANSTHAN JAITARAN SANTI NAGAR NIMBOL ROAD JAITARAN
3399 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
3400 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
3401 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD, AGRA
3402 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD
3403 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
3404 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
3405 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
3406 NEHRU MAHILA MANADAL GOVIND BHAWAN KHAJURI SADAK KHAJURI
3407 NEHRU MAHILA MANDAL GOVIND BHAWAN KHAJURI SADAK BHOPAL
3408 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
3409 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
3410 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
3411 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
3412 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
3413 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
3414 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
3415 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
3416 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
3417 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
3418 NERAVU FOUNDATION 6/1, 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET,KUMARA PARK WEST, SHESHADRIPURAM, BLORE- 560020
3419 NEST NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3420 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
3421 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
3422 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
3423 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
3424 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
3425 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
3426 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3427 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3428 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
3429 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
3430 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
3431 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
3432 NEW ERA EDUCATION DEVELOPMENT SOCIETY CO TARA INFOTECH NEAR PS BANK MALL GODOWN ROAD RAMPURA PHUL
3433 NEW ERA EDUCATION DEVELOPMENT SOCIETY NEED TARA INFOTECH NEAR PS BANK RAMPURA PHUL
3434 NEWERA SKILLS LLP E 607 TITANIUM CITY CENTRE 100 FT RING ROAD SATELLITE AHMEDABAD
3435 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3436 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
3437 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
3438 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3439 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3440 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3441 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3442 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3443 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3444 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3445 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3446 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
3447 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
3448 NEW LBS SANSTHAN ZERO MILE CHORAHA , PRATAPGARH
3449 NEW LBS SANSTHAN PRATAPGARH ZERO MILE CHOURAHA , PRATAPGARH , RAJASTHAN
3450 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
3451 NEW MOON RUPASHPUR, KAMALPUR, DHALAI KAMALPUR
3452 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
3453 NEW SIMBOL TAKNIKI PRASHIKSHAN SANSTHAN CIVIL LINE KATNI
3454 NEW SWIFT EDUCATION AND EMPLOYMENT CONSULTANCY PRIVATE LIMITED 29/238 KHALSHA CHAMBERS BEAWAR RAOD AJMER
3455 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
3456 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3457 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3458 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3459 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
3460 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
3461 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
3462 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3463 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
3464 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3465 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
3466 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
3467 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3468 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3469 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3470 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
3471 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
3472 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3473 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3474 NEXT STEP LOGISTICS MANAGEMENT PVT LTD NO 14, 1ST FLOOR, SAI NIVAS, 5TH CROSS, 1ST BLOCK, AKSHAYA NAGAR, RAMMURTHY NAGAR EXTN, BANGALORE
3475 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
3476 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
3477 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
3478 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
3479 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
3480 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
3481 NIELIT IMPHAL NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY (NIELIT) IMPHAL AKAMPAT P.O BOX 104, IMPHAL, MANIPUR 795001
3482 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
3483 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
3484 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
3485 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
3486 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
3487 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3488 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3489 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3490 NILAGIRI INSTITUTE OF HOTEL MANAGEMENT AND CATERING TECHNOLOGY INDUSTRIAL SCHOOL 12-687H NEAR JUDICIAL MAGISTRATE COURT MYSORE ROAD GUDALUR THE NILGIRIS TAMILNADU
3491 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
3492 NILANCHAL CHEMICAL AND FERTILIZERS LIMITED C/O RAM RADHIKA MAHAVIDHYALAY GRAM : - CHATIYA POST :- MEHRUNA LAR , SALEMPUR
3493 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
3494 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
3495 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
3496 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
3497 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
3498 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
3499 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
3500 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
3501 NIRBAL VARG SWASTHYA KALYAN SAMITI 448 WAZIDPUR SOUTH JAUNPUR 222002 UP
3502 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
3503 NIRMALA MAHILA SHILP KALA KENDRA ADARSH NAGAR SECT-1 LAKHIMPUR PUR ROAD SITAPUR
3504 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA AHMEDABAD
3505 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA, AHMEDABAD-
3506 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
3507 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
3508 NISHKAM SEWA SANSTHAN NEAR 101 NO. RAILWAY GETA, MERTA ROAD TAHSIL MERTA CITY DISTRICT NAGAUR
3509 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, PO - SOUTH SINTHEE, PS - SINTHI,
3510 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, P.S.- SINTHI, P.O.- SOUTH SINTHEE, KOLKATA
3511 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
3512 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
3513 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
3514 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3515 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3516 NITEOIT SOLUTIONS PVT LTD HYDERABAD: PLOT NO 6, H NO 1-66/4/6, KAVURI HILLS, MADHAPUR, HYDERABAD BANGALORE: NITEOIT, #118, 2ND FLOOR, HORAMAVU CROSS, BANASWADI RING ROAD, BANGALORE – 560043
3517 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
3518 NITYANANDA E LEARNING PVT LTD BLOCK NO. 5/6, MAHATMA PHULE COMPLEX, SHIVAJI CHOWK, VADUJ-415506
3519 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3520 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
3521 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
3522 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
3523 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3524 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
3525 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
3526 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 2O/1 SITALA MATA LANE GROUND FLOOR FLAT NO AS6
3527 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SITALA MATA LANE, P.S. BARANAGAR, KOLKATA-90
3528 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SHITALA MATA LANE GROUND FLOOR, FLAT NO- AS 6
3529 NOBAL ORGANIZATION OF ZEST YIELDING NOZY SOCIETY 1. D-56, SHANTI NAGAR KHTI PURA, JAIPUR, RAJ. 302006 2. SIS SCHOOL CAMPUS, RIDHI SIDHI PULIYA, SHIPRA PATH, MANSAROVAR, JAIPUR, RAJ 302020
3530 NOBAL ORGANIZATION OF ZEST YIELDING NOZY SOCIETY 1. D-56, SHANTI NAGAR, KHATI PURA ROAD, JAIPUR- 302006 2. SIS SCHOOL CAMPUS, RIDHI SHIDHI PULIYA, SHIPRA PATH, MANSAROVAR, JAIPUR - 302020
3531 NOBEL ORGANIZATION OF ZEST YIELDING SOCIETY SIS SCHOOL CAMPUS, RIDHI SIDHI PULIA, SHIPRA PATH, MANSAROVAR,JAIPUR
3532 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
3533 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
3534 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
3535 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
3536 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
3537 NOBLE MUSLIM MINORTIY EDUCATIONAL AND WELFARE SOCIETY YUNUS COLONY,AURANGABAD, 431001
3538 NO EDUCATION RAVINDRA NAGAR RAIPUR
3539 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
3540 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
3541 NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION REGISTERED OFFICE ADDRESS:2ND FLOOR,NEW MARKET,ITI COMPLEX,KAMLABARI ROAD,16 NO TINIALI,DULIAJAN,DIBRUGARH,ASSAM,PIN:786602 CAMPUS ADDRESS:NALAPARA,NEW VIP,SARUSAJAI,LOKHARA,GUWAHATI,ASSAM,PIN:781040
3542 NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION CAMPUS:NALAPARA,NEW VIP,LOKHRA,GHY-781040 REGISTERED OFFICE:16NO TINIALI,ABOVE ALLAHABAD BANK,KAMALABARI ROAD,DULIAJAN-786602,DIBRUGARH,ASSAM
3543 NORTH EAST INSTITUTE FASHION TECHNOLOGY NEIFT,SECOND FLOOR,(NEXT TO SBI EVENING BRANCH) G.N.B. ROAD,GUWAHATI
3544 NORTH EAST INSTITUTE OF PROFESSIONAL STUDIES C/O NEIPS, IB ROAD, UPPER NEW NONGSTOIN, WEST KHASI HILLS DISTRICT
3545 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
3546 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
3547 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
3548 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
3549 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
3550 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
3551 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
3552 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
3553 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
3554 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
3555 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
3556 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
3557 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
3558 NRLM SKILLS SAMRAT,CHANKYAPURI
3559 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
3560 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
3561 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
3562 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3563 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3564 NST ACADEMY REGD OFFICE : NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3565 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
3566 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3567 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3568 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3569 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
3570 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3571 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3572 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
3573 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
3574 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
3575 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3576 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3577 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
3578 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
3579 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
3580 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
3581 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
3582 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
3583 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
3584 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
3585 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
3586 ODISA TECHNICAL AND MANAGEMENT EDUCATIONAL SOCIETY SHREE LAXMI NIVAS , LAXMINAGAR , BABUA BAGICH , COX COLONY , PO INDUSTRIAL ESTATE , JHARSUGUDA DIST JHARSUGUDA ORRISA
3587 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3588 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3589 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3590 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
3591 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
3592 OLIRUM INDIA TRUST A1143, THAMARAI NAGAR, TIRUVANNAMALAI
3593 OLIRUM INDIA TRUST A1143, IISTREET, THAMARAI NAGAR, TIRUVANNAMALAI
3594 OLIRUM INDIA TRUST NO.175, VALLUVAR STREET, CHINNAKALLAPADI VILLAGE AND POST TIRUVANNAMALAI
3595 OLIRUM INDIA TRUST NO.175, VALLUVAR STREET, CHINNAKALLAPADI VILLAGE AND POST, TIRUVANNAMALAI
3596 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
3597 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
3598 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
3599 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
3600 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
3601 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
3602 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
3603 OMKARESHWAR CONSULTING AND OUTSOURCING SERVICES PRIVATE LIMITED 58 ELDECO GREENS GOMTI NAGAR UTTAR PRADESH LUCKNOW
3604 OM SAI CONTRUCTION OM SAI CONSTRUCTION 61/2 MAHAVEER CHOWK NARAYANPUR CHHATTISGARH
3605 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
3606 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH MAIN ROAD LOHA TQ LOHA DIST NANDED
3607 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH SANGEWAR COPMLEX MAIN ROAD LOHA TQ LOHA DIST NANDED
3608 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH BUS STAND OPPOSITE MAIN ROAD LOHA TQ LOHA DIST NANDED
3609 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
3610 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
3611 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
3612 OMTECH COMPUTER SOCIETY I FLOOR ALLAHABAD BANK NAINITAL ROAD BAHERI BAREILLY
3613 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
3614 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
3615 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
3616 ONE INDIA INFORMATION TECHNOLOGY PRIVATE LIMITED ONE INDIA INFORMATION TECHNOLOGY PRIVATE LIMITED OFFICE NO.501 FIFTH FLOOR VAISHALI TOWER -II NURSERY CIRCLE VAISHALI NAGAR JAIPUR RAJASTHAN
3617 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
3618 ONEWAY SKILL MANAGEMENT AND TECHNOLOGY PRIVATE LIMITED FLAT NO. 1645-A DHANAS CHANDIGARH
3619 ONE WINDOW SOLUTION PVT LTD PLOT NO. 331, SECTOR - 8 VIDHYADHAR NAGAR JAIPUR
3620 ONE WINDOW SOLUTIONS PVT LTD PLOT # 331, SECTOR - 8 VIDHYADHAR NAGAR
3621 ONEX MEDICAL AND EDUCATION WELFARE SOCEITY 178/14 NEAR- SARSWATI SCHOOL, NEHRU NAGAR, SAMAN , REWA, MADHYA PRADESH -486001
3622 ONFIELDIN PRIVATE LIMITED #16, ANJANAVILAS, S.R. LAYOUT, SRIRAMPURA - II STAGE, MYSORE - 570023
3623 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
3624 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY LEHRAGAGA-148031 DISTT. SANGRUR (PB.)
3625 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY PUNGH, SUNDERNAGAR, DISTT MANDI (HP)
3626 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
3627 OPTIMA ELECTRICAL SYSTEMS PVT LTD S L TOWER, UR 43, UPPALAM ROAD, STATUE TRIVANDRUM 695001
3628 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
3629 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
3630 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
3631 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3632 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3633 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3634 ORBIT DETECTIVE AND SECURITY SERVICES PVT LTD 102, MEGHDOOT TOWER, VIJAYNAGAR, INDORE
3635 ORBIT SKILL FOUNDATION NEAR AYYAPPA TEMPLE, VRINDAVAN COLONY, JAGDALPUR
3636 ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3637 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3638 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3639 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
3640 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3641 ORIGIN CADD INFOTECH NO:49 THIYAGI KUMARAN STREET THANEERPANDAL, PEELAMENU COIMBATORE TAMILNADU
3642 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3643 ORION TRUST SAGOLBAND THINGOM LEIKAI
3644 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
3645 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
3646 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3647 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
3648 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3649 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3650 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3651 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3652 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
3653 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3654 ORRISIS ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3655 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
3656 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3657 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3658 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
3659 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
3660 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
3661 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
3662 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
3663 OVER AIR TECHNOLOGIES PRIVATE LIMITED #2385, SECTOR-22C, CHANDIGARH
3664 OVER AIR TECHNOLOGIES PRIVATE LIMITED S.C.O-84/1, SECTOR-58, SHAHI MAJRA MOHALI
3665 OXFORD SHIKHHA PRASAR SANSTHAN TIWARIYAN CHHIBRAMAU, KANNAUJ U.P.
3666 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI U.P. IN CODE-262701
3667 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3668 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3669 OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI
3670 OXYGEN INSTITUTE ASE OXYGEN INSTITUTE ASE SETH COLONY ARJUNPURWA
3671 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
3672 PABAN JYOTI BHUYAN GHY
3673 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
3674 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
3675 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
3676 PACE WELFARE AND SKILL DEVELOPMENT SOCIETY 84 WARD NO.8, GALI NO.1 NAVANKUR GALI, GANJ BASODA DISTRICT VIDISHA MP-464221
3677 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
3678 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
3679 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
3680 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
3681 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
3682 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
3683 PADMAJA WELFARE SOCIETY HOUSE OF SHRI GAGAN, FLA NO.- 101/B, RAGHVENDRA LOK, PUNAICHAK, BAILEY ROAD, PATNA, BIHAR
3684 PADMANABHAN EDUCATIONAL TRUST SANNATHI STREET SRIMUSHNAM CUDDALORE DIST
3685 PADMANABHAN EDUCATIONAL TRUST SANNATHI STREET SRIMUSHNAM
3686 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
3687 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
3688 PAL FACILITY MANAGEMENT SERVICES PRIVATE LIMITED E-568 KH NO-113-3 GALI NO 79 MAHAVIR ENCL-3 NEAR MOTHER DAIRYNEW DELHI - 110059
3689 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
3690 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
3691 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
3692 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
3693 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
3694 PANAH FOUNDATION 5,KAILASH NAGAR, NEAR GAYATRY SOCIETY. B/H- RAJIV GHANDHI BHAVAN SAIJPUR BHOGHA,NARODA ROAD
3695 PANAH FOUNDATION 5 KAILASH NAGAR , B/H RAJIV GANDHI BHAVAN, SAIJPUR BOGHA,
3696 PANAH FOUNDATION 5,KAILASH NAGAR, NEAR GAYATRY SOCIETY. B/H- RAJIV GHANDHI BHAVAN SAIJPUR BHOGHA,NARODA ROAD
3697 PANAPUR CONSTRUCTION PRIVATE LIMITED D-29, GROUND FLOOR, GANESH NAGAR, PANDAV NAGAR COMPLEX, NEAR HANUMAN MANDIR, DELHI EAST DELHI 110092 INDIA
3698 PANAPUR CONSTRUCTION PRIVATE LIMITED D-29, GROUND FLOOR, GANESH NAGAR, PANDAV NAGAR COMPLEX, NEAR HANUMAN MANDIR, DELHI EAST DELHI 110092 INDIA
3699 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
3700 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
3701 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
3702 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
3703 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
3704 PANCHSHEEL THINKERS SAMITI MERHWA (BANGANGA ROAD)SHOHRATGARH SIDDHARTHNAGAR 272205 UTTAR PRADESH
3705 PANCHSHEEL THINKERS SAMITI MERHWA (BANGANGA ROAD) SHOHRATGARH SIDDHARTHNAGAR 272205
3706 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
3707 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
3708 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
3709 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
3710 PANDIT DEENDAYAL UPADHYAY EDUCATION SOCIETY 24 KK PURI AWAS VIKAS JHANSI
3711 PANDIT LEKHRAM VEDIC MISSION D-15/1,GF,ARDEE CITY, GURGAON, HARYANA
3712 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
3713 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
3714 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU JAMMU
3715 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
3716 PANSI TECHNOLOGIES 101,PANSI HOUSE,NEAR BY PARYAG SOCIETY BUILDING,LOKDHARA KALYAN (E), TISGAON RD, LOKGRAM, KALYAN, MAHARASHTRA 421306
3717 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17, KURUKSHETRA
3718 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17,KURUKSHETRA
3719 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17, KURUKSHETRA
3720 PARAKRAM ASSOCIATION OF GWALIOR ENGINEERS 78-TANSEN NAGAR GWALIOR
3721 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
3722 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20 NEW ASHOK NAGAR DELHI
3723 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
3724 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
3725 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20, NEW ASHOK NAGAR, DELHI
3726 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
3727 PARAM EDUCATIONS SAMITI SOMANI AADARS VIDYAMANDIR ,NEAR GHANTA GHAR,SIKAR (RAJ.)
3728 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
3729 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
3730 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
3731 PARAMOUNT WELFARE SOCIETY 90/6, SHKTI NAGAR BARI, RAISEN,M.P
3732 PARAMPARA FOUNDATION JF-2/8,BLOCK 2 JANTA FLAT,ARYA KUMAR ROAD,RAJENDRA NAGAR,P.O. RAJENDRA NAGAR,P.S.-KADAMKUAN
3733 PARAMPARA FOUNDATION JF-2/8,BLOCK-2,JANTA FLAT,ARYA KUMAR ROAD,P.O.-RAJENDRA NAGAR,P.S.-KADAMKUAN,PATNA
3734 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
3735 PARAS SPORTS AND EDUCATIONAL SOCIETY J.K BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3736 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3737 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3738 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
3739 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
3740 PARIDHI AT NAYATOLA,BHIKHANPUR PO BHAGALPUR BHAGALPUR
3741 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
3742 PARINITA GRAMEEN VIKAS SAMITI WARD NO.14 PAWAR DHARMSHALA NEAR BUS STAND NASRULLAGANJ DIST. SEHORE (M.P.)
3743 PARISHRAM MAHILA MANDAL CHARITABLE TRUST 5, AMRUT SAGAR APARTMENT, PURVI SOCIETY, HIRABAUG, SURAT.
3744 PARISHRAM MAHILA MANDAL CHARITABLE TRUST 5, AMRUT SAGAR APARTMENT, PURVI SOCIETY, HIRABAUG, SURAT.
3745 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
3746 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
3747 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
3748 PARIVARTAN SANDESH FOUNDATION 134-D/1,FLAT NO. B-1,UGF,BEGUMPUR,NEW DELHI
3749 PARIVARTAN SANDESH FOUNDATION B-1, UGF, PROPERTY BEARING NO.134-D/1, BEGUMPUR, NEW DELHI
3750 PARIVARTAN SANDESH FOUNDATION B-1, UPPER GROUND FLOOR, PROPERTY BEARING NO. 134-D/1, SITUATED AT BEGUMPUR, NEW DELHI
3751 PARKSONS DYESTUFF INDUSTRIES PRIVATE LTD 500, PAREKH HOUSE, OPP LENDRA PARK OLD RAMDASPETH
3752 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
3753 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
3754 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
3755 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
3756 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
3757 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
3758 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
3759 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
3760 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
3761 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
3762 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
3763 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
3764 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
3765 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
3766 PAWAN DSDSDS
3767 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
3768 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
3769 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
3770 PCI EDUCATIONAL TRUST W.NO 1 RS PURA JAMMU H/O SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU
3771 PCI EDUCATIONAL TRUST W.NO 1 RS PURA JAMMU 181102 H/O SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
3772 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
3773 PC INFOTECH GROUP PC INFOTECH GROUP, 3RD FLOOR, CENTRAL MARKET, TINKONIA, BURDWAN, WEST BENGAL-713101
3774 PEACE DEVELOPMENT SOCIETY NEAR MAZAR HAFIZ JAMAL SAHAB BAJORI TOLA RAMPUR UP
3775 PEACE RURAL DEVELOPMENT SOCIETY PRDS 87/909, NEAR KMC WATER PLANT TELECOM NAGAR
3776 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, DAALNWALA
3777 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, OPP. GURUDWARA, DEHRADUN
3778 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
3779 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3780 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3781 PEDAGOGUES EDUCATION INDIA PVT LTD 810,VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3782 PEDAGOGUES EDUCATION INDIA PVT LTD 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3783 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
3784 PENTAGON MARITIME TRAINING AND RESEARCH INSTITUTE PMTRI BUILDING, PENTAGON HOUSE, CIDCO SERVICE I NDUSTRI AL AREA, PLOT NO. 60, SECTOR-1, SHIRVANE, NERUL-E, NAVI MUMBAI
3785 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
3786 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
3787 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
3788 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
3789 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
3790 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
3791 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL HARYANA
3792 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL ,HARYANA
3793 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
3794 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
3795 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
3796 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
3797 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
3798 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
3799 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
3800 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
3801 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
3802 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
3803 PHILADELPHIA RURAL DEVELOPMENT SOCIETY PHILADELPHIA COMPOUND TAHSILPARA WARD NO-13 BIJAPUR DISTRICT BIJAPUR
3804 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
3805 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
3806 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
3807 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
3808 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
3809 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
3810 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
3811 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
3812 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
3813 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
3814 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
3815 PITAMBER SHARMA RAGHUNATH TEMPLE,MAIN MARKET WARD NO.-6
3816 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
3817 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
3818 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
3819 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
3820 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
3821 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
3822 PLAN TO EMPOWER F 13/17 B, TF JOGA BAI EXTEN. JAMIA NAGAR OKHLA, NED DELHI
3823 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
3824 PLEASE DELETE TEST APPLICATION TEST IN TEST
3825 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
3826 P L S AUTO SHELL INDUSTRIES PRIVATE LIMITED 377 DHOLPURAAGRA ROAD FIROZABAD UTTAR PRADESH UP 283203
3827 PLS AUTO SHELL INDUSTRIES PRIVATE LIMITED 377 DHOLPURAAGRA ROAD FIROZABAD UTTAR PRADESH UP 283203 IN
3828 PLUS91 SECURITY SOLUTIONS 2/400, GROUND FLOOR, SUBHASH NAGAR, NEW DELHI
3829 PLUSTRUST 101, SRI SABARI RESIDENCY, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD.
3830 PLUSTRUST FLAT NO 101, SRI SABARI RESIDENCY, 11-3-397, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD
3831 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
3832 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
3833 POLYVALENT CONSULTING PVT LTD KAKADEO,PLOT NO.-117/L/248, NAVEEN NAGAR, KANPUR
3834 PONNI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE,PATTUKONAMPATTI POST,PAPPIREDDIPATTI TALUK,DHARMAPURI DT,PINCOAD :636905.
3835 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
3836 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
3837 PORNICA EDUCATIONAL TRAINING INSTITUTE OLD SUBRAMANI KOVIL STREET, PAUPPARAPATTI PO, PENNAGARAM TALUK, DHARMAPURI DISTRICT
3838 POSITIVE WOMEN NETWORK OF RAJASTHAN SOCIETY PLOT NUMBER49 50 63 GANDHIGRAM JAISINGHPURA NEWATA TEHSIL SANGANAR DISTRICT JAIPUR STATE RAJASTHAN
3839 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
3840 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
3841 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
3842 PRABHAT PUBLIC SIKSHA PRASAR SAMITI MOHLLA RAJEEV NAGAR PRABHAT PUBLIC JUNIOR HIGH SCHOOL NH. 24 PILIBHIT ROAD RITHORA BAREILLY
3843 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
3844 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
3845 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
3846 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
3847 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
3848 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3849 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
3850 PRAGATHI SEVA SAMITHI ​H.NO. 2 - 6 - 45/2, SRI SHANTHI NAGAR COLONY, ROAD NO.2, CIRCUIT HOUSE ROAD, HANAMKONDA, WARANGAL URBAN
3851 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
3852 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
3853 PRAGATI EDUCATION AND CHARITABLE TRUST RAJKOT SHOP NO-302 3ED FLOUR DECORA SQUARE SADHUVASVANI ROAD RAJKOT
3854 PRAGATI FOUNDATION NEAR PANDEN BUILDING NEEM CHOURAHA BODA BAAG REWA M P
3855 PRAGATI FOUNDATION ABOVE LAKSHMI SUPAR MARKET NEEM CHOURAHA BODA BAG REWA M P
3856 PRAGATI UNIVERSAL TRUST PLOT NO – 9, KHASRA NO – 173, BLOCK –A, GALI NO – 6, MAHARANA VIHAR, DISTRICT GHAZIABAD, GHAZIABAD UTTAR PRADESH – 201009
3857 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
3858 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
3859 PRAKALPGRAST KALYANKARI SAMITEE GONDIAS JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA-441601 (MS)
3860 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
3861 PRAKASH DEEP SEWA SANSTHAN PDSS SCHOOL OF SKILL DEVELOPMENT H.N. 60, NARAYAN NAGAR WARD, GORA BAZAR, RAEBARELI (U.P.) MOBILE: 9616542695
3862 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
3863 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
3864 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
3865 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3866 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3867 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3868 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
3869 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
3870 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3871 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3872 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3873 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
3874 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
3875 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
3876 PRATAP SEWA SAMITI GOMATI NAGAR PANCHO PEERAN SULTANPUR
3877 PRATHAM HEERA SALES PRIVATE LIMITED KRIDA BHAVAN BUILDING, BEHIND MUNICIPAL COUNCIL, NANDURBAR
3878 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
3879 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
3880 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
3881 PRATHYAK SERVICES PRIVATE LIMITED F-16, RING ROAD, ADIL NAGAR LUCKNOW
3882 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
3883 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
3884 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
3885 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
3886 PRATISHTHA C-67 JEEWAN PARK PANKHA ROAD UTTAM NAGAR DELHI-110059
3887 PRAWAH SRIRAM TOWER ASHIANA DIGHA ROAD, OPPOSITE IMERIAL GARDEN BEDDING HALL, PATNA
3888 PRAWAH SRI RAM TOWER, ASHIANA DIGHA ROAD, PATNA
3889 PRAWAH 303, RAMJEET APARTMENT, ARA GARDEN ROAD, JAGDEO PATH, PATNA
3890 PRECAMA HEALTHCARE PRIVATE LIMITED FLAT NO. G/A, MAYUR APARTMENTS 3A, DR. U. N. BRAHMACHARI STREET (OLD LOUDON ST) KOLKATA
3891 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
3892 PREM KUNJ CONSTRUCTION AND ENGG PVT LTD 2 KATEWA NAGAR EXT.,GUJAR KI THARI , NEW SANGANER ROAD JAIPUR
3893 PREMLILA VITHALDAS POLYTECHNIC SNDT WOMENS UNIVERSITY MUMBAI PREMLILA VITHALDAS POLYTECHNIC SIR VITHALDAS VIDYAVIHAR, JUHU ROAD, SANTACRUZ (WEST), MUMBAI-400 049. TELEPHONE: 26608676, 26608493, 26608462, 26606648 EXTN. 253 EMAIL: PVP@PVPSNDT.ORG, PRINCIPAL@PVPSNDT.ORG
3894 PRERANA RUGUDIPARA BALANGIR
3895 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
3896 PRERANA RUGUDIPARA BALANGIR ODISHA
3897 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
3898 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3899 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3900 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3901 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3902 PRIME EDUCATIONAL TRUST NO 20 PERUMAL NORTH STREET
3903 PRIME EDUCATIONAL TRUST 20, PERUMAL NORTH STREET, NAGAPATITNAM
3904 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3905 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3906 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3907 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY ANANTAPUR (V&M) ANANTAPUR(D) A.P
3908 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY, ANANTAPUR(V) ANANTAPUR(M) ANANTAPUR (D) ANHRAPRADESH
3909 PRINCIPAL GOVERNMENT INDUSTRIAL TRAINING INSTITUTE ROPAR NANGAL ROAD, ROPAR
3910 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
3911 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10 HUDA PARK,NEAR NEW BUS STAND KURUKSHETRA
3912 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
3913 PRIX AUTOMATION BASEMENT, SEHRAWAT BHAWAN, OPP. SARASWATI MAHILA COLLEGE, PALWAL, HARYANA
3914 PRIYADARSHANI MAGASWARGIYA VIKAS MAHILA MANDAL NANDED B-5 VISHNU COMPLEX,NEAR TAJ PATIL HOTEL,ITI CORNER NANDED
3915 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
3916 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
3917 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING, DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR
3918 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING., DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR, DIST-AHMEDNAGAR
3919 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
3920 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
3921 PRIYA GRIH UDYOG VIKAS AVAM SHIKSHA PRASAR SAMITEE N7/48 R-11 PATEL NAGAR CHHOTIBHIKHARIPUR D.L.W VARANASI
3922 PRIYANKA URBAN AND RURAL DEVELOPMENT ORGANIZATION NO.8 6TH MAIN ROAD NEAR GANGAMMA TEMPLE GANGANAGAR R T NAGAR POST BANGALORE
3923 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
3924 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
3925 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
3926 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3927 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3928 PROFESSIONAL FASHION AND MANAGEMENT PRIVATE LIMITED D-116, OKHLA INDUSTRIAL AREA, PHASE 1, OKHLA, NEW DELHI
3929 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
3930 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
3931 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
3932 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS DOOR NO 30/348 BALAJINAGAR DHARMAVARAM ANANTAPUR (D) ANDHRAPRADESH (S)
3933 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
3934 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
3935 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, NEAR M.J.D. GOVT P.G. COLLEGE, TARANAGAR
3936 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, M.J.D. GOVERNMENT P.G. COLLEGE KE PASS, TARANAGAR, DIST.- CHURU
3937 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
3938 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
3939 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3940 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3941 PROWINS AGRI SYSTEM SAGARIKA, NEAR OLD BRIDGE, MARUTHANKUZHY, KANJIRAMPARA P.O.,THIRUVANANTHAPURAM 30
3942 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
3943 PROWINS AGRI SYSTEM PROWINS AGRI SYSTEM, NEAR OLD BRIDGE, MARUTHAMKUZHY, KANJIRAMPARA P O THIRUVANANTHAPURAM 695030 KERALA
3944 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
3945 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
3946 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
3947 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
3948 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
3949 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
3950 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
3951 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
3952 PSLMM DG
3953 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
3954 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3955 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
3956 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
3957 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
3958 PUB BARPETA SOCIAL WELFARE SOCIETY VILL- MAZDIA , P.O- PACHIM MAZDIA, P.S- SARTHEBARI, DIST- BARPETA, ASSAM.
3959 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
3960 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
3961 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
3962 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3963 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
3964 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3965 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3966 PUNE CONSULTANCY SERVICES PRIVATE LIMITED REGISTERED ADDRESS : A2-803,GANGA OSIAN MEADOWS,NEAR ADITYA BIRLA HOSPITAL,THERGAON,PUNE PLANT & TRAINING MANAGEMENT ADDRESS : PLOT NO: 116, SURVEY NO: 31/14, KIRTI CLASSIQUE, NEAR KPIT CUMMINS, RAJIV GANDHI INFOTECH PART,PHASE-1, HINJEWADI MARUNJI ROAD.PUNE 411057
3967 PUNJ AAB EDUCATION AND WELFARE SOCIETY MOONAK # 96, WARD NO. 1, VPO MOONAK DISTT. SANGRUR (PUNJAB)
3968 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
3969 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
3970 PUNJAB SEVA SAMITEE 36A, WHOLE SALE CLOTH MARKET, GANDHIBAGH, NAGPUR, MAHARASHTRA
3971 PUNYSHLOK AHILYADEVI MAHILA BAHUUDESHIYA SANSTHA NEAR J.V MEHTA NAVAYUG VIDHYALAY BEHIND AMBIKA KRIDA MANDAL RAILWAY STATION KHAMGAON
3972 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
3973 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3974 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3975 PUTHIYAPATHAIFOUNDATION 2/54A TRICHY ROAD RANGANATHAPURAM SULUR COIMBATORE
3976 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
3977 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
3978 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3979 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
3980 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3981 QUANTUM GLOBAL INFRATECH LTD N1 / 150, IRC VILLAGE, NAYAPALLI, BHUBANESHWAR, ODISHA
3982 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
3983 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
3984 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
3985 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
3986 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
3987 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
3988 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
3989 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
3990 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
3991 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
3992 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3993 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3994 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3995 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
3996 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3997 RAGHAVS FOUNDATION 10-3-444/120A, P.S.NAGAR, VIJAY NAGAR COLONY, HYDERABAD
3998 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
3999 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
4000 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
4001 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
4002 RAHI SHIKSHAN SANSTHA RAHI ESTATE, AHILYA NAGAR JAITALA ROAD, NAGPUR
4003 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
4004 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
4005 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4006 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
4007 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
4008 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
4009 RAJA BARIAR EDUCATIONAL WELFARE TRUST VILL-P.O - DOMA VIA KHUSRUPUR DIST-PATNA BIHAR
4010 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4011 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4012 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4013 RAJARAM MEMORIAL EDUCATIONAL WELFARE SOCIETY VILLAGE AND POST DAHGAWAN TEHSIL SAHASWAN DISTRICT BUDAUN
4014 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
4015 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
4016 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
4017 RAJASTHAN SHIKSHAN PARSHIKSHAN SANSTHAN 77 VIDHYA VIHAR, BEHIND CHETALI ENCLAVE, 5 E CHHOTI
4018 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
4019 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
4020 RAJDHANI EDUTECH ENTERPRISES EW-07,INDRAPRASTH RDA COLONY,RAIPURA,RAIPUR,CHHATISGARH
4021 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
4022 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P) - 226001
4023 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHIITWAPUR ROAD, LALKUAN, HUSSAINGANJ, LUCKNOW (U.P) - 226001
4024 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P)
4025 RAJEEV GANDHI COMPUTER PRASAR MISSION SANSTHAN RAJEEV GANDHI COMPUTER PRASAR MISSION SANSTHAN REGD. OFFICE - WARD NO 29, BATWALO KA MOHALLA, JHUNJHUNU (RAJ.)-333001 HEAD OFFICE-NEAR KHAN STONE COMPANY-MANDRELLA, TEHSIL –CHIRAWA, DISTT. - JHUNJHUNU (RAJ.)-333025
4026 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
4027 RAJEEV INDUSTRIAL TRAINING AND RESEARCH INSTITUTE 22(A), STATION ROAD OPPOSITE VIKAS DEEP BUILDING,HUSAIN GANJ LUCKNOW
4028 RAJE SAMBHAJI PRATISHTHAN SANCHALIT SAMBHAJI RAJE MANAGEMENT SCIENCE COLLEGE SHIRUR KASAR MAIN ROAD SHIRUR KASAR TQ SHIRUR KASAR DIST BEED MAHARASHTRA
4029 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
4030 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
4031 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
4032 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
4033 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
4034 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
4035 RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE BSNL RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE,BSNL , GST ROAD MINAMBAKKAM ,CHENNAI
4036 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
4037 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
4038 RAJLAXMI SOLUTIONS PRIVATE LIMITED UNIT NO. 203 TO 207, 2ND FLOOR, VARDHAMAN INDUSTRIAL COMPLEX, GOKUL NAGAR, MUMBAI MUMBAI CITY MH 400601
4039 RAJ SHREE 787
4040 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
4041 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
4042 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
4043 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
4044 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
4045 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, SECTOR-10, DWARKA
4046 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, MANISH PLAZA III, SECTOR-10, DWARKA, NEW DELHI
4047 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
4048 RAM MORADABAD
4049 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
4050 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
4051 RAMAKRISHNA MISSION RAMAKRISHNA MISSION VIDYALAYA INDUSTRIAL TRAINING INSTITUTE, (A BRANCH CENTRE OF RAMAKRISHNA MATH AND RAMAKRISHNA MISSION, BELUR MATH, HOWRAH, WEST BENGAL) SRI RAMAKRISHNA VIDYALAYA POST, PERIYANAICKENPALAYAM, COIMBATORE
4052 RAMAKRISHNA MISSION VIDYALAYA RAMAKRISHNA MISSION VIDYALAYA , (A BRANCH CENTRE OF RAMAKRISHNA MATH AND RAMAKRISHNA MISSION, BELUR MATH, HOWRAH, WEST BENGAL) SRI RAMAKRISHNA VIDYALAYA POST, PERIYANAICKENPALAYAM, COIMBATORE
4053 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
4054 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
4055 RAMAN TRADERS 10D, DEVDHARA COLONY, MURLIPURA JAIPUR
4056 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
4057 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
4058 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
4059 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
4060 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL
4061 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL,
4062 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
4063 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
4064 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT GHAZIPUR
4065 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT GHAZIPUR
4066 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT SUBHASH NAGAR GHAZIPUR UP 233001
4067 RAMKY ENCLAVE LIMITED RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN RAOD,SOMAJIGUDA,HYDERABAD,TELANGANA
4068 RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN ROAD,SOMAJIGUDA,HYDERABAD,TELANGANA,INDIA
4069 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
4070 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
4071 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
4072 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
4073 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
4074 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
4075 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
4076 RAM SARAN EDUCATIONAL SOCIETY 161/3A/A PURA FATEH MOHAMMAD ARAIL MORE NAINI ALLAHABAD
4077 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
4078 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
4079 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
4080 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
4081 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
4082 RANIDIH SEWA SAMITI VILLAGE-RANIDIH POST-SARIYA TCH-SARANGADH DIST-RAIGARGH
4083 RANIDIH SEWA SAMITI VILAGE-RANIDIH POST-SARIYA,TECH-SARANGADH DIST-RAIGARH C.G.
4084 RANKS DIGITAL MEDIA PRIVATE LIMITED G-20, 2ND FLOOR, SECTOR-63, NOIDA
4085 RANKS DIGITAL MEDIA PRIVATE LIMITED RDM CORPORATE OFFICE, 2ND FLOOR, G-20, SECTOR - 63, NOIDA, UP.
4086 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
4087 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
4088 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA
4089 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA,WEST BENGAL
4090 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,CHAKDAHA,NADIA
4091 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD VILL-RASULLAPUR,P.O-DEWLI,P.S-CHAKDAHA,DIST-NADIA,PIN-741222
4092 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
4093 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
4094 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
4095 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.-DURG
4096 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG C.G.
4097 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
4098 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
4099 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
4100 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
4101 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG (C.G.)
4102 RASTRIYA BAL VIKAS SAMITI W-1,127/2,2ND FLOOR, MANGLAM COMPLEX SAKET NAGAR
4103 RASTRIYA MANAV VIKAS SAMITI SHIV KRIPA COMPLEX OPP. PWD OFFICE AGRA ROAD DAUSA(RAJ)
4104 RASTRIYA SAMAJIK UTTHAN SANSTHAN KHAJURI KHAJURI,KUSHAL GARH ROAD TEHSIL THANDLA DISTRICT JHABUA M.P.457777
4105 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
4106 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE BESIDE JAISWAL PETROL PUMP RATU ROAD RANCHI
4107 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE, BESIDE JAISWAL PETROL PUMP, RATU ROAD, RANCHI
4108 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE BESIDES JAISWAL PETROL PUMP RATU ROAD RANCHI
4109 RATNADEEP COUNSULTANT PVT LTD RATNDEEP CONSULTANTS PVT LTD, ABOVE IDBI BANK, SHREE RAMJEE ARCADE , RATU ROAD, RANCHI
4110 RAVI EDUCATION SOCIETY VPO ATELA KALAN, CH DADRI, HARYANA
4111 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
4112 RAVI EDUCATION SOCIETY VPO ATELA KHURD
4113 RAVI EDUCATION SOCIETY VPO ATELA KHURD
4114 RAVI EDUCATION SOCIETY VPO ATELA KALAN
4115 RAVI EDUCATION SOCIETY VPO ATELA KALAN
4116 RAVINDRA FOUNDATION 702/1, CIVIL LINES JHANSI
4117 RAWABI TOURS AND TRAVEL PRIVATE LIMITED NO. 5/631, G-1, 1ST FLOOR, B & S BUILDING, NEAR PASSPORT OFFICE, BYPASS ROAD, ERANJIPALAM, CALICUT
4118 RAYAPPAN MARIYAPUSHPAM EDUCATIONAL AND PUBLIC CHARITABLE TRUST D-97, 9TH CROSS (WEST), THILLAI NAGAR, TRICHY-620 018
4119 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA, SATARA KARMAVEER SAMADHI PARISAR, NEAR POWAI NAKA, SATARA (MAHARASHTRA)
4120 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA ,SATARA KARMAVEER SAMADHI PARISAR NEAR POWAI NAKA SATARA (MAHARASHTRA )
4121 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
4122 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
4123 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
4124 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
4125 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
4126 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
4127 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4128 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4129 REAL EDUCATION TRUST 24, 25 VISHRAMNAGAR, OPP AKHAND ANAND SCHOOL, VED ROAD,SURAT.
4130 REAL EDUCATION TRUST 24,25 VISHRAM NAGAR, OPP. AKHAND ANAND SCHOOL, VED ROAD, SURAT.
4131 REAL EDUCATION TRUST 45, VIJAYRAJ RAW HOUSE,SINGANPOR CAUSEWAY ROAD,SURAT
4132 REAL EDUCATION TRUST 45, VIJAYRAJ RAW HOUSE,SINGANPOR CAUSEWAY ROAD,SURAT
4133 REAL REVOLUTION MARKETING PRIVATE LIMITED B-32, MAHESH NAGAR, TONK PHATAK, JAIPUR
4134 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
4135 REBIRTH EDUCATION AND RESEARCH FOUNDATION 3RD FLOOR, MARUTINANDAN COMPLEX, OPP G D HIGH SCHOOL, VISNAGAR
4136 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
4137 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
4138 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
4139 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
4140 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
4141 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
4142 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
4143 REKHA SOCIETY DGGHDGHSH
4144 RELIABLE FIRST ADCON PRIVATE LIMITED 412-422, FOURTH FLOOR, DEVNANDAN MALL, OPP : SANYAS ASHRAM, NR- M. J. LIBRARY, AHMEDABAD
4145 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
4146 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
4147 RELISYS MEDICAL DEVICES LIMITED SURVEY NUMBER 312 MANGALPALLY POCHARAM ROAD IBRAHIMPATNAM RANGAREDDY TELANGANA 501510
4148 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
4149 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
4150 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
4151 RESCUE SKILLS PRIVATE LIMITED MUNICIPAL COMPLEX UPSTAIRS, OLD BUS STAND, ULAVAR SANDHAI, KARUR
4152 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
4153 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
4154 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR
4155 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR DIST-CHHATARPUR (M.P.)
4156 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
4157 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
4158 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
4159 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
4160 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
4161 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
4162 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
4163 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
4164 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
4165 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
4166 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
4167 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
4168 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
4169 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
4170 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
4171 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
4172 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
4173 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
4174 RISHABHDEV EDUCATION AND RESEARCH INSTITUTE 5, INDRALOK APARTMENT, NEAR MOTIBAG CHOWK, CIVIL LINES, RAIPUR, CHHATISHGARH
4175 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
4176 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
4177 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
4178 RIT EDUCATION AND WELFARE SOCIETY KOTA HOUSE NO.2-TH-35,VIGYAN NAGAR, KOTA
4179 RIT EDUCATION AND WELFARE SOCIETY KOTA 2 THA 35, VIGYAN NAGAR , KOTA ( RAJASTHAN )
4180 RIT EDUCATION AND WELFARE SOCIETY KOTA 2 THA 35 VIGYAN NAGAR KOTA RAJASTHAN
4181 RJ RJ
4182 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
4183 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
4184 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
4185 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
4186 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
4187 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
4188 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
4189 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
4190 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
4191 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
4192 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
4193 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
4194 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
4195 ROHSTOFFE INTERNATIONAL PRIVATE LIMITED 1304, REGENT CHAMBERS, JAMNALAL BAJAJ ROAD, NARIMAN POINT
4196 ROJGAR MARGDARSHAN AVAM SWAROJGAR PRASHIKSHAN SANSTHAN NEAR NEW BUS STAND,SHARDAPURAM,P.O. BANSAGAR COLONY,REWA (M.P.)486001
4197 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
4198 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
4199 ROSHNI NATIONAL SEWA GRAMUDYOG SANSTHAN MOH KULHAN SARAIN, POST KHAIRABAD
4200 ROUNAK ALPASANKHYANK BAHUUDDESHIY SHIKSHAN SANSTHA DREAMS TECHNOLOGY, DR. ZAKIR HUSSAIN WARD, NEAR WATER TANK, BHANDARA
4201 ROYAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY H.NO. - 347 INSAF NAGAR INDIRA NAGAR
4202 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
4203 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
4204 ROYAL WINGS AUTO PRIVATE LIMITED NO.73,& 74 THIRUMALI STREET VEERAPANCHATRAM, ERODE
4205 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
4206 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
4207 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
4208 RPEDUCATIONALTRUST PLOT-44,NEAR GANPATI MANDIR,SHASTRI NAGAR,VASAI (W),PALGHAR
4209 R P EDUCATIONAL TRUST PLOT NO, 44, SHASTRI NAGAR, NEAR GANPATI MANDIR, VASAI (W) DIST PALGHAR
4210 R P EDUCATIONAL TRUST PLOT NO. 44, SHASTRI NAGAR, NEAR GANPATI MANDIR, VASAI WEST, DIST PALGHAR
4211 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
4212 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
4213 R S ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR
4214 RS ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR RAJASTHAN
4215 RSESK SOCIETY MAHENDRU
4216 RSM FINSERV LTD B-2/68,MOHAN CO-OPERATIVE INDUSTRIAL AREA,PHASE-2, BADARPUR,NEW DELHI
4217 RS VERMA EDUCATION SOCIETY GANESH BAG SHIVPURI RAYA(MATHURA)
4218 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
4219 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
4220 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
4221 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
4222 RUBBER BOARD P.B.NO:1122,KOTTAYAM-2,KERALA,INDIA
4223 RUBBER TRAINING INSTITUTE RUBBER TRAINING INSTITUTE, RUBBER BOARD P O, KOTTAYAM, KERALA
4224 RUBIX ADVISORY 196, SIRASPUR, DELHI
4225 RUBIX ADVISORY LLP 196, SIRASPUR, DELHI
4226 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
4227 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
4228 RUDRA DEVELOPMENT FOUNDATION VILL GAIGHATA
4229 RUGMARK FOUNDATION C-3A/86-C, JANAKPURI
4230 RUGMARK FOUNDATION C-3A/86-C, JANAKPURI, DELHI
4231 RUNGTA EDUCATIONAL SOCIETY RUNGTA KNOWLEDGE CITY, KOHKA KURUD ROAD, BHILAI
4232 RUNGTA EDUCATIONAL SOCIETY RUNGTA EDUCATIONAL CAMPUS, KOHKA KURUD ROAD, BHILAI
4233 RUNGTA INFOTECH SYSTEMS PRIVATE LIMITED RUNGTA KNOWLEDGE CITY KOHKA KURUD ROAD BHILAI
4234 RUNGTA INFOTECH SYSTEMS PRIVATE LIMITED RUNGTA KNOWLEDGE CITY, KOHKA KURUD ROAD BHILAI
4235 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
4236 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
4237 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
4238 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
4239 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
4240 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
4241 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
4242 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
4243 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
4244 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
4245 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
4246 RURAL DEVELOPMENT ASSOCIATION RURAL DEVELOPMENT ASSOCIATION 103A/3 AVALURPET ROAD AMBETHKAR SECOND STREET TIRUVANNAMALAI
4247 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
4248 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
4249 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
4250 RURAL EDUCATION AND ACTION FOR CHANGE RURAL EDUCATION AND ACTION FOR CHANGE NUNGOUROK VILLAGE,DISTRICT:CHANDEL, BLOCK:MACHI,P.O.PALLEL MANIPUR 795135
4251 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
4252 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
4253 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4254 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4255 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
4256 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4257 RURAL EDUCATION DEVELOPMENT SOCIETY NEAR MEGHA HIGHWAY ROAD, VILLAGE - BADELA
4258 RURAL EDUCATION DEVELOPMENT SOCIETY NEAR MEGHA HIGHWAY ROAD, VILLAGE - BADELA
4259 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
4260 RURAL FOUNDATION 51 A, UTSAV PART I, MAHANAGAR COLONY BAREILLY, UTTAR PRADESH-243122
4261 RURAL FOUNDATION HEAD OFFICE: DULARI DHAM, NEAR KISAN SEWA ASHRAM, AHROULI MOD, POKHRAYAN,KANPUR DEHAT-209111-UTTAR PRADESH
4262 RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY REGISTERED OFFICE HOUSE NO. 54-140,WARD NO.-60 SONKARBADI,DAGNIYA DIST RAIPUR- 492001 C.G. ADMINISTRATIVE OFFICE RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY (RICES) OLD SARANGARH BUS STAND BEHIND KANHA HOSPITAL WARD NO. 31 RAIGARH 496001 C.G. FOR ENQUIRY – 07762 - 222569/215448, 9522223698, 9329057958 EMAIL - SUPPORT@RICEEDU.ORG , ADMIN@RICEEDU.ORG WEBSITE:-WWW.RICEEDU.ORG
4263 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
4264 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
4265 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
4266 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
4267 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
4268 SAATIVIK KARMA RESEARCH FOUNDATION F-412 VILLAGE & POST OFFICE GHITORINI NEW DELHI
4269 SAATIVIK KARMA RESEARCH FOUNDATION F-412, VILLAGE & POST OFFICE GHITORINI NEW DELHI
4270 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
4271 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
4272 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
4273 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
4274 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR (UK) 247667
4275 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
4276 SABZAR SOCIAL WELFARE SOCIETY PARRY SHOPPING COMPLEX NEAR RAZVI STOP MAGAM ( JAMMU & KASHMIR)
4277 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
4278 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
4279 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
4280 SADGUNA TECHNOLOGIES NAIMNAGAR
4281 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
4282 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
4283 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
4284 SADHU SARAN SINGH SKILL TRAINING CENTRE PRIVATE LIMITED C/O RAUSHAN RAJ,WARD NO-11,DUMARI BUZURG,SARAN,BIHAR
4285 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
4286 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
4287 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
4288 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
4289 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
4290 SAFDSF SADFASD
4291 SAFE TOWERS PRIVATE LIMITED GROUND FLOOR, PLOT NO-65, POCKET-1, JASOLA VIHAR, NEW DELHI-110025
4292 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY INDORE
4293 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY, INDORE
4294 SAGE SUSTAINABLE APPROACH FOR GREEN ENVIRONMENT LLP 205, SECOND FLOOR, BHAVANI INDUSTRIAL ESTATE, OPP. IIT BOMBAY MAIN GATE, POWAI, MUMBAI
4295 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
4296 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
4297 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
4298 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
4299 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
4300 SAHARA COMPUTER EDUCATION H NO 1-5-129 DIAMOND TEXTILE COMPLEX 2ND FLOOR MAIN ROAD OPP BSNL OFFICE ZAHEERABAD DIST SANGAREDDY, TELANGANA 502220
4301 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
4302 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-125 DIAMOND TEXTILE COMPLEX 2ND FLOOR OPP BSNL OFFICE MAIN ROAD ZAHEERABAD, DIST SANFAREDDY. TELANGANA. 502220
4303 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
4304 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
4305 SAHASRA ELECTRONICS PRIVATE LIMITED 129-G, N.S.E.Z, NOIDA
4306 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
4307 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
4308 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
4309 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
4310 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4311 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4312 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
4313 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4314 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4315 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
4316 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
4317 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
4318 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
4319 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
4320 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
4321 SAHYADRI SHIKSHK EDUCATION SANGHA SHIRGAON AT POST SHIRGAONTAL DEVGAD DIST SINDHUDURG
4322 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
4323 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
4324 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
4325 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
4326 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
4327 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
4328 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
4329 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
4330 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
4331 SAI DHAM FOUNDATION DAMINI SOCIETY JUHU MUMBAI, MAHARASHTRA
4332 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
4333 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
4334 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
4335 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
4336 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
4337 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
4338 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
4339 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
4340 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
4341 SAINT MARGARET EDUCATION SOCIETY D - BLOCK PRASHANT VIHAR DELHI
4342 SAINT MARGARET EDUCTION SOCIETY D-BLOCK , PRASHANT VIHAR, DELHI
4343 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4344 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4345 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4346 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
4347 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4348 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4349 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
4350 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
4351 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
4352 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
4353 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
4354 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
4355 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
4356 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
4357 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
4358 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
4359 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
4360 SAJAR HEALTH EDUCATIONAL AND CHARITABLE TRUST 52, VAIGAI STREET, VELMURUGAN NAGAR, BYPASS ROAD, MADURAI
4361 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
4362 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
4363 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
4364 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
4365 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
4366 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
4367 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
4368 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
4369 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
4370 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
4371 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
4372 SAMAGRA SAMAJIK NAITIK VIKAS SANSTHAN 060338 GOUTAM COMPLEX GOUTAM MADHIYA KACHHPURA BRIDGE GARHA JABALPUR MADHYA PRADESH
4373 SAMAJ DIVA INSTITUTE OF FASHION DESIGNING, OPPOSITE RADHA KARISHAN MANDIR, OLD BUS STAND , PALAMPUR, DISTT KANGRA (H.P.)
4374 SAMAJ DIVA INSTITUTE OF FASHION DESIGN OPPOSITE RADHA KARISHAN MANDIR, OLD BUS STAND, PALAMPUR, DISTT KANGRA ( H.P.) 176061
4375 SAMAJ DIVA INSTITUTE OF FASHION DESIGNING, OPPOSITE RADHA KARISHAN MANDIR , OLD BUS STAND, PALAMPUR , DISTT . KANGRA (H.P.)
4376 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
4377 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
4378 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
4379 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
4380 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
4381 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
4382 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
4383 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
4384 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
4385 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
4386 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
4387 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
4388 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
4389 SAMARTH EDUSKILLS PVT LTD GD-ITL TOWER,706,B09 GDITL TOWER,NETAJI SUBASH PLACE,PITAMPURA,DELHI-110034
4390 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
4391 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR
4392 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR, RAJASTHAN
4393 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
4394 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
4395 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
4396 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
4397 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
4398 SAMBAL SIKHASAN SANSTHAN SHIVSINGHPURA SIKAR
4399 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
4400 SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI, VINAYAK NAGAR DARRASHIVPURI NEAR INFANT PUBLIC SCHOOL SAHARANPUR PIN: 247001
4401 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
4402 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
4403 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
4404 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
4405 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
4406 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
4407 SAMRIDHI SOCIETY 235 SARAI SULTANI ALIGARH
4408 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
4409 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
4410 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
4411 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9,LALA LAJPAT RAI COLONY,ASHOKA GARDEN,RAISEN ROAD,BHOPAL
4412 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4413 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
4414 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
4415 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
4416 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
4417 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
4418 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
4419 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
4420 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
4421 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
4422 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
4423 SANDEEP TEST ASDASDASD
4424 SANDESH MNGO INDIA INDIA 1 INDORE
4425 SANDIP FOUNDATION POST MAHIRAVANI, TRIMBAK ROAD NASIK MHARASTRA
4426 SANDIP FOUNDATION 2ED FLOOR KOTESHWAR PLAZA JN ROAD MULUND MUMBAI
4427 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
4428 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
4429 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
4430 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
4431 SANGMESHWAR EDUCATIONAL TRUST REGD #142, SECTOR 07, URBAN ESTATE, KURUKSHETRA-136118, HARYANA
4432 SANGMESHWAR EDUCATIONAL TRUST REGD HOUSE NUMBER 142 SECTOR 07 URBAN ESTATE KURUKSHETRA HARYANA
4433 SANIDHYA SKILL DEVELOPMENT PRIVATE LIMITED 403, PALTINUM PLAZA, ABOVE ICICI BANK, STATION ROAD, NADIAD
4434 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
4435 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
4436 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
4437 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
4438 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
4439 SANKALP SAMAJIK VIKAS SANSTHAN F-80 AAKRITI ECO CITY BAWADIAKALAN BHOPAL
4440 SANKALP SAMAJIK VIKAS SANSTHAN F-80 AAKRITI ECO CITY, BAWADIAKALAN BHOPAL
4441 SANKALP SEWA SANSTHAN A-389, VIJAY SINGH PATHIK NAGAR BHILWARA, RAJASTHAN.
4442 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
4443 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
4444 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
4445 SANSAR FOUNDATION SANSAR FOUNDATION, 3RD FLOOR, AMJ BUSINESS PARK, VIJAYA ROAD, NEXT TO CBT, DHARWAD
4446 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
4447 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
4448 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
4449 SANSKRITI SAMVARDHAN MANDAL SHARDANAGAR SAGROLI DIST. NANDED
4450 SANSKRITI SHIKSHA SAMITI JILA SAHAKARI BANK PARISAR CHOUBEY COLONY RAIPUR C.G.
4451 SANSKRITI SHIKSHA SAMITI JILA SAHAKARI BANK PARISAR CHOUBEY COLONY RAIPUR C.G.
4452 SANT ASHWA SHIKSHAN SAMITI 10 RASHMI PATHOLOGY LEB NEAR OF ABHISEK TAKIZ PANDHANA ROAD KHANDWA
4453 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE
4454 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE KHANDWA
4455 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
4456 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
4457 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
4458 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
4459 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
4460 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU DIST DHOLPUR RAJASTHAN
4461 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU
4462 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU DISTRICT DHOLPUR RAJASTHAN
4463 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
4464 SAP INTEGRATED SECURITY AND IT SERVICES PRIVATE LIMITED B-544. POCKET-11, JASOLA VIHAR, NEW DELHI-110025
4465 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
4466 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
4467 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
4468 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
4469 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
4470 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
4471 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
4472 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
4473 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
4474 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR ,BEHIND TUN TUN BABU PETROL PUMP,BANSEL BUILDING,CHAPRA ROAD,SIWAN ,BIHAR
4475 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR, NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD, SIWAN
4476 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,BEHIND UMASHANKAR SINGH PETROL PUMP,NEAR IDBI BANK,CHAPARA ROAD,SIWAN ,BIHAR
4477 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD, SIWAN BIHAR
4478 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR ,NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD,SIWAN
4479 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
4480 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
4481 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE - VILLAGE/POST- MADANPURA, TEH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN CORP.OFFICE - SHREE NATH CAMPUS, NEAR GAYATRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRPURA, CHECHAT, TH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN
4482 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE- VILLAGE/POST- MADANPURA, TEH- RAMGANJMANDI, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN. CORP. OFFICE- SHREE NATH CAMPUS, NEAR GAYTRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRAPURA, CHECHAT, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN
4483 SARASWATII GLOBAL PRIVATE LIMITED SARASWATII GLOBAL PVT LTD. 3 GANESH COLONY, AMER ROAD, JAIPUR-302002 INDIA
4484 SARASWATII GLOBAL PRIVATE LIMITED SARASWATII GLOBAL PVT LTD. 3 GANESH COLONY,BEHIND GOLIMAR GARDEN,AMER ROAD
4485 SARASWATI INSTITUTIONS OF COMPUTER EDUCATIONAL SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX LAWRENCE ROAD
4486 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
4487 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
4488 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
4489 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
4490 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
4491 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST P.S. BHATIA COMPLEX, PLOT NO.- 22, NEAR MAIN BUS STAND, SRIKARANPUR
4492 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST VPO 13 Q TEHSIL & DISTRICT SRIGANGANAGAR RAJASTHAN
4493 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
4494 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
4495 SARGURU SHIRIDII SYSTEMS PRIVATE LIMITED 43/P, KASTHURI NILAYAM, KAMARAJ STREET, GOVINDASALAI, PONDICHERRY
4496 SARISKA SEVA SANSTHAN 119,PARIVHAN NAGAR,SURYA NAGAR LINK ROAD,MANNA KA,ALWAR
4497 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
4498 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
4499 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
4500 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR ,, ARERA COLONY, BHOPAL - 462016, MADHYA PRADESH, INDIA
4501 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR, ARERA COLONY BHOPAL - 462016 MADHYA PRADESH , INDIA
4502 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGES CAMPUS DATODA KHANDWA ROAD, INDORE
4503 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4504 SARODINI SARASWATI SHIKSHA SAMITI SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS, VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4505 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
4506 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
4507 SAROJ GOPAL EDUCATIONAL SOCIETY MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI
4508 SAROJ GOPAL EDUCATIONAL SOCIETY VILLAGE - MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI, CHHATTISGARH
4509 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
4510 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
4511 SARSWATICHANDRA FOUNDATION TRUST SARSWATICHANDRA FOUNDATION TRUST 268C, MAIN ROAD, HMT LAYAUT RT NAGAR, BANGALORE KARNATAKA 560032
4512 SARSWATI EDUCATION AND WALFARE SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX, LAWRENCE ROAD, JALALABAD-WEST
4513 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
4514 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
4515 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
4516 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
4517 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
4518 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
4519 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4520 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4521 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
4522 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
4523 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
4524 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
4525 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
4526 SARVAJANIK JANKALYAN PARMARTHIK NYAS SARVAJANIK JANKALYAN PARMARTHIK NYAS E-3/27-A, ARERA COLONY, BHOPAL MADHYA PRADESH - 462016
4527 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
4528 SARVA SHIKSHA EVAM ROZGAR PARISHAD CHARITABLE TRUST ZIMT BUILDING SCF 26/27 OPP PAPIHA PARK, MODEL TOWN FATEHABAD, HARYANA
4529 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
4530 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
4531 SARVASIDDHANTA CHARITABLE TRUST B-17, MADHUBAN COLONY, TONK PHATAK, JAIPUR
4532 SARVHIT TRUST G-10, KRISHNA PLAZA, GARH ROAD, MEERUT, UTTAR PRADESH-250004
4533 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4534 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4535 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
4536 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4537 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4538 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4539 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4540 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4541 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4542 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4543 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4544 SARVODAYA VINDHYA VIKAS SAMITI SARVODAYA VINDHYA VIKAS SAMITI GURH CHAURAHA, REWA MADHYA PRADESH
4545 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
4546 SARVODYA EDUCATIONAL TRUST 290 MAIN ROAD NEW PLOT JAMMU
4547 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
4548 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
4549 SARV SHRI MAA NARMADA SHIKHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALYAN SAGAR MP
4550 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
4551 SARV SHRI MAA NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALAN SAGAR
4552 SARV SHRI NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD, DEORI KALAN SAGAR MADHYA PRADESH
4553 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4554 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4555 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4556 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4557 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
4558 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
4559 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
4560 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
4561 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
4562 SATMILE SATISH CLUB O PATHAGAR VILL-CHHAT ELAJAN, P.O.-ELAJANER KUTHI, DIST-COOCHBEHAR
4563 SATNAM KHADI GRAMODYOG SEWA SAMITI VILLAGE HARDASPUR POST DUBIHAN, GHAZIPUR, UTTAR PRADESH-
4564 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
4565 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
4566 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
4567 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO-110 BHUJGAON TALUKA AKRANI DIST NANDURBAR
4568 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
4569 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
4570 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
4571 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
4572 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
4573 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
4574 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4575 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4576 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
4577 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
4578 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
4579 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4580 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
4581 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4582 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4583 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4584 SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH P O CHERTHALA ALAPPUZHA
4585 SATYAM GRAMA SANGHAM SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH.P.O CHERTHALA ALAPPUZHA KERALA
4586 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
4587 SATYAM SKILLS CENTER VISHAKAPATNAM
4588 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
4589 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
4590 SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE 319/1 HAMIRPUR RAOD RATH DISTRICT HAMIRPUR U.P. 210431
4591 SAUMYA BEUTY PARLOUR AND TRAINING INSTITUTE MOHAL SAUMYA BEAUTY PARLOUR,POST RATH DISTT HAMIRPUR U.P
4592 SAUNIT GROUP OF STUDIES EDUCATIONAL SOCIETY 24/126, RUHAI MUHAL, NAR SANKAT HARAN MANDIR, AURAIYA
4593 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
4594 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
4595 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
4596 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
4597 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
4598 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
4599 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
4600 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
4601 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
4602 SBDA AT-GVBBGFHGFBFGB
4603 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
4604 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
4605 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
4606 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
4607 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
4608 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
4609 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
4610 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
4611 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
4612 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45 H.G.B ROAD.
4613 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
4614 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
4615 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
4616 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4617 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4618 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4619 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4620 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
4621 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
4622 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
4623 SCHOOL OF COMMUNITY SCIENCE AND TECHNOLOGY IIEST SHIBPUR DOWNING HALL WEST WING BOTANICAL GARDEN SHIBPUR HOWRAH
4624 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
4625 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
4626 SCL GLOBAL LOGISTICS INDIA PRIVATE LIMITED UNIT NO FF-C,ARMENIAN CENTRE.,OLD NO.71,NEW NO.94,ARMENIAN STREET,GEORGE TOWN,CHENNAI-600001
4627 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
4628 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
4629 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPP. KARIMPIN TASTE LAND ,M C ROAD NATTAKOM
4630 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPPOSITE KARIMPIN TASTE LAND, MC ROAD, NATTAKOM
4631 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
4632 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
4633 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
4634 SECOND INNING HOUSE H. NO. 380, J J COLONY, BLOCK – D, DSIDC, BAWANA, NEW DELHI – 110039, INDIA.
4635 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
4636 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
4637 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
4638 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
4639 SEED AND TREE CONSULTANTS PVT LTD T12, DOOR NO 2004, BLURIDGE TOWNSHIP, HINJEWADI,PUNE
4640 SEEDS VENTURE SOCIETY 2M-69,MAHATMAGANDHI NAGAR,KANKARBAGH,PATNA
4641 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
4642 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
4643 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
4644 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
4645 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
4646 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
4647 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
4648 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
4649 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
4650 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
4651 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
4652 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
4653 SERAPHIC IT SOLUTIONS A-501 NISHDIN AURA, MAHALAXMI NAGAR, INDORE CONTACT NO. 9644034142
4654 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
4655 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
4656 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
4657 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
4658 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST NEAR GOVT ITI, VENGIKKAL AND POST TIRUVANNAMALAI - 606604 TIRUVANNAMALAI TK & DIST OFFICE PH : 04175-233277
4659 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST, NEAR GOVT. ITI., VENGIKKAL & POST, TIRUVANNAMALAI-606604, TIRUVANNAMALAI TK & DT., OFFICE PH : 04175-233277 MOB : 8610778503
4660 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
4661 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
4662 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
4663 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
4664 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
4665 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
4666 SEVENTS CONSULTANTS PRIVATE LIMITED ROOM NO:-29, 3RD FLOOR, MARINE DRIVE, GCDA COMPLEX, KOCHI, KERALA
4667 SEVENTS CONSULTANTS PRIVATE LIMITED NO: 19, 3RD FLOOR,GCDA COMMERCIAL COMPLEX, MARINE DRIVE, KOCHI, KERALA
4668 SEVICA 1 SARAI KHAWAJA
4669 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
4670 SGR EDUCATIONAL SOCIETY #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL, DISTRICT: KARIMNAGAR, TELANGANA.
4671 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
4672 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
4673 SHABHGAI SHIKSHAN KENDRA SAHBHAGI SHIKSHAN KENDRA SAHBHAGI ROAD, CHHATHA MEEL (BEHIND POLICE FIRE STATION), SITAPUR ROAD, LUCKNOW-226201 (U.P.) INDIA, PHONE: 9452293783, 9935302536
4674 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
4675 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
4676 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
4677 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
4678 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
4679 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
4680 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
4681 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
4682 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
4683 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
4684 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
4685 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
4686 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
4687 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
4688 SHANTI GD ISPAT AND POWER PRIVATE LIMITED HEAD OFFICE: 402 RAJEEV GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR PLANT ADDRESS: VILLAGE AMJHAR DISTRICT CHAMPA JANJGIR
4689 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
4690 SHANTI NIKETAN EDUCATION SOCIETY JANTA SR. SEC. SCHOOL VPO- JONDHAN KALAN,
4691 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4692 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
4693 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4694 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4695 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
4696 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
4697 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSKAR BHARTI PUBLIC SCHOOL, NANGLI BALAHIR, TEH. BEHROR
4698 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
4699 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
4700 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
4701 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
4702 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
4703 SHARI HARI ADARSH SIKSHAN SANDSTHAN -V.P.O. BORUNDA
4704 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
4705 SHARON INSUL INDIA LIMITED SHARON INSUL INDIA LIMITED SHARON TOWER, SEAPORT-AIRPORT TOAD, KAKKANAD, ERNAKULAM, KERALA
4706 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161, AGGRASAIN INDUSTRIAL AREA AGGRASAIN
4707 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161 AGGRASAIN INDUSTRIAL AREA AGGRASAIN NAGAR
4708 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
4709 SHASHI BHUSHAN SEN PATELWADA,WARD NO.7,SALUMBER,DIST.UDAIPUR(RAJASTHAN) PATELWADA
4710 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
4711 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
4712 SHETKARI SHIKASHAN PRASARAK MANDAL S.S.P.M EDUCATIONAL COMPLEX,GAURIPADA TALAO,GAURIPADA ROAD,MILIND NAGAR,KALYAN WEST,DISRICT THANE
4713 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
4714 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
4715 SHEVOM RUBBER INDUSTRIES PVT LTD 3/338 VISHWAS KHAND GOMTINAGAR, LUCKNOW
4716 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
4717 SHIKHAR EDUCATIONAL SOCIETY 598/10 MUSKAN RESIDENCY,LALPUR ,RAIPUR,CHHATISGARH
4718 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
4719 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
4720 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
4721 SHIKSHA FOUNDATION GROUND FLOOR, CLIFTON PARK TOWER, NEAR SWAMI NARAYAN COLLEGE, KANKARIA ROAD, SHAH ALAM TOLL NAKA, AHMEDABAD
4722 SHIKSHA FOUNDATION GROUND FLOOR, CLIFTON PARK TOWER, NEAR SWAMINARAYAN COLLEGE, KANKARIA ROAD, SHAH ALAM ROLL NAKA, AHMEDABAD
4723 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
4724 SHIKSHAUNNATI CHAPARER PAR ALIPURDUAR
4725 SHIKSHAUNNATI SUBHASH PALLY NEAR M.N BUS STAND ALIPURDUAR
4726 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR 222142 UP
4727 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
4728 SHIKSHA VISTAR SANSTHA HOUSE NO 40, SEC 9/2 , GANDHI NAGAR
4729 SHILPEE EDUCATIONAL TRUST A/12, ALKAPURI, GARDNIBAGH, PATNA, BIHAR
4730 SHILP SHREE MAHILA SEWA SAMITI 1/256 VIKAS NAGAR LUCKNOW
4731 SHINE ACADEMY # 12-4-582, OBULADEVA NAGAR, ANANTAPUR, ANDHRA PRADESH - INDIA - 515001.
4732 SHINE ACADEMY # 12-4-582, OBULADEVA NAGAR, ANANTAPUR
4733 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
4734 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
4735 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
4736 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
4737 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
4738 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
4739 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
4740 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
4741 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
4742 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
4743 SHIVALIK JAN KALYAN SAMITI SIDDHI VINAYAK BHAVAN OPP. ARYANS HOSPITAL KHALGHAT A.B. ROAD DIST. DHAR (MP)
4744 SHIVAM DEVANSH FAB PRIVATE LIMITED VILLAGE MOHALA, CHHAPROLA ROAD, SIKRI, BALLABGHGARH, FARIDABAD (HARYANA)
4745 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, JAFRABAD GODHRA 389001
4746 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
4747 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, OPP. JAFARABAD GRAM PANCHAYAT, GODHRA
4748 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
4749 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
4750 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
4751 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
4752 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4753 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4754 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4755 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
4756 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
4757 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
4758 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK YAMUNANAGAR
4759 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK,YAMUNANAGAR
4760 SHIV EDUCATION SOCIETY NEAR MLN COLLEGE, RADAUR YAMUNA NAGAR,HARYANA
4761 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK, YAMUNANAGAR
4762 SHIVPRABHU BAHUUDDESHIYA KRIDA SHIKSHAN VA SANSKRUTIK MANDAL BULDANA VISHNUWADI, CIRCULAR ROAD, BULDANA, TQ. DIST. BULDANA- 443001 MAHARASHTRA (INDIA)
4763 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
4764 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
4765 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
4766 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
4767 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
4768 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
4769 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
4770 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
4771 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
4772 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
4773 SHODH 180/22, ZAKIR NAGAR, OKHLA
4774 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
4775 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
4776 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
4777 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
4778 SHRAMIKA VIKASA KENDRAM SHRAMIKA VIKASA KENDRAM H.N. 1-9-99 KOLLAPUR
4779 SHRAMIKA VIKASA KENDRAM SHRAMIKA VIKASA KENDRAM H.N. 1-9-99 KOLLAPUR NAGARKURNOOL-DIST TELANGANA
4780 SHRAMJIVI VIKAS SANGH 21,AKASHDEEP SOCIETY,NEAR JAY BHAVANI RAW HOUSE, B/H RLY,EAST KALOL
4781 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
4782 SHRAWASTI GRAMODYOG SEWA SANSTHAN VILLAGE- AURAIYA NIDHAN , POST- KATAHA, GILAUALA SHRAWASTI , PIN- 271835
4783 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4784 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4785 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4786 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
4787 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
4788 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
4789 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
4790 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
4791 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
4792 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
4793 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR HOUSE NO 626 SHIVAJI NAGAR JINTUR TQ JINTUR DIST PARBHANI (MS)
4794 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
4795 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
4796 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
4797 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
4798 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
4799 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
4800 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
4801 SHREE JAGDAMBA BAL VIDYA MANDIR VILL POST SULTANGARH DISTT FATEHPUR U.P.
4802 SHREE JAINARAYAN GHOSAL SIKHSA SANSTHAN D 44/15, RAMAPURA, VARANASI, UTTAR PRADESH
4803 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
4804 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN,MATHURA
4805 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN
4806 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
4807 SHREE LAXMI COMPUTER CENTER LAXMI COMPUTER CENTER BASAVANA BAGEWADI
4808 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
4809 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
4810 SHREE MAN MANDIR EDUCATION TRUST KRISHNA COMPLEX, FIRST FLOOR, NR.AJI DUM CHOKDI, RAJKOT.
4811 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
4812 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
4813 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
4814 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
4815 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
4816 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
4817 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
4818 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
4819 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
4820 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
4821 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
4822 SHREE RAM KRIPA BUILD HOME PRIVATE LIMITED 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
4823 SHREERAM OM REAL ESTATE 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
4824 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
4825 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
4826 SHREE SANT GADGEBABAB BAHUDDESHIY SHIKSHAN SANSTHA KIRAN NAGAR NO 1 AMRAVATI 444606 S P GODE HOUSE KIRAN NAGAR NO 1 NEAR SAI MANDIR AMRAVATI
4827 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
4828 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
4829 SHREE SHERA EDUCATIONAL TRUST SHREE SHERA EDUCATIONAL TRUST(R),C/O COMMUNITY PLOYTECHNIC BELLARE,SHAHIN MAAL ,IIND FLOOR,OPP KSRTC BUS STAND,BELLARE,BELLARE POST,SULLYA TALLUK,DHAKSHINA KANNADA DIST,KARNATAKA STATE
4830 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
4831 SHREE VIDYA NIKETAN TRUST #353/1901, NEAR NIRUPAMA APPARTMENT, NAYAPALLI, BHUBANESWAR,ODISHA
4832 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
4833 SHRESTH WELFARE TRUST SHRESTH WELFARE TRUST PRAGATI WEB WORLD NEAR DR. SONALI DESHMUKH HOSPITAL RUKHMINI NAGAR AMRAVATI
4834 SHREWD MANPOWER CONSULTANTS PRIVATE LIMITED #306 A, PANCOM BUSINESS CENTER, OPP. CHENNAI SHOPPING MALL, AMEERPET, HYDERABAD
4835 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
4836 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
4837 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
4838 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
4839 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
4840 SHRI BALAJI INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED DUBEY COLONY MOWA RAIPUR
4841 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
4842 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI,
4843 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI, RAIPUR, CHHATTISGARH
4844 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
4845 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
4846 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
4847 SHRI DADASAHEB GAWAI CHARITABLE TRUST AMRAVATI CONGRESS NAGAR ROAD SHYAM NAGAR AMRAVATI
4848 SHRI DAMARAM MEMORIAL SHIKSHAN AVM PRESHIKSHAN SANSTHAN NAGAUR NEAR BASNI OVER BRIDGE, SANJAY COLONY, NAGAUR
4849 SHRI DAUJI REWATI INFRABUILD PRIVATE LIMITED H. NO. 31/177-A, PREM NAGAR, RAJPUR CHUNGI AGRA AGRA UTTAR PRADESH 282001
4850 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
4851 SHRI DIGAMBER PRASHIKSHAN AVAM ANUSANDHAN SANSTHAN A-131, RANJEET NAGAR, BHARATPUR RAJASTHAN
4852 SHRI DURGA SANKIRTAN JANTA SABHA DURGA BHAWAN COMPLEX, THE MALL SOLAN
4853 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
4854 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
4855 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
4856 SHRI GHARSHI RAM SHIKSHA SAMITI VILL-DHANI KIRAROD, POST-DHARSON
4857 SHRI GHARSI RAM SHIKSHA SAMITI VILL- DHANI KIRAROD,POST- DHARSOUN
4858 SHRI GOPAL DARBAR LOK KALYAN SAMITI GANDHI NAGAR MAHOBA UP
4859 SHRI GOPAL DARBAR LOK KALYAN SAMITI GHATKOTRA MAURANIPUR
4860 SHRI GOPAL DARBAR LOK KALYAN SAMITI VILLAGE POST GHATKOTRA TEH MAURANIPUR DISTT JHANSI UP
4861 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
4862 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
4863 SHRI GURU HARGOVIND SOCIETY 13, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4864 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
4865 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4866 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4867 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
4868 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST STANFORD INTERNATIONAL SCHOOL,MERRUT-SONEPAT ROAD, PALRI, NEAR GLAXO COMPANY, SONEPAT
4869 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST 408, AGGARWAL PRESTIGE MALL, PLOT NO. 02, COMMUNITY CENTRE, PITAMPURA, DELHI
4870 SHRI JAGDAMBA BAL VIDYA MANDIR SULTANGARH FATEHPUR UP VILL SULTANGARH SULTANGARH BINDKI
4871 SHRI JAGDAMBA MATA SHIKSHAN KRIDA BAHUUDDESHIYA SANSTHA TAMBOLA AT POST TAMBOLA TA LONAR DIST BULDHANA
4872 SHRI JAI SHIVANAND JI SANSTHAN VILLAGE BHADERDA POST KHATUPURA
4873 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
4874 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
4875 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
4876 SHRI JYOTIRLING CHARITABLE TRUST 2ND FLOOR,BHAGYALAXMI APPARTMENT,STATION ROAD,SACHIN,SURAT
4877 SHRI JYOTI SERVICES P LTD H-17 IST FLOOR, SOUTH EXTENTION-I DELHI DL 110049 IN
4878 SHRI JYOTI SERVICES PVT LTD H.NO 17, 1ST FLOOR,SOUTH EXTENSION,DELHI
4879 SHRI KALYAN WOMEN WELFARE SOCIETY BEHIND SBBJ BANK V&P DANTARAMGARH DIST. SIKAR (RAJASTHAN)332703
4880 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS SHRINAGAR COLONY MANDLESHWAR
4881 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS MAHESHWAR ROAD SHRINAGAR COLONY MANDLESHWAR
4882 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS SHRINAGAR COLONY MAHESHWAR ROAD MANDLESHWAR
4883 SHRI KHANDERAI BAHUUDESHIYA VIKAS SANSTHA GAYATRI APPARTMENT ,FLAT NO-8,GOAPLAWADI,TAL-DAUND,DIST-PUNE
4884 SHRI KHANDERAI BAHUUDESHIYA VIKAS SANSTHA GAYATRI APPARTMENT,FLAT NO-8,GOPALWADI,TAL-DAUND,DIST-PUNE
4885 SHRI KHANDERAI BAHUUDESHIYA VIKAS SANSTHA GAYATRI APPARTMENT ,FLAT NO-8,GOAPLAWADI,TAL-DAUND,DIST-PUNE
4886 SHRI KHERAPATI MAHARAJ SHIKSHA SAMITI BRIJPUR ROAD, ARROO TIRAHA, DABRA
4887 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
4888 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
4889 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
4890 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
4891 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED. MAHARASHTRA
4892 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI. TQ.DIST.NANDED. MAHARASHTRA
4893 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED MAHARASHTRA
4894 SHRI KUTCH JAN KALYAN SAMITI BHUJ 200, 2ND FLOOR, SHANTI CHABMERS, OPP. SBI BANK, STATION ROAD, BHUJ
4895 SHRI LIXMAN SINGHJI MEMORIAL EDUCATIONAL AND WELFARE SOCIETY MARWAR MUNDWA UNCHI GALI, MARWAD MUNDWA VILLAGE AND TEHSIL MARWAD MUNDWA, DISTRICT NAGAUR
4896 SHRI MAHALAXMI MULTI PURPOSE CO OP SOCIETY LTD TOPINKATTI, TAL: KHANAPUR, DIST: BELGAUM
4897 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
4898 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
4899 SHRIMATI JWALA DEVI MEMORIAL TRUST C/O CORDIA INSTITUTE, VPO SANGHOL, NH 95
4900 SHRIMATI JWALA DEVI MEMORIAL TRUST CORDIA GROUP OF INSTITUTION, VPO SANGHOL, TEH KHAMONO, DIST FATHEGARH SAHIB, PUNJAB
4901 SHRI MISHRI DUBE MEMORIAL SANSTHAN PATEL MAIDAAN,KAZIPURA,KEKRI,AJMEER
4902 SHRI MISHRI LAL DUBE MEMORIAL SANSTHAN PATEL MAIDAAN KAZIPURA, KEKRI,AJMER
4903 SHRI MISHRI LAL DUBE MEMORIAL SANSTHAN PATELMAIDAAN,KAZIPURA,KEKRI,AJMER
4904 SHRI MISHRI LAL DUBEY MEMORIAL SANSTHAN PATEL MAIDAAN,KAJIPURA,KEKRI,AJMER
4905 SHRI MOHANRAO DESHPANDE EDUCATION SOCIETY A/P-AJRA, TAL-AJRA, DIST-KOLHAPUR, MAHARASHTRA
4906 SHRI MOOLPURI JI COMPUTER EDUCATION AND INFORMATION TECHNOLOGY TRAINING SANSTHAN JAISALMER 444 MADHAV MARG GANDHI COLONY JAISALMER
4907 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 331, ANAURA, NEAR INDIRA CANAL, FAIZABAD ROAD
4908 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
4909 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
4910 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 331, ANAURA, FAIZABAD ROAD, NEAR INDIRA CANAL, LUCKNOW
4911 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
4912 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
4913 SHRI NILKANTH SAMAJ SEVA TRUST AT TATAM GADHADA - BOTAD ROAD TA. GADHADA DIST - BOTAD
4914 SHRI NILKANTH SAMAJ SEVA TRUST AT TATAM GADHADA-BOTAD ROAD DIST- BOTAD
4915 SHRI NILKANTH SAMAJ SEVA TRUST AT TATAM TATAM GURUKUL GADHADA-BOTAD RAOD DIST - BOTAD 364750
4916 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
4917 SHRI OM NAMO SHIKSHAN SANSTHAN V/P - BORUNDA, TEH.- PIPARCITY DIST.- JODHPUR RAJASTHAN
4918 SHRI OM PARKASH BANSAL EDUCATIONAL AND SOCIAL WELFARE TRUST RIMT UNIVERSITY, SIRHIND SIDE, MANDI GOBINDGARH
4919 SHRI PAULRAJ ALAGESH EDUCATIONAL TRUST NO.144, MOUNT POONAMALLEE HIGH ROAD, AYYAPANTHANGAL, CHENNAI.
4920 SHRI PAULRAJ ALAGESH EDUCATIONAL TRUST 144,MOUNT POONAMMALLE HIGH ROAD,AYYAPANTHANGAL,CHENNAI
4921 SHRI PAULRAJ ALAGESH EDUCATIONAL TRUST 144,MOUNT POONAMMALLE HIGH ROAD,AYYAPANTHANGAL,CHENNAI
4922 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4923 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4924 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4925 SHRI PITAMBRA VIDHYAPEETH NYAS JR MIG 1/1 GEETANJALI COMPLEX KOTRA SULTANABAD BHOPAL
4926 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4927 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
4928 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
4929 SHRI RAMANA FOUNDATION 26F/16 RMS ROAD, NAGAL NAGAR,DINDIGUL
4930 SHRI RAMANA FOUNDATION 26F/16 R.M.S ROAD, NAGAL NAGAR, DINDIGUL
4931 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4932 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4933 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
4934 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITI KARAHI
4935 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITI KARAHI
4936 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITIA KARAHIFATEHPURSIKRIAGRA
4937 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
4938 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
4939 SHRI RAM SIKHAN AWM SEVA SANSTHAN VILL-KUSHMAHA(BHAGWANAPUR),VIA-LAXMIGUNJ,DIST-KUSHINAGER(U.P.)274305
4940 SHRI RAM SKILLS DEVELOPMENT PRIVATE LIMITED MAIN BARWALA ROAD, VIRAT NAGAR,HANSI, DIST HISAR.
4941 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4942 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4943 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4944 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4945 SHRI SADGURU SAI SAMARTH JEEVAN ADHAR SAMAJIK SANSTHA BRANCH GADHINGLAJ BHADGAON ROAD,DOCTOR COLONY,NEAR SHIVSAGAR HOTEL,GADHINGLAJ
4946 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
4947 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
4948 SHRI SANT GAJANAN MAHARAJ BAHUUDDESHYTA SHISKSHAN SANSTHA SAWALAPUR AT PURNA NAGAR TQ BHATKULI DIST AMRAVATI
4949 SHRI SHAMJIBHAI HARJIBHAI TALAVIYA CHERITABLE TRUST RK UNIVERSITY, KASTURBADHAM, BHAVNAGAR RAJKOT HIGHWAY
4950 SHRI SHAMJIBHAI HARJIBHAI TALAVIYA CHERITABLE TRUST RK UNIVERSITY,RAJKOT BHAVNAGAR HIGHWAY, KASTURBADHAM RAJKOT
4951 SHRI SHAMJIBHAI HARJIBHAI TALAVIYA CHERITABLE TRUST RK UNIVERSITY, KASTURBADHAM, RAJKOT - BHAVNAGAR HIGHWAY, RAJKOT
4952 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
4953 SHRI SHIKSHA PRASAR EVAM JANKALYAN SAMITI 26,BAJARIYA MOHALLA SEONDHA DISTT DATIA MADHYA PRADESH
4954 SHRISHTI HELPING HANDS WELFARE SOCIETY A-602 NEW ASHOKA GARDEN, 80 FEET ROAD,BHOPAL
4955 SHRI SIDDHIVINAYAK EDUCATION SOCIETY CINEMA ROAD WARD NO 6 JUNNARDEO
4956 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
4957 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
4958 SHRI SWAMY RAMA FOUNDATION TRUST THE SWAMI RAM FOUNDATION TRUST, RAM NAGAR, SWAMI RAM MARG, VILLAGE BHUREWALA NARIANGARH134 203, DISTTAMBALA, HARYANA, REWA, HARYANA, INDIA
4959 SHRI THAKUR JI EDUCATIONAL WELFARE TRUST 17/213 BHARAULI BAZAR STATION ROAD, DEORIA
4960 SHRI VIDYAPATI VIDYA PARISHAD SHRI VIDYAPATI ACADEMY GEEDAM ROAD BAHADURGUDA JAGDALPUR BASTAR
4961 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
4962 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
4963 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
4964 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
4965 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
4966 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
4967 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
4968 SHTI VA SHETKARI VIKAS BHUUDESHIYA SANSTHA JALNA M-15 CHOUDHARI NAGAR, MANTHA ROAD, JALNA
4969 SHTI VA SHETKARI VIKAS BHUUDESHIYA SANSTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA TQ.DIST. JALNA. (MH)
4970 SHUBHANGI CHANDAN SKILLS PRIVATE LIMITED B-481 SUSHANT CITY BHILWARA RAJASTHAN 311001
4971 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
4972 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
4973 SIDDIQE MEMORIAL FOUNDATION PAPU PICTER PLACE SUJAWALPUR PO+PS-SAKRA MUZAFFARPUR
4974 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
4975 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
4976 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
4977 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
4978 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
4979 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
4980 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
4981 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
4982 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT F/S GOVINDPURI EXTENTION NEW DELHI 110019
4983 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
4984 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
4985 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
4986 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
4987 SIKSHYA BHARATI TRUST AT-COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK
4988 SIKSHYA BHARATI TRUST SIKSHYA BHARATI TRUST COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK STATE-ODISHA
4989 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
4990 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
4991 SILIGURI GLOBAL ENGINEERING INSTITUTE THIKNIKATA, PLOT NO. 94/180, PS. MATIGARA, PO. SUSHRUTNAGAR, (OPP. NORTH BENGAL MEDICAL COLLEGE), SILIGURI, NEAR AMIT AGARWAL BAHWAN, DARJEELING
4992 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD
4993 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD
4994 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD- 382481
4995 SILVER RESORT HOTEL INDIA PRIVATE LIMITED 263C AROSSIM, CANSAULIM, GOA
4996 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
4997 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4998 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4999 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
5000 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
5001 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
5002 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
5003 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
5004 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
5005 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
5006 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
5007 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
5008 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
5009 SINGH INTELLIGENCE SECURITY PRIVATE LTD G-3/1, MLD, COMMERCIAL CENTER, CROSS ROAD A, ANDHERI, MUMBAI, - 400093 MAHARASTRA, INDIA
5010 SINGH INTELLIGENCE SECURITY PVT LTD SHANTI MILL COMPUND MAROL IND.CORPORATION MITTAL ESTATE ANDHERI (EAST) MAHARASHTRA, MUMBAI
5011 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
5012 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
5013 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
5014 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
5015 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
5016 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
5017 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
5018 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
5019 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
5020 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
5021 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
5022 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
5023 SISHU KALYANA SWADHIKARA KENDRA HEAD OFFICE AT - RUGUDIPARA, SAI MANDIR LANE PO/DIST - BALANGIR, ODISHA
5024 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
5025 SITA INFRA AND SERVICES PVT LTD "SITA INFRA AND SERVICES 301,JUBEAD COMPLEX,EXIBTION ROAD,PATNA"
5026 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
5027 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
5028 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
5029 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
5030 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
5031 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
5032 SJP HOTELS AND RESORTS PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
5033 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO-VC-2, MAHALUXMI PLAZA, SEC-3, VAISHALI, GHAZIABAD
5034 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO. V-2, MAHALUXMI PLAZA, SECTOR-3, VAISHALI, GHAZIABAD
5035 SJS SKILLS DEVELOPMENT CENTER A UNIT OF SHRI JYOTI SERVICES P LTD SM KUTEER ,92 CIVIL LINE MEERUT CANTT
5036 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
5037 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
5038 SKILL DEVELOPMENT AND INFORMATION SOCIETY LIG-147 DINDAYAL COLONY, BHILAI
5039 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
5040 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
5041 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
5042 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
5043 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
5044 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
5045 SKILL POINT CAREER DEVELOPMENT WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYAPALAYAM,ERODE
5046 SKILL POINT CAREER DEVELOPMENT WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYAPALAYAM,
5047 SKILL POINT CAREER DEVELOPMENT WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYAPALAYAM,ERODE,TAMILNADU
5048 SKILL POINT CAREER WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYA PALAYAM,ERODE
5049 SKILLPRO TECHNOLOGIES PVT LTD 2ND FLOOR, 33 SUBASH ROAD, DEHRADUN UTTARAKHAND
5050 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
5051 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
5052 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
5053 SKILLSONICS INDIA PRIVATE LIMITED SKILLSONICS INDIA PRIVATE LIMITED, 550 A, GROUND FLOOR, 8TH MAIN, 4TH BLOCK, KORAMANGALA, BANGALORE
5054 SKILLSONICS INIDA PRIVATE LIMITED #12, 2ND FLOOR, 17TH 'A' MAIN, 5TH BLOCK, K0RAMANGALA, BANGALORE.
5055 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
5056 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
5057 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
5058 SKILL VISION SOCIAL EDUCATIONAL SOCIETY 81 KOHARAPEER THALIWALAN CHOWK BAREILLY
5059 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
5060 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
5061 S K MANDAL FOUNDATION ROAD NO.-5, PURVI PATEL NAGAR , NEAR GANDHI MURTI , PATNA
5062 S K SEWA SAMITI CHANDNI CHOWK, PURANI ABADI, SRI GANGANAGAR - 335001 RAJASTHAN
5063 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
5064 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
5065 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
5066 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
5067 SKYNET FOUNDATION SHREE AMBALAL UPADHYAY SAHAKAR BHAVAN, NR. SAHAKAR HALL, AMBAWADI,
5068 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
5069 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TECHNICAL INSTITUTE, SHREE AMBALAL UPADHYAY SAHAKAR BHAVAN, NR. SAHAKAR HALL, AMBAWADI
5070 SKY ORGANAIZATION HEBBAGODI, HOSUR ROAD BANGALORE. ANEKAL TQ BANGALORE DIST.
5071 SLC EDUCATIONAL SOCIETY 101, 1-11-112/2 CHAKRAVARTHY TOWERS SHYAMLAL BUILDINGS BEGUMPET, HYDERABAD
5072 SMARAN UDYOG PRIVATE LIMITED OFFICE NO.208, SHRI KRISHNA PLAZA, ALEKAR MARKET,NARAYANGAON, TAL - JUNNAR, DIST - PUNE
5073 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
5074 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
5075 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
5076 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
5077 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
5078 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARATHAHALLI, ABOVE DOMINO OR IMPERIAL HOTEL
5079 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING LAYOUT, MUNNEKOLLALA, MARATHAHALLI
5080 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARATHAHALLI, BANGALORE
5081 SMART GROUP OF EDUCATION SOCIETY K.S.R.T.C DEPOT ROAD, BESIDE CHAMUNDESHWARI TEMPLE, CHITRADURGA
5082 SMART MODERN SHIKSHAN SANSTHAN VPO- BAGHOLI TEH-UDAIPURWATI DIST-JHUNJHUNU RAJASTHAN
5083 SMART MODERN SHIKSHAN SANSTHAN VPO-BAGHOLI, TEH-UDAIPURWATI,JHUNJHUNU,RAJASTHAN
5084 SMARTONE TECHNO SOFT PRIVATE LIMITED NARURANGABAD, COURT ROAD, ETAWAH-206001
5085 SMART SKILL TECH PRIVATE LIMITED PLOT NO 137 SEC 24
5086 SMARTSTEPS CONSULTING PRIVATE LIMITED # 201 & 214, 2ND FLOOR, TOPAZ BUILDING, PANJAGUTTA, HYDERABAD
5087 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
5088 SMARTTRICKTECH PRIVATE LIMITED GROUND FLOOR SHOP NO 1MOHALLA CHAWAD BY PASS ROAD SASNI
5089 SMART ZONE GUNJABARI
5090 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
5091 SMITA MAHILA SHIKSHAN SANSTHAN 567 ANAND COLONY BALDEOBAG JABALPUR MADHYA PRADESH 482002
5092 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
5093 SMT DEVKI DEVI SEVA SAMITI L.I.G. GOVIND PUR ALLAHABAD
5094 SMT DEVKI DEVI SEVA SAMITI LIG 123 GOVINDPUR ALLAHABAD
5095 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
5096 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
5097 SMYAK MAGASVARGIYA BAHUUDESHIYA SEVABHAVI SANSTHA JALNA SMYAK NIVAS PLOT NO 20,NEAR VRUNDAVAN NARSARI BHAGYA NAGAR OLD JALNA
5098 SMYAK MAGASVARGIYA BAHUUDESHIYA SEVABHAVI SANSTHA JALNA 1ST FLOOR LUCKY PAINT NUTAN VASAHAT ABAD ROAD JALNA
5099 SNAP NEAR MANIPAL HOSPITALS
5100 SNC INFOTECH PRIVATE LIMITED KC-114, KAVI NAGAR , GHAZIABAD
5101 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
5102 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
5103 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
5104 SN JYOTI ASSOCIATES PRIVATE LIMITED SN JYOTI ASSOCIATES PRIVATE LIMITED 959, MAHAVIR NAGAR, ROAD NO-3, GOVIND PRASAD, JHARPADA, BHUBANESWAR ORISSA, INDIA
5105 SNS FOUNDATION 508, 3RD FLOOR, JAISWAL COMPLEX, SAKCHI, JAMSHEDPUR EAST SINGHBHUM
5106 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
5107 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
5108 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
5109 SOCIAL AGRICULTURE CHILDRENS EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMABAKKUDI TALUK, PUDUKKOTTAI DISRICT.
5110 SOCIAL AMELIORATION SOCIETY OPP. GP WOMEN COLLEGE, OLD LAMBULANCE, CENTRAL JAIL RD, IMPHAL, MANIPUR 795001
5111 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
5112 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
5113 SOCIAL DEVELOPMENT ORGANISATION H.NO. 50, MASOUD ALI BUILDING, TAAJ LEIRAK, HAFIZ HATTA, IMPHA EAST,MANIUR -7095001
5114 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
5115 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 4 HOUSE NO C-31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR NEW DELHI
5116 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 3 HOUSE NO C 31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR
5117 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
5118 SOCIAL ORGANISATION FOR TRANSFORMATION C/O SHALI BHADRA MUTHA ,255, IN FRONT OF GOPAL MANDIR,MAIN ROAD, SADAR MARKET,RAIPUR,C.G.
5119 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
5120 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
5121 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
5122 SOCIAL WELFARE ASSOCIATION OF RURAL DEVELOPMENT AT-SAHANI MARKET,NEAR ZILA SCHOOL BHATTA BAZAR,PURNIA
5123 SOCIAL WELFARE ASSOCIATION OF RURAL DEVELOPMENT SAHANI MARKET,ZILA SCHOOL ROAD PURNIA,PIN-854301
5124 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
5125 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
5126 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
5127 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
5128 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
5129 SOCIETY 501 SAI JYOTHI RESIDENCY OFF HITEX ROAD IZZATH NAGAR KOTHAGUDA HYDERABAD
5130 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT SATHEE (SOCIETY FOR ADVANCEMENT IN TRIBES, HEALTH, EDUCATION AND ENVIRONMENT) CHITRAGUPTA COLONY BEHIND GODDA COLLEGE, GODDA-814133 JHARKHAND
5131 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT CHITRAGUPTA COLONY, BEHIND GODDA COLLEGE, GODDA
5132 SOCIETYFORADVANCEMENTINTRIBESHEALTHEDUCATIONANDENVIRONMENTSATHEE CHITRAGUPTA COLONY,BEHIND GODDA COLLEGE,GODDA
5133 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
5134 SOCIETY FOR AWARENESS AND INVOLVEMENT FOR FUTURE IMPROVEMENTS DOOR NO. 11-2-165, MARKET STREET, RAYADURG, ANANTHAPUR DIST
5135 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
5136 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
5137 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
5138 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
5139 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
5140 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
5141 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
5142 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
5143 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
5144 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
5145 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
5146 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
5147 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
5148 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
5149 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEVELOPMENT VILLAGE & P.O- KANISHAIL P.S & DISTRICT- KARIMGANJ
5150 SOCIETY FOR EDUCATION AND SOCIAL ACTIVITIES FF-31, SF-30,31,19,VATSALYA STATUS, OPP RAILWAY STATION, KADI
5151 SOCIETY FOR EDUCATION AND VOCATIONAL TRAINING 704, NAVEEN APARTMENTS, SAINIK VIHAR, PITAMPURA, NEW DELHI - 110034
5152 SOCIETY FOR EDUCATION AND VOCATIONAL TRAINING 704, NAVEEN APARTMENTS, SAINIK VIHAR, PITAMPURA, NEW DELHI
5153 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
5154 SOCIETYFORHEALTHACTIONDEVELOPMENTANDENVIRONMENTALSERVICES PLOT NO-468/3A, SHREE VIHAR, PATIA, CHANDRASEKHARPUR, BHUBANESWAR
5155 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
5156 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
5157 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
5158 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
5159 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
5160 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
5161 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
5162 SOCIETY FOR INFRASTRUCTURAL PROMOTION AND RURAL ADVANCEMENT AT- GANGANIWAS, NEW RAUSAPATANA PO-BAXIBAZAR PS-PURIGHAT, DIST - CUTTACK
5163 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.)
5164 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.)
5165 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.) 05922-262075,09410681250
5166 SOCIETY FOR INTEGRATED PROGRAMMES NO - 48A, MAHAL VADAMPOKKI STREET, MADURAI - 625001.
5167 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
5168 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
5169 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
5170 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
5171 SOCIETY FOR RESOURCE INTEGRATION AND DEVELOPMENT ACTION SRIDA CENTRE POST - BARELA MANDLA ROAD, JABALPUR DISTRICT
5172 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
5173 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
5174 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
5175 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
5176 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
5177 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI,NEW DELHI-110075
5178 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
5179 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
5180 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
5181 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
5182 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
5183 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
5184 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
5185 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY MAHAKAUSHAL NAGAR, BEHIND – SARASWATI H. S. SCHOOL, ADHARTAL, JABALPUR, MADHYA PRADESH, INDIA. PIN- 482 004
5186 SOCIETY OF ORIENTAL COMPUTER INFORMATION EDUCATION AND TRAINING FOR YOUTH 501, SAI JYOTHI RESIDENCY, HITEX ROAD, IZZATH NAGAR, KOTHAGUDA,HYDERABAD.
5187 SOCIETY OF ORIENTAL COMPUTER INFORMATION EDUCATION AND TRAINING FOR YOUTH 501, SAI JYOTHI RESIDENCY, ADITYA SUNSHINE LANE,NEAR CYBER CONVENCTIONS, KOTHAGUDA, KONDAPUR.
5188 SOCIETY OF ORIENTAL COMPUTER INFORMATION EDUCATION AND TRAINING FOR YOUTH 501, SAI JYOTHI RESIDENCY, HITEX ROAD, IZZATH NAGAR, KOTHAGUDA,HYDERABAD.
5189 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
5190 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
5191 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
5192 SOCIETY TOWARDS OPERATION POLLUTION REGISTERED OFFICE: R-613, MANGOL PURI, BRANCH OFFICE: H.NO. RZB- 10 KH.NO. 79/16/2, NIHAL VIHAR, NANGLOI
5193 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
5194 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
5195 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
5196 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
5197 SOFT BIT COMPUTER EDUCATION SOCIETY NEAR HANUMAN MANDIR DHIMRAPUR CHOUK JINDAL ROAD RAIGARH
5198 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
5199 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
5200 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
5201 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
5202 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
5203 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
5204 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
5205 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
5206 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
5207 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
5208 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
5209 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
5210 SONAPUR PALLY UNNAYAN SAMITY SONAPUR PART-I,PO-SONAPUR,DISTRICT-CACHAR
5211 SONARPUR SWAMI VIVEKANANDA MANAS MISSION VILL- GHASIARA, P.O.+P.S.- SONARPUR, DIST-SOUTH 24 PARGANAS, KOLKATA-700150, WEST BENGAL
5212 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
5213 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
5214 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
5215 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
5216 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
5217 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
5218 SONY XPERIA FGFDGFGFD
5219 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
5220 SOS CARE C-88/A, GF, KAUSHIK SADAN, GALI NO.3, JANTA GARDEN, PANDAV NAGAR, DELHI-110091
5221 SOS CARE INDIA C-88/A,GF, GALI NO.3,KAUSHIK SADAN, JANTA GARDEN,PANDAV NAGAR,DELHI-91
5222 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
5223 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
5224 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR
5225 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR (CG)
5226 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
5227 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 2 FERN ROAD 2ND FLOOR KOLKATA 700019
5228 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 74 TOPSIA ROAD SOUTH TOPSIA KOLKATA 700048
5229 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 2 FERN ROAD 2ND FLOOR KOLKATA 700019
5230 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
5231 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
5232 SOUTH KADAMTALA RURAL WELFARE SOCIETY BALIADANGA MORE,BALIADANGA, KALIACHAK, MALDA, PIN- 732201, W.B.
5233 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, PIN - 700031
5234 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
5235 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
5236 SOUTH TRAVANCORE AGENCY FOR RURAL DEVELOPMENT JMM CENTRE, MAR THOMA KENDRAM, MANNANTHALA, THIRUVANANTHAPURAM
5237 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
5238 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
5239 SOVEREIGN BUSINESSES PRIVATE LIMITED F-6, TIRTHRAJ APARTMENT JACOB ROAD CIVIL LINES JAIPUR
5240 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
5241 SPANDANA SWAYAM SEVA TRUST NEAR TALUK OFFICE AZAD RODE THIRTHAHALLI SHIMOGA KARNATAKA 577432
5242 SPARK HEALTH CLINICAL SERVICES PRIVATE LIMITED PLOT NO: 2 & 3, GROUND FLOOR, PANKAJ TOWERS, RAGHAVENDRA COLONY, PEERJADI GUDA, UPPAL, HYDERABAD
5243 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
5244 SPARSH 310 CHANDRALOK TOWER KAPOORTHALA, LUCKNOW
5245 SPARTA SECURITY AND ALLIED SOLUTIONS PRIVATE 11, 12 D 63/7-A, UPPER GROUND FLOOR, SURYA COMPLEX, PHASE 1, SURYA BAGH COLONY, MAHMOORGANJ, VARANASI - 221010, UTTAR PRADESH, INDIA
5246 SPARX RURAL AND URBAN DEVELOPMENT SOCIETY SRUDS 13-227/LAXMAREDDY COMPLEX,SAI KRISHNA NAGAR,MEDCHAL.501401
5247 SPBL ENERGY PVT LTD 901 B BLOCK PANKI
5248 SPBL ENERGY PVT LTD 901 B BLOCK PANKI
5249 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
5250 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
5251 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
5252 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
5253 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
5254 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
5255 S P GRAMYA VIKAS AVAM GRAMODYOG SANSTHAN 636/431 TAKROHI POST CHINHAT SECTOR 11 INDIRA NAGAR LUCKNOW UP
5256 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
5257 SP MEMORIAL EDUCATIONAL TRUST FIRST FLOOR VINAYAK TOWER 28 MAHATMA GANDHI MARG CIVIL LIONES
5258 SR ASIA 4F-CS-25, ANSAL PLAZA, VAISHALI, GHAZIABAD INDIA
5259 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
5260 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
5261 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
5262 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
5263 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
5264 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
5265 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
5266 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
5267 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
5268 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
5269 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
5270 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
5271 SREE SAI RAM EDUCATIONAL SOCIETY