Rejected Applications
Sr. No. Name Address
1 10 D WELFARE AND DEVELOPMENT TRUST SOLGOLIA, ATAGHARA, MADARAT, BURIPUR
2 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
3 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
4 982 PARKAL WARANGAL DISTRICT ANDHRA PRADESH 9-82 PARKAL WARANGAL DISTRICT ANDHRA PRADESH.
5 A2Z MULTISERVICES AND IT SOLUTIONS PVT LTD H.NO.201/7,DOCTORS COLONY,CIVIL LINES,BAREILLY MOB:9897033301
6 A2Z MULTISERVICES IT SOLUTIONS PVT LTD PLOT NO. 272, NH-30, HARDUA NAWABGANJ, BAREILLY
7 AAA AAA
8 AAA BBB JABBALPUR, KATHMANDU,
9 AAA SOCIETY A AA AAAAAAAAAAAAAA
10 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
11 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 NEAR BY DR. VIJAY GANDHI, BAIHAR ROAD C/O PANCHSHEEL COMPUTER BALAGHAT DIST- BALAGHAT
12 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 BAIHAR ROAD BESIDE OF DR GANDHI C/O PANCHSHEEL COMPUTER BALAGHAT DIST-BALAGHAT
13 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 NEAR BY DR. VIJAY GANDHI, BAIHAR ROAD C/O PANCHSHEEL COMPUTER BALAGHAT DIST- BALAGHAT
14 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 NEAR BY DR. VIJAY GANDHI, BAIHAR ROAD C/O PANCHSHEEL COMPUTER BALAGHAT DIST- BALAGHAT
15 AADARSH SAMAJIK SANSTHA AT POST GHULEWADI AADARSH NAGAR SURVEY NO 58 TAL SANGAMNER DIST AHMEDNAGAR
16 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
17 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
18 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
19 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
20 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
21 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
22 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
23 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
24 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
25 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
26 AAKASH CONDUCTORS AND WIRES INDIA PRIVATE LIMITED 14-B, NEW INDUSTRIAL ESTATE, RAWABHATA, RAIPUR C.G.
27 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
28 AAMC TRAINING INDIA PRIVATE LIMITED 026, SMARTWORKS BUSINESS CENTRE, LOGIX BUSINESS PARK, C-28,29 SECT-62 NOIDA-201309, INDIA
29 AAMC TRAINING INDIA PRIVATE LIMITED 702-A, 7TH FLOOR, TOWER NO. 2 BLOCK B, PANCHSHEEL WELLINGTON, SECTOR-1- CROSSING REPUBLIK GHAZIABAD.
30 AAMC TRAINING INDIA PRIVATE LIMITED AAMC TRAINING INDIA PRIVATE LIMITED 702-A, 7TH FLOOR, TOWER NO. 2, B-BLOCK PANCHSHEEL WELLINGTON, SECTOR-1, CROSSING REPUBLIK GHAZIABAD--
31 AAMC TRAINING INDIA PRIVATE LIMITED H.NO. 702-A, 7TH FLOOR , TOWER NO. 2 BLOCK -B, PANCHSHEEL WELLINGTON, SETOR-1, CROSSING REPUBLIK GHAZIABAD
32 A AND A EDUCATIONAL AND IT SOLUTIONS PLOT NO.170, VENKATESWARA COLONY, PADMAVATI NAGAR, VIZIANAGARAM
33 A AND A EDUCATIONAL AND IT SOLUTIONS PLOT NO 170, VENKATESWARA COLONY, PADMAVATI NAGAR, VIZIANAGARAM
34 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
35 AARAV MEDISHINE PRIVATE LIMITED 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.- DURG (C.G.)
36 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
37 AARNOVA TECHNOLOGIES PRIVATE LIMITED PLOT NO. 357-B, 2ND FLOOR, SECTOR-37, PACE CITY-II, UDYOG VIHAR, PHASE-VI, GURGAON
38 AARNOVA TECHNOLOGIES PRIVATE LIMITED 1104,VIKRANT TOWER,RAJENDRA PLACE,NEW DELHI
39 AARNOVA TECHNOLOGIES PRIVATE LIMITED 1104, RAJENDRA PLACE, VIKRANT TOWER, NEW DELHI
40 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
41 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
42 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
43 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
44 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
45 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
46 AARTHI A1 TRADERS 9D/14, 50 FEET ROAD, RAMAKRISHNAPURAM, KARUR
47 AARTI EDUCARE PVT LTD AARTI EDUCARE PVT LTD, SUPREME TECHNOCRATS PVT LTD, PLOT E-50, MIDC, NASHIK
48 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
49 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
50 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
51 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
52 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
53 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
54 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
55 AASHKA INFOCOM PVT LTD A-61, KARMACHARI NAGAR PART-2, NR. PARASMANI FLAT, RANNA PARK, GHATLODIA, AHMEDABAD
56 AAS HUMAN WELFARE SOCIETY VILLAGE DILRA RAIPUR AKKA DILARI RAMPUR ROAD MORADABAD
57 AASTHA EDUCATION AND WELFARE SOCIETY C/O,ABHAYKUMAR DANDAGE, F-5,SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
58 AASTHA EDUCATION AND WELFARE SOCIETY C/O, ABHAYKUMAR DANDAGE, SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
59 AASTHA EDUCATION AND WELFARE SOCIETY C/O ABAHYKUMAR DANDAGE F-5 SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
60 AASTHA SANSKRITIK EVAM SAMAJIK KALYAN SAMITI PLOT, NO. 160, 2ND FLOOR, ZONE-1 , M.P. NAGAR BHOPAL
61 AASTHA VIKAS TRUST 205 B 21ST CENTURY BUSINESS CENTER RING ROAD SURAT
62 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO.1, SUMSUL AARIFFA NAGAR, PERIYAR SALAI ROAD, KEELAVASAL, THANJAVUR
63 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
64 AATHI ANBU CHARITABLE TRUST 194/6,KASPA STREET, MELAPILLAYAR KULAM, TIRUNELVELI.
65 AATHRATH JAMMU AND KASHMIR PLOT NO 1 KANJIKULLAH ROAD YARIPORA
66 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
67 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
68 AAYUSHMAN SAMITY 2A- BASANT VIHAR COLONY,MAHAVIR NAGAR, RAIPUR CHHATISGARH
69 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
70 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
71 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
72 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
73 ABBASI EDUCATIONAL AND WELFARE TRUST C-1076, HASTSAL ROAD, UTTAM NAGAR,NEW DELHI
74 ABBASI EDUCATIONAL AND WELFARE TRUST A2/25B, FIRST FLOOR, HASTSAL ROAD, UTTAM NAGAR, NEW DELHI, NEAR HOLI CHOWK
75 ABC KALARA BURDWAN
76 ABC JKLJLJK
77 ABC JHSDJHDFKLJDFKJHJKGD
78 ABC BHOPAL
79 ABCD ADRS LINE 2
80 ABCD ABCDEFGHIJKLMNOP
81 ABCD ABCD
82 ABC FIRM LTD PATNA
83 ABCL EDUCATIONAL PRIVATE LIMITED 52/12, M.M.H. COLLEGE ROAD, MODEL TOWN WEST GHAZIABAD
84 ABCL EDUCATIONAL PRIVATE LIMITED 52/12 M.M.H. COLLEGE ROAD, MODEL TOWN WEST,GHAZIABAD
85 ABC PRIVATE LIMITED JHKSKRFUFIGJKFCIYKGLYUGDFTYC VF76IFOYFGOUL
86 ABC PVT LTD PUNE
87 ABC TRUST LKCNSDKAJD
88 ABDIN EDUCATINAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
89 ABDIN EDUCATIONAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
90 ABD PVT LTD XYZ
91 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
92 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
93 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
94 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
95 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
96 ABET TRADELINK PRIVATE LIMITED C/O RANJEET KUMAR CHOUDHARY VATSAYAN, CHANKYAPURI, GAUSHALA ROAD, RAMGARH JHARKHAND 829122
97 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
98 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
99 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
100 ABHINAYTOSH MAHILA BAL VIKAS SAMITI SEVA HOSPITAL PREMISES, PADMAKAR NAGAR, MAKRONIA, SAGAR, MADHYA PRADESH
101 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
102 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
103 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
104 ABHYUDAY VEDANT SOCIETY VANDE MATARAM BHAVAN, CHURCH ROAD KUNKURI, DIST. - JASHPUR
105 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
106 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
107 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
108 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
109 ACADEMY FOR CREATIVE TEACHING TRUST 6TH MAIN,HMT COLONY, OPT BUS DEPOT, R.T NAGAR BANAGALORE
110 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
111 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
112 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
113 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
114 ACAT EDUCATION PRIVATE LIMITED ACAT EDUCATION PRIVATE LIMITED,1ST FLOOR,RAJ COMPLEX,SANICHARA ASTHAN,DR. P.GUPTA ROAD,NEAR VIJAYA BANK,WARD-20,CHATTI,RATANPUR,BEGUSARAI (BIHAR,PIN-851101
115 ACCEL IT RESOURCES LIMITED NO.37 V FLOOR, CHATEAU D' AMPA BUILDING, NELSON MANICAKAM ROAD, AMINJIKARAI, CHENNAI, TAMILNADU
116 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
117 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
118 ACCESS SOLAR LTD PLOT NO.104, PRASHANTHI NAGAR, I.E.KUKATPALLY HYDERABAD – 500 072 TELANGANA, INDIA
119 ACCILERATOR SMARTGRO MARKETING PRIVATE LIMITED #1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARTHAHALLI
120 ACCION FRATERNA ACCION FRATERNA ECOLOGY CENTER, OPP. RDT STADIUAM, UPPARAPALLI ROAD, BANGALORE HIGHWAY, ANANTAPUR
121 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
122 ACCURATE EDUCATION AND RESEARCH SOCIETY C-187,SURYANAGAR, GHAZIABAD, UP
123 ACE CONSULTING PRIVATE LIMITED NO.309 2ND FLOOR DEEP PLAZA OPPOSITE GURGAON COURT SOHNA ROAD GURGAON HARYANA 122001
124 ACE FOUNDATION SHAKTINAGARAPADA,NEAR POLICE STATATION, BHAWANIPATNA
125 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
126 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
127 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
128 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
129 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
130 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
131 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
132 ACTION FOR ADVANCEMENT OF SOCIETY A-30, MADHAV RAO SAPARE NAGAR, BIRGAON, RAIPUR, CHHATTISGARH
133 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
134 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
135 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
136 ACTTS INFOTECH SERVICES PRIVATE LIMITED WARD NO.11 TARANAGAR CHURU
137 ADAIKALA MADHA TECHNICAL INSTITUTE TRUST ADAIKALA MADHA TECHNICAL INSTITUTE, THOOTHUR MAIN ROAD, ELAKURICHI VILLAGE & POST, THIRUMANUR - VIA, ARIYALUR - TK & DT, TAMIL NADU STATE, PIN - 621715.
138 ADAM TEST_XYZ
139 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
140 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
141 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
142 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
143 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
144 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
145 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
146 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
147 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
148 ADARSH FOODS CITY STATION ROAD KHURJA
149 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
150 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
151 ADARSH SHIKSHAN PRASARAK MANDAL OSMANABAD ADARSH SIHSHAN PRASARAK MANDAL, OSMANABD ADMINISTRATIVE BUILDING, SHRIPATRAO BHOSALE HIGH SCHOOL,CAMPUS TAMBRI VIBHAG, OSMANABAD
152 ADARSH SHIKSHAN PRASARAK MANDAL OSMANABAD PRASHASAKIYA BHAWAN SHRIPATRAO BHUSAE HIGH SCHOOL OSMANABAD MAHARASHTRA OSMANABAD-
153 ADARSH SHIKSHAN PRASARAK MANDHAL ADIMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD MAHARASHTRA
154 ADARSH SHIKSHAN PRASARAK MANDHAL ADMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD
155 ADARSH SHIKSHAN SAMITI KARELI MAHADEV WARD KARELI
156 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7,SALUMBER,DIST.UDAIPUR(RAJ.)
157 ADARSH SHIKSHA SAMITI PATELWADA,WARD O.7,SALUMBER,DIST.UDAIPUR(RAJASTHAN)
158 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7,SALUMBER
159 ADARSH SHIKSHA SAMITI PATELWADA,WARD NO.7, SALUMBER, DIST.UDAIPUR(RAJASTHAN)
160 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
161 ADARSH VIDHYA SAMITI 87 UTTAMGIRI COLONY,NEAR DOUBLE CROSSING, SHASTRIPURAM AGRA
162 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
163 ADEPT EDUSYS PRIVATE LIMITED HALL NO. 6,11 NO STOP,ARERA COLONY,BHOPAL,(M.P.)
164 ADEPTEDUSYSPVTLTD HALL NO.-6,11 NO. STOP,ARERA COLONY,BHOPAL(M.P.)
165 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
166 ADESHWAR SHIKSHAN SAMITI 26 MEDICAL COMPLEX,G.E ROAD, RAIPUR, C.G
167 ADESHWAR SHIKSHAN SAMITI 26 MEDICAL COMPLEX, G.E ROAD RAIPUR,CHHATISGARH
168 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
169 ADHARSHA MAHILA MANDALI PULLUR,KURNOOL MANDAL,DIST.AP
170 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
171 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
172 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
173 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
174 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
175 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
176 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
177 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
178 ADITYA DHAWALE PATIL BAHUUDDESHIYE SEVABHAVI SANTHA LOKMANYA NAGAR NEAR AAVNI CORNER KAREGAO ROAD PARBHANI
179 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
180 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
181 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
182 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
183 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
184 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
185 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
186 ADIVASI SOCIETY FOR HELPING ATTITUTE RAMAN PADA, KUTRA
187 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
188 ADIWASI DEOMOGRA EDUCATION SOCIETY AT POST PATHRAI, TALUKA AND DIST NANDURBAR
189 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
190 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
191 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
192 ADVANCE CONSULTING A-23, UPPER REPUBLIC, AIZAWL, MIZORAM
193 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
194 ADVANCED LIFE CARE MULTIDESCIPLINARY HOSPITAL PRIVATE LIMITED 26-KASIA ROAD CANTT CROSSING DAUDPUR GORAKHPUR U.P
195 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
196 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
197 ADVANCE INFORMATION AND MULTIMEDIA EDUCATION SOCIETY 53 A, MAIN ROAD KARRAHI, BARRA, KANPUR
198 ADVENT CHEMBIO PRIVATE LIMITED 21, QUEEN VIEWS, JUHU ROAD, MUMBAI
199 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
200 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
201 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
202 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
203 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
204 AEREN FOUNDATION G-5, RATAN APARTMENT, NEAR DENA BANK, STATION ROAD, BHAYANDAR (WEST), THANE - 401101
205 AEREN FOUNDATION G-5, RATAN APARTMENT, NEAR DENA BANK, STATION ROAD, BHAYANDAR (WEST), THANE - 401101
206 AFZ EDUEARTH PVT LTD A FUTURE ZONE INSTITUTE OF IT & MANAGEMENT NEAR RAILWAY CROSSING KHATUMODE REENGUS SIKAR RAJSTHAN 332404
207 AGERSEN SEWA SAMITI RZC-187, MAHAVIR ENCLAVE, PALAM COLONY NEW DELHI-110045
208 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
209 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
210 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
211 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
212 AGRI AND SOCIO ECONOMIC DEVELOPMENT TRUST KALIAMMAN KOVIL NEAR, GENGUVARPATTY POST PERIYAKULAM
213 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
214 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
215 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
216 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
217 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
218 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
219 AIFA INFOTECH PVT LTD 572/2D, ADRSH NAGAR, NEW RAILWAY ROAD, OPP, AUTO STAND, GURUGRAM, HARYANA-122001
220 AIFA INFOTECH PVT LTD 572/2, AADRSH NAGAR, NEW RAILWAY ROAD, OPP. AUTO STAND, GURUGRAM HR
221 AIFA INFOTECH PVT LTD 572/2,ADARSH NAFAR, NEW RAILWAY ROAD, OPP. AUTO STAND,GURUGRAM HARYANA-122001
222 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
223 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
224 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
225 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
226 AIMTRON ELECTRONICS PVT LTD PLOT NO.1/A, G.I.D.C. ESTATE WAGHODIA
227 AIRWAAVE COMMUNICADO INDIA PRIVATE LIMITED NO.353,SRI DURGA ARCADE, 3RD FLOOR, 2ND MAIN ROAD, 8TH BLOCK JAYANAGAR, BANGALORE KA
228 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
229 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
230 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
231 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
232 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
233 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
234 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
235 AKASH COMBINES LIMITED PLOT NO 9, MALVIYA NAGAR BHOPAL
236 AKASH COMPUTERS SAKSHARTA MISSION AND EDUCATION CHARITBALE TRUST OFFICE NO 9-10, F.F. SAI BABA COMPLEX, POLICE STATION ROAD, PLOT NO 216, WARD 12-B,GANDHIDHAM
237 AKASH COMPUTERS SAKSHARTA MISSION AND EDUCATION CHARITBALE TRUST OFFICE NO 9-10, PLOT NO 216, WARD 12-B,SAI BABA COMPLEX,GANDHIDHAM,KUTCH.
238 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
239 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
240 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
241 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
242 AKRITI SAMAJIK SANSTHAN 3RD FLOOR, STAR GLAXY COMPLEX, NEAR- VERMASELL PETROL PUMP, DAKBUNGLOW ROAD, HAJIPUR, VAISHALI, BIHAR 844101
243 A K SAMANTARAY AND COMPANY PRIVATE LIMITED PLOT NO. 309/1801, SUB PLOT NO.1, SBI CAMPUS, SAILASHREE VIHAR, BHUBANESWAR
244 AKSARA SOCIAL SERVICE SOCIETY H.NO-9-82 PARKAL WARANGAL DISTRICT
245 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
246 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
247 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
248 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
249 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
250 ALAYAM WELFARE TRUST 117-B, PERIYAR NAGAR, PULIAKULLAM COIMBATORE-641045, TAMILNADU.
251 ALBAN COMMUNICATION INDIA PRIVATE LIMITED 379/381, NARSI NATHA STREET, MASJID BUNDER (WEST) MUMBAI, MAHARASHTRA – 400009
252 ALBAN COMMUNICATIONS INDIA PRIVATE LIMITED 502, AGH CHAMBERS, 379-381 NARSHI NATHA STREET, MASJID BUNDER(WEST) MUMBAI-400009, MAHARASHTRA
253 ALBAN COMMUNICATON PRIVATE LIMITED 379-391, NARSHI NATHA STREET MASJID BUNDER (WEST), MUMBAI, MAHARASHTRA
254 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
255 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
256 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
257 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
258 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
259 ALFURQAN COMPUTERS RAMBAGH PAYEEN SRINAGAR,KASHMIR OPPOSITE ZUM ZUM COMPLEX
260 ALFURQAN COMPUTERS RAMBAGH PAYEEN SRINAGAR OPPOSITE: ZUM ZUM COMPLEX-190015
261 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
262 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
263 ALHUDA PUBLIC SHIKSHA SEWA SAMITI VILL BANKATWA MAKOLIYA P/O TURHANI RAJJAB DISTT BAHARAICH UP 271802
264 ALIGN SKILLS EDUTECH W.NO. 6, NEAR CHUNA FATAK, HANUMANGARH
265 ALKA PAU LUDHIANA
266 AL KARIM BAHUUDDESHIYA SEVABHAVI SANSTHA AT POST PALI
267 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
268 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
269 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
270 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA
271 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
272 ALLIANCE CHARITABLE TRUST PLOT NO 13 & 14, FNO 101, PREMIA URBANA, PILLAR NO 208, UPPARPALLY, RAJENDRA NAGAR ROAD
273 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
274 ALLIANCE CHARITABLE TRUST PLOT 13 & 14 FLAT NO 101, PREMIA URBANA,, UPPARPALLY, PILLAR NO 208, RAJENDRA NAGAR
275 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
276 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
277 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
278 ALL INDIA COUNCIL OF TECHNICAL EDUCATION AND TECHNOLOGY UTTRA KOWGACHI, VIVEKANANDA LANE, NEAR – SHAKTI SANGHA CLUB, P.O. - SHYAMNAGAR, P.S.- JAGATDDAL
279 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
280 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
281 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
282 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
283 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
284 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
285 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
286 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
287 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
288 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
289 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
290 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
291 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
292 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
293 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
294 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
295 ALL TIME SECURITIES PVT LTD 201 RG MALL, OPP. DHARAMKUNJ APPTT., SECTOR-9, ROHINI, DELHI
296 ALMIGHTY INTERNATIONAL SOCIETY OUTSIDE MANNA PHATAK, MALERKOTLA
297 ALPHA FOUNDATION M1, PANCHAL UDYOG NAGAR, NEAR SYNDICATE BANK, BHAYANDAR, THANE, MAHARASHTRA, PIN - 401105
298 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
299 ALPS SOLUTIONS PRIVATE LIMITED KHASRA NO-654/2,PILLAR NO-501,MUNDKA,DELHI
300 ALSHUMS EDUCATION SOCIETY ALSHUMS EDUCATION SOCIETY INFRONT OF SHIRINGI RISHI HIGHER SECONDARY SCHOOL FOREST DEPOT ROAD NAGRI DHAMTARI
301 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
302 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
303 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
304 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
305 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
306 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
307 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
308 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
309 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
310 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
311 AMAZE ENGINEERS SOLUTION GAT NO. 679/2, OPP. BUS STOP, KURULI PHATA, KURULI, KHED, DIST PUNE-
312 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
313 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
314 AMBIKA PRATISHTHAN MAIN ROAD, SAILU TQ. SAILU DIST. PARBHANI
315 AMBIYA EDUCATION AND HEALTH WELFARE SOCIETY 4/11/43 AZAM COLONY, ROSHAN GATE, AURANGABAD-431001
316 AMECH BUSINESS SOLUTION PRIVATE LIMITED A 22,2ND FLOOR, SECTOR-3 NOIDA
317 AMEYAA TECH SOLUTIONS PVT LTD PLOT NO. 219, H.NO. 8-2-293/82/A/219, PHASE 1, ROAD NO.17, JUBILEE HILLS, OPPSITE JIC EXIT GATE, HYDERABAD, TELANGANA
318 AMIR SHAHABUDDIN HEALTHCARE TRUST C/O:ORIENT COACHING INSTITUTE, OCI TOWER NEW CHECKON,NEAR HOTEL ORIENT,HAFIZ HATTA, IMPHAL EAST DISTRICT, MANIPUR
319 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
320 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
321 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
322 AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-686/K/15, 4TH FLOOR, BANJARA HILLS, ROAD NO12,HYDERABAD.
323 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
324 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
325 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
326 AMITY HUMANITY FOUNDATION C-521 DEFENCE COLONY NEW DELHI
327 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
328 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
329 AMRAWATI EDUTECH OPC PRIVATE LIMITED 89-P RAMJANKI NAGAR CHOWK BASHARATPUR GORAKHPUR
330 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
331 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
332 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
333 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
334 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
335 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
336 AMRUTHA FOUNDATION NO.306, D.B. ROAD, R.S..PURAM, COIMBATORE - 641002 TAMILNADU - INDIA
337 AMRUTHA FOUNDATION NO.306, D.B.ROAD, R.S.PURAM, COIMBATOR E- 641 002
338 AMS EDUCATIONAL TRUST : 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
339 AMS EDUCATIONAL TRUST 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
340 AMUDHASURABI NEAR INDIAN OIL BANK THIRUVALUVAR NAGAR, PENNAGARAM (PO) & TALUK, DHARMAPURI (DT), TAMILNADU
341 AMUDHA SURABI SEVAI MAIYAM 4/135 KULLANUR,HOHENAKKAL MAIN ROAD, PIKKAMPATTI, DHARMAPURI, TAMILNADU
342 AMUTHA SURABI SEVAI MAIYAM OPP EB OFFICE, NEAR INDIAN OIL BUNK, PENNAGARAM, DHARMAPURI.
343 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
344 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
345 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
346 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
347 ANANDAM EDUCATIONAL AND CHARITABLE TRUST NO.15/4 VIVEKANANDAR SALAI, THIRUVALLUVAR NAGAR, SALAVANPET,VELLORE.
348 ANANDAM EDUCATIONAL AND CHARITABLE TRUST NO.15/4 VIVEKANANDAR SALAI, THIRUVALLUVAR NAGAR, SALAVANPET, VELLORE
349 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
350 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
351 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
352 ANAND EDUCATION AND RESEARCH TRUST D-40, SHANTI PATH, JAWAHAR NAGAR, JAIPUR
353 ANAND EDUCATION AND RESEARCH TRUST ANAND INTERNATIONAL COLLEGE OF ENGINEERING, NEAR KANOTA, AGRA ROAD, JAIPUR
354 ANANT FOUNDATION FOR INNOVATION AND SOCIAL INCLUSION BUILDING NO. 11-A, S/F, KH NO.258, LANE NO. 3, WESTEND MARG, SAIDULAJAB, SAKET, NEW DELHI, NEW DELHI-110030
355 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
356 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
357 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
358 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
359 ANANYA SHIKSHAN SAMITI GREENLAND VISHAL NAGAR RAIPUR VILLAGE BORIYAKALA POST MANA CAMP SEJBAHAR RAIPUR
360 ANDHRA CARDIOLOGY ASSOCIATES PRIVATE LIMITED 6-3-248/1/1A, CARE HOSPITAL, ROAD NO.1, BANJARA HILLS, HYDERABAD-500034
361 ANDHRA MAHILA SABHA ANDHRA MAHILA SABHA DDMS,LITERACY HOUSE, AMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
362 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
363 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM
364 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
365 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM, PERAMBALUR
366 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
367 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
368 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
369 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
370 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
371 ANDLEEB WELFARE SOCIETY KHAG BUDGAM
372 ANEES MEMORIABLE EDUCATIONAL TRUST MUQUEEM PLAZA 1ST FLOOR BUMGUNDESHWAR CIRLCE BVB COLLEGE ROAD BIDAR 585403
373 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR,BUMGUNDESHWAR CIRCLE,BVBCOLLEGE ROAD BIDAR KARNATAKA,INDIA
374 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR ,BUMGUNDESHWAR CIRCLE,BVB COLLEGE ROAD BIDAR,KARNATAKA
375 ANFAR FOUNDATION 2ND FLOOR, ANFAR SHOPPING CENTRE, J.K. KEDIA ROAD, HOJAI, P.O. HOJAI, P.S. HOJAI, DISTRICT- NAGAON, ASSAM, INDIA
376 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
377 ANGLAISE INFOMATICS PRIVATE LIMITED KH NO. 44/18 & 19, C-BLOCK INDRAPRASTHA COLONY, BURARI, DELHI
378 ANGLAISE INFOMATICS PRIVATE LIMITED KH NO. 44/18 & 19, INDRAPRASTHA COLONY, BURARI, DELHI
379 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
380 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
381 ANIMATRONICKS 2ND FLOOR N.J. HOUSE ABOVE SYNDICATE BANK ,OPP HONDA SHOW ROOM SANTRAM ROAD NADIAD 387001.
382 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
383 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
384 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
385 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
386 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE, DHARAMPETH
387 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE
388 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
389 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
390 ANJANEYA CHARITABLE AND EDUCATIONAL TRUST OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT BEHRAMPUR GANJAM
391 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
392 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
393 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
394 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
395 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
396 ANKERITE SEVA SANSTHAN MD 1/163 L.D.A CALONY KANPUR ROAD LUCKNOW
397 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO.3, DIGDOH HILLS,HINGNA MIDC, NAGPUR
398 ANKUSH SHIKSHAN SANSTHA ANKUSH SHIKSHAN SANSTHA, CRPF GATE, DIGDOH HILLS, HINGNA MIDC, NAGPUR, 440016
399 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO 3,DIGDOH HILLS ,HINGNA MIDC,NAGPUR
400 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
401 ANKUSH WELFARE SOCIETY D.NO;41-1/3-5 KRISHNA LANKA DVARAKA NAGAR VIJAYAWADA
402 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
403 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
404 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
405 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
406 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
407 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
408 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
409 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
410 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
411 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
412 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
413 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
414 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
415 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
416 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
417 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
418 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
419 ANNAMALAI ASDJFKL ADF ASDF AS F
420 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
421 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
422 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
423 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
424 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW MOBILE NO. 7985486626
425 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
426 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
427 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
428 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
429 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
430 ANTOYODAYA SAI KRIPA SEWA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA DISTT SAGAR
431 ANTYODAYA SAI KRIPA SEVA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA
432 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
433 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
434 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
435 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
436 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
437 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
438 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
439 ANUMEHA HEALTH CARE AND FASHION PVT LTD ANUMEHA VILLA (AHCC) P N BOSE COMPOUND NEAR KC ROY MEMORIAL HOSPITAL BESIDE BANARJEE LODGE LALPUR RANCHI JHARKHAND
440 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
441 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
442 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
443 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
444 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
445 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
446 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
447 ANV CONSULTANCY SERVICES PRIVATE LIMITED C/O RAMA NAND SINGH ZILA SCHOOL ROAD DUMKA
448 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
449 APAAR C/O DR. M.C. BHATT, 7/12 RAMASHRAM, TAKANA ROAD
450 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
451 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
452 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
453 APEX EDUCATION AND DEVELOPMENT SOCIETY NEAR VOHRA MUSAFIR KHANA. STATION ROAD,DAHOD
454 APEX EDUCATION AND DEVELOPMENT SOCIETY 2ND FLOOR,HOTEL VRUNDAVAN,OPP BUS STAND,DAHOD.GUJ
455 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
456 APEX INDIA EDUCATION AND CHARITABLE TRUST APEX INDIA EDUCATION AND CHARITABLE TRUST, DOOR NO' 11 T337 ' T'K'PET' NEAR NADAR KALYANA MANDAPAM, GUDALUR, GUDALUR BAZAAR POST, NILGIRIS TN- 643212
457 APLOMB ABHILASHA BHAWAN MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA
458 APNA TELE LINK PRIVATE LIMITED SCO 1-12, 4TH FLOOR, PPR MALL, MITHAPUR ROAD JALANDHAR CITY
459 APOGEE SERVICES PVT LTD A-2/30 VIJAY KHAND GOMTINAGAR LUCKNOW UTTAR PRADESH
460 APOLLO ONLINE SERVICES PRIVATE LIMITED H.NO. 12-13-387, STREET NO.1, LANE NO.1 TARNAKA SECUNDERABAD
461 APOORVA MEDICARE PRIVATE LIMITED 16/1451
462 APOORVA MEDICARE PRIVATE LIMITED 16/1451 INDIRA NAGAR LUCKNOW
463 APPAREL AND LEATHER TECHNICS PRIVATE LIMITED KAIKONDRAHALLI, CARMELRAM POST NEAR BELLANDUR GATE, SARJAPUR ROAD, BANGLORE
464 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
465 APPWORX IT SOLUTIONS PRIVATE LIMITED NETSMARTZ HOUSE, PLOT NUMBER 10, RAJEEV GANDHI TECHNOLOGY PARK, CHANDIGARH
466 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
467 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
468 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
469 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
470 AQSA ALPSANKHYAK EDUCATION AND WELFARE SOCIETY AMEEN COLONY, DHAR ROAD PARBHANI
471 ARADHANA EDUCATIONAL AND CHARITABLE TRUST ARADHANA EDUCATIONAL CAMPUS, BHAVNAGR ROAD, BOTAD
472 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
473 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
474 ARAMCO SOLUTIONS PRIVATE LIMITED 1ST FLOOR, PENTAGAN, BEHIND BALDEV PLAZA, RFC LANE, GOLGHAR, GORAKHPUR – 273001 UTTAR PRADESH, INDIA
475 ARAMCO SOLUTIONS PRIVATE LIMITED 1ST FLOOR, PENTAGAN, BEHIND BALDEV PLAZA, RFC LANE, GOLGHAR,GORAKHPUR – 273001 UTTAR PRADESH, INDIA
476 ARAMCO SOLUTIONS PRIVATE LIMITED 1ST FLOOR, PENTAGAN, BEHIND BALDEV PLAZA, RFC LANE, GOLGHAR, GORAKHPUR – 273001 UTTAR PRADESH, INDIA
477 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
478 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
479 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
480 A R ASSOCIATE AT-STATION ROAD KHUTAUNA,P.O+ P.S-KHUTAUNA,DISRICT-MADHUBANI (BIHAR)
481 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
482 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
483 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
484 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
485 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
486 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
487 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
488 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
489 ARCENCIEL FOUNDATION H. NO. 85B, KHRIYA POKHARA BASHARATPUR, MEDICAL ROAD GORAKHPUR GORAKHPUR UP 273004 IN
490 ARCEUS INFOTECH PVT LTD 508, 5TH FLOOR, THE SUMMIT BUSINESS BAY (OMKAR), ANDHERI-KURLA ROAD, ANDHERI (EAST), MUMBAI - 400093
491 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
492 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
493 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
494 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR SHREE RAM BHAWAN PICNIC SPOT ROAD KHURAM NAGAR LUCKNOW
495 A R DAIRY FOOD PVT LTD 10/5C, MADURAI ROAD, DINDIGUL, TAMILNADU.
496 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
497 A R DIARY FOOD PRIVATE LIMITED 10/5C, MADURAI ROAD, DINDIGUL, TAMILNADU.
498 ARIHANT PRO EDUCATION SOCIETY 202, RADHA GANGA ARCADE, DELHI ROHTAK ROAD, BAHADURGARH,
499 ARIHANT PROEDUCATION SOCIETY SCF-11,M.I.E,BAHADURGARH,DISTT.JHAJJAR,HARYANA
500 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
501 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
502 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
503 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
504 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
505 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
506 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
507 ARIVUSURABHIEDUCATIONALANDSOCIALTRUST 34/99,MPS SALAI,NEAR JK STORE,TIRUTTANI,TIRUVALLUR DISTRICT,TAMILNADU
508 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
509 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
510 AROX EXPO PRIVATE LIMITED AROX EXPO PVT LTD NH-8 AMBERI UDAIPUR
511 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
512 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
513 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
514 ARPAN WELFARE SOCIETY Z 2 CHOICE HOUSE NEAR HDFC BANK ZONE 1 MP NAGAR BHOPAL
515 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
516 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
517 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
518 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
519 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
520 ARSH INSTITUTE OF INFORMATION TECHNOLOGY AND RESEARCH LLP NEAR POST OFFICE VPO THUNAG
521 ARSH INSTITUTE OF INFORMATION TECHNOLOGY AND RESEARCH LLP NEAR POST OFFICE MAIN BAZAR THUNAG
522 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
523 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
524 ARTECH INFOSYSTEMS PRIVATE LIMITED INFOSPACE, B-2, TOWER 2, GROUND FLOOR, SECTOR 62, NOIDA
525 ARTECH INFOSYSTEMS PVT LTD GROUND FLOOR B2 TOWER 2 INFOSPACE SECTOR 62
526 ARTECH INFOSYSTEMS PVT LTD GROUND FLOOR B2 TOWER 2 INFOSPACE SECTOR 62
527 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
528 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
529 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
530 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
531 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
532 ARUNACHAL UNIVERSITY OF STUDIES NH-52, NAMSAI DISTRICT NAMSAI
533 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
534 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
535 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
536 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
537 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
538 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
539 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
540 ARUN SURYA SHIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA H.NO 13, GEETANJALI PARK, NEAR MAHARISHI VIDYA MANDIR SCHOOL,MANGLA, BILASPUR (C. G)
541 ARUN SURYA SIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA OM NAGAR, JARHA BHATA , BILASPUR C.G
542 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
543 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
544 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
545 ARYAN KNOWLEDGE SQUARE PRIVATE LIMITED GH 9/162, PASHCHIM VIHAR, NEW DELHI
546 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
547 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
548 ASD EDUCATIONAL CHARITABLE TRUST NO 2/141 GANAPATHY COMPLEX,BAZAAR ROAD,KANCHIPURAM,TAMILNADU
549 ASD EDUCATIONALCHARITABLE TRUST 2/141,BAZAAR ROAD
550 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
551 AS EDUCATION AND WELFARE SOCIETY VPO TIGRANA,DISTT-BHIWANI,HARYANA 127031
552 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
553 ASFSDA ASDF
554 ASHA HO. NO. 11 RADHAPURAM COLONY KANCHANPUR MATIYARI CHINHAT LUCKNOW
555 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
556 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
557 ASHASECURITYGUARDSERVICES L-2/482, VINEET KHAND, GOMTI NAGAR, LUCKNOW
558 ASHA SKILL DEVLOPMENT FOUNDATION WARD NO 28, FIRST FLORE KESAR PLAZA COMPLEX HANUMAN CHAUK BALAGHAT
559 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
560 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
561 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION G-24, 3RD FLOOR, VIJAY NAGAR SINGLE STOREY, DELHI
562 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
563 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
564 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
565 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
566 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
567 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
568 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
569 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
570 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
571 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
572 ASHTA UTKARSH SEVA SANSTHAN SAMITI 445, WARD NO 16, SEMNARI ROAD ASHTA
573 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
574 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
575 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
576 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
577 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
578 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
579 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
580 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
581 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
582 ASIAN INFOTECH EDUCATIONAL DEVELOPMENT SOCIETY ASIAN INFOTECH ZOOROAD TINIALI APURBA SINHA PATH BY LANE-05
583 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
584 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
585 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
586 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
587 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
588 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
589 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
590 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
591 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
592 ASPIRE DISRUPTIVE SKILL FOUNDATION 2ND FLOOR KAILASH -B OPP. DRINE IN CINEMA BESIDE HDFC BANK, DRIVE IN ROAD AHMADABAD -PIN-380054 GUJARAT.
593 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
594 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
595 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
596 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
597 ASSET HOMES PRIVATE LIMITED G-129,28/34A,PANAMPILLY NAGAR, KOCHI - 682036 , KERALA
598 ASSIST G. T. ROAD CHILAKALURIPET GUNTUR DISTRICT ANDHRA PRADESH
599 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
600 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
601 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
602 ASSOCIATION FOR PEOPLES ADVANCEMENT AND ACTION RESEARCH 7/12,RAMA ASHRAM TAKNA ROAD
603 ASSOCIATION FOR PEPOLES ADVANCEMENT AND ACTION RESEARCH C/O DR. M.C. BHATT, 7/12 RAMASHRAM, TAKANA ROAD
604 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
605 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127, P. MEENAKSHIPATTY, KARUMATHUR POST, THENI MAIN ROAD
606 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
607 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
608 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
609 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
610 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
611 ASYLUM SECURITY AND INTELLIGENCE PRIVATE LIMITED GRAND CHANDRA APARTMENT, FRASER ROAD, PATNA BIHAR 800001
612 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
613 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
614 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
615 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
616 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
617 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
618 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
619 ATHMA DIVINE TRUST NO 80-A KONDASAMY ROAD RAMNAGAR COIMBATORE
620 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
621 ATMAN FOUNDATION GADHADA AT GADHADA GOPINATH BANLOGE BEHIND VARJ VIHAR SOCIETY GADHADA BOTAD ROAD DIST - BOTAD
622 ATMAN FOUNDATION GADHADA AT GADHADA GOPINATH BANLOGE BEHIND VARJ VIHAR SOCIETY GADHADA BOTAD ROAD DIST - BOTAD
623 ATMIY MANAGEMENT LLP AT GADHADA MOHANNAGAR SOCIETY OPP NEW BUS STATION DIST BOTAD
624 ATMIY MANAGEMENT LLP AT,GADHADA MOHANNAGAR SOCIETY OPP.NEW BUSSTATION DIST.BOTAD TALUKO - GADHADA
625 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
626 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
627 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
628 AURA EDUCATIONAL SOCIETY 60-9-10/4, PINNAMANENI PPLY CLONIC STREET, 7 TH LANE SIDHARTHA NAGAR, VIJAYAWADA
629 AURA EDUCATIONAL SOCIETY NO 60-9-10/4, TEJA BUILDINGS, SIDDHARTHANAGAR, PINNAMANENIPOLYCLINIC ROAD, VIJAYAWADA, KRISHNA DISTRICT
630 AURORA EDUCATIONAL SOCIETY AURORA CONSORTIUM, 1-8-168/2/1, STREET NO. 12, CHIKKADPALLY, HYDERABAD
631 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
632 AUTOLITE INDIA LIMITED D 469 ROAD NO 9 A V K I AREA RAJASTHAN JAIPUR
633 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
634 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
635 AVISH EDUCATIONAL SOCIETY ARYA NAGAR, AVISH EDUPLEX, AGRASEN CHOWK, INFRONT OF DENA BANK, DURG
636 AVISHKAR CONSTRUCTION COMPANY MAHARANA PRATAP WARD NEAR INGLE SQUARE CIVIL LINE GONDIA
637 AVJ INFOTECH PVT LTD AMIYO NIKETAN NAITY ROAD,BAGAN PARA,2ND FLOOR,P.O-NABAGRAM, PIN: 712246
638 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
639 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
640 AV RETAIL PVT LTD 337, LOWER GROUND FLOOR, SECTOR-38
641 AV RETAIL PVT LTD 337, LOWER GROUND FLOOR, SECTOR-38, GURGAON
642 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
643 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
644 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
645 AVTAR WELFARE SOCIETY 538/5-C BANKER COLONY, JHANSI
646 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, JHANSI UP 284001
647 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY
648 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
649 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, BEHIND KISAN BAZAR, JHANSI
650 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
651 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
652 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
653 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
654 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
655 AWARENES BASED CHARITABLE TRUST NO-6/203,GANDHI NAGAR,KOMARAPALAYAM-PO, TRICHENGODE-TK,NAMAKKAL-DT
656 AWARNESS BASED CHARITABLE TRUST 6/203, GANDHI NAGAR, KOMARAPALAYAM-PO, TRICHENGODE-TK, NAMAKKAL-DT
657 AXYKNO CAPITAL SERVICES PRIVATE LIMITED LEVEL 3, LEELA VISTA, WHC ROAD, BAJAJ NAGAR NAGPUR
658 AXYKNO CAPITAL SERVICES PRIVATE LIMITED LEVEL 3, LEELA VISTA, WHC ROAD, BAJAJ NAGAR, NAGPUR
659 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
660 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
661 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
662 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
663 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
664 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
665 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOT-ISE-KHAN
666 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN
667 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN DISTT MOGA PUNJAB
668 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
669 BABA JAKJDAS JHAKJB KNKDCKDN KJBSKBDSKN BSKBDKCB
670 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
671 BABA SAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE , PLOT NO 59/471 , P.S - SECTOR 12. BOKARO (JHARKHAND)
672 BABASAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE 59/471. PO + PS SECTOR 12. BOKARO
673 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
674 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
675 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
676 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
677 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
678 BADRINARAYAN SHIKSHA SAMITI KUNER,PAOTA,JAIPUR(RAJASTHAN)-303106
679 BADULARA DEESHARI SOCIETY BADULARA, POST-WEST SANABANDH, DIST-BANKURA
680 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
681 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
682 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
683 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
684 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
685 BAISHNABI SOCIAL AND EDUCATIONAL CHARITABLE ORGANIZATION TRUST PLOT NO-347/586/604, AT-TAMANDO-PO-TAMANDO, PS-TAMANDO, DIST-KHURDA, ODISHA-752054
686 BAISHNABI SOCIAL AND EDUCATIONAL CHARITABLE ORGANIZATION TRUST PLOT NO-347/586/604, AT-TAMANDO,PO-TAMANDO,DIST-KHURDA
687 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
688 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
689 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
690 BAJRANGBALI SHAIKSHNIK EVAM SAMAJIK SEVA SANSTHAN POSTAL PARK NAVRATAN PUR MANDIR,P.O-GPO.P.S.-KANKARBAGH
691 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
692 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
693 BALAGH EDUCATION AND WELFARE SOCIETY 3RD FLOOR KHALID APARTMENT BADI OMTI JABALPUR M.P.
694 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
695 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
696 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
697 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
698 BALAJ TRUST CO LTD DGHDGGHDGDGGD
699 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
700 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
701 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
702 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
703 BALIRAJA BAHUUDESHIYE SEWABHAWI SANSTHA BEED AT PADMAVATI GALLI PARLI V TQ PARLI V DIST BEED 431122
704 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
705 BAL MAHILA VIKAS SAMITI 9-C MAHARAN PRATAP NAGAR OLD USHA COLONY LASHKAR GWALIOR
706 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
707 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
708 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
709 BAL VIKAS UTTHAN SAMITI I.T EDUCATION (BAL VIKAS UTTHAN SAMITI) NEAR O.B.C BANK AMBEHTA CHAND SAHARANPUR U.P 247451
710 BAL VIKAS UTTHAN SAMITI I.T EDUCATION (BAL VIKAS UTTHAN SAMITI) NEAR O.B.C BANK AMBEHTA CHAND SAHARANPUR UTTAR PRADESH
711 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
712 BANASKANTHA GENERAL WORKS SEVA SANGH 19,MATRUKRUPA SOCIETY, ALKAPURI, AT : VIJALPOR, TA : JALAPOR, DIST : NAVSARI,
713 BANASKANTH GENERAL WORKS SEVA SANGH 19 MATRUKRUPA SOCIETY ALKAPURI
714 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
715 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
716 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
717 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
718 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
719 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
720 BANDIPORA INFOTECH PRIVATE LIMITED WARD NO 02 SOFI COMPLEX KHADIM MARKET BANDIPORA J&K
721 BANDIPORA INFOTECH PRIVATE LIMITED WARD NO 02 ,SOFI COMPLEX KHADIM MARKET BANDIPORA
722 BANGANGA SAKSHARTA SAMITI MERHWA BANGANGA ROAD SHOHRATGARH SIDDHARTHNAGAR UTTAR PRADESH 272205
723 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
724 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
725 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
726 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
727 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
728 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
729 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
730 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
731 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
732 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
733 BASANTI DASH EDUCATIONAL TRUST BASANTI DASH EDUCATIONAL TRUST, A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
734 BASANTI DASH EDUCATIONAL TRUST HEAD OFFICE, HIG/A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
735 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
736 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
737 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
738 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
739 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
740 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
741 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
742 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
743 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
744 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
745 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
746 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
747 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
748 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80, SITE-5, UDYOG KUNJ, PANKI, KANPUR-208022,PH. NO.0512-2212083
749 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
750 BELA ROZGAR AND HEALTH CONSCIONS COMPANY IST FLOOR, SANT PLAZA, ABOVE CORPORATION BANK SHRIKANT VERMA MARG, NEAR RAMA MAGNETO MALL, BILASPUR, CHHATTISGARH
751 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
752 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
753 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
754 BENTOGREEN SKILL PRIVATE LIMITED 50L, WEST CHOWBAGA, P.S.-TILJALA, KOLKATA
755 BERHAMPORE NETAJI VIVEKANANDA ADARSHA SEVA SAMITY 74/1, ABDUS SAMAD ROAD, GORABAZAR, P.O. BERHAMPORE, DIST. MURSHIDABAD
756 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
757 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
758 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
759 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
760 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM, AVINASHI ROAD, TIRUPUR
761 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM, AVINASHI ROAD, TIRUPUR
762 BEST CORPORATION PRIVATE LIMITED 89/2, PADMAVATHIPURAM AVINASHI ROAD, TIRUPUR
763 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
764 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
765 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
766 BEST EMPOWERMENT SERVICES TRUST 211/17A TVS COLONY MEENAKSHI NAGAR HASTHAMPATTI
767 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
768 BFHJFF BDHD
769 BG SOFTWARE SOLUTIONS 6514A 2ND FLOOR KALYANI COMPLEX BUDIKERE ROAD KANAKAPURA
770 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
771 BHAGIRATHI TRANS CORPO PVT LTD # 2, ESSPEE TOWER, RAJENDRA NAGAR, DATTAPADA ROAD, BORIVALI (EAST)
772 BHAGIRATHI TRANSCORPO PVT LTD UNIT.2 , ESSPEE TOWER , RAJENDRA NAGAR , DATTAPADA ROAD , BORIVALI (E)
773 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
774 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
775 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
776 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
777 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
778 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
779 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
780 BHANSALI TRUST BHANSALI TRUST AND HOSPITAL, HIGHWAY CROSS ROAD, NEAR GAYATRI TEMPLE
781 BHANSALI TRUST BHANSALI TRUST, HIGHWAY CROSS ROAD, TO.RADHANPUR, DIST.PATAN
782 BHANSALI TRUST BHANSALI TRUST RADHANPUR HIGHWAY CROSS ROAD NEAR GAYATRI TEMPLE AT PO RADHANPUR
783 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
784 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
785 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
786 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
787 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
788 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
789 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
790 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
791 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
792 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
793 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
794 BHARATH FOUNDATION 9-10-232/1 FIRST FLOOR ABOVE CANARA BANK CHITTA ROAD
795 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
796 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
797 BHARATHIYA SEVA SAMSTHE NO.363, 7TH MAIN, BHUVANESHWARI NAGAR, T DASARAHALLI, BANGALORE
798 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
799 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
800 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
801 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
802 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
803 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
804 BHARAT SANCHAR NIGAM LIMITED RGMTTC BSNL.RGMTTC,GST ROAD MINAMBAKKAM,OPP. TO OLD AIRPORT, CHENNAI-27
805 BHARAT SANCHAR NIGAM LIMITED RGMTTC BHARAT SANCHAR NIGAM LTD RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE OPPOSITE TO OLD AIRPORT GST ROAD MINAMBAKKAM CHENNAI
806 BHARAT SANCHAR NIGAM LIMITED RGMTTC BHARAT SANCHAR NIGAM LIMITED RGMTTC OPPOSITE TO OLD AIRPORT GST ROAD MINAMBAKKAM CHENNAI
807 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
808 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
809 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
810 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
811 BHARAT VEERANGNA AWANTIBAI EDUCATIONAL SANTHAN D-16 SECTOR-9 VIJAY NAGAR GHAZIABAD
812 BHARAT VIKAS SAMITI CARMEL CHOWK, 7TH MILE, NEAR WADI POLICE STATION, AMRAVATI ROAD, NAGPUR
813 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
814 BHARDWAJ EDUCATIONAL DEVELOPMENT SOCIETY 3/ 542 , JANKIPURAM EXT , LUCKNOW , UTTAR PRADESH
815 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
816 BHARTIYA EDUCATIONAL CHARITABLE TRUST 56 SETH KUMHARTOLI DORANDA
817 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
818 BHARTIYA MAHILA SEVA SANGH NR KASHI BAPU TEMPLE NR RIVER BARWALA
819 BHARTIYA MAHILA SEVA SANGH SAKAR COMPLEX, OPP ICICI BANK, TOWER ROAD, BOTAD, BOTAD-364710
820 BHARTIYA MAHILA SEVA SANGH NR KASHI BAPU TEMPLE NR RIVER BARWALA
821 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
822 BHARTIYA SAMAJIK BAHUUDESHIYA VIKAS SANSTHA C/O. MANGAL KAWDU TELANG,VIKAS NAGAR, NEAR TAKSHAKISHLIYA BUDDHA VIHAR, BABUPETH CHANDRAPUR.
823 BHARTIYA SAMRUDDHI INVESTMENTS AND CONSULTING SERVICES LIMITED 3RD FLOOR, SURBHI ARCADE, BANK STREET, TROOP BAZAR, KOTI, HYDERABAD
824 BHARUCH JILLA ADARSH SAMAJ SEVA MANDAL AT&PO: MANGROL, TA.:NANDOD DIST.: NARMADA
825 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
826 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
827 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
828 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
829 BHAVISHYA EDUCATIONAL AND CHARITABLE SOCIETY H NO 8/2, B L NO 16, MANICKPEER, KANKINARA
830 BHAWANI INFOCOM PRIVATE LIMITED S. B. LANE, MUNSIFF DANGA, PURULIA
831 BHAWANI MARKETING PRIVATE LIMITED SHIMA PLAZA,3RD FLOOR,BLOCK D, ULUBARI CHARIALI, GUWAHATI
832 BHELSA JAN KALYAN SAMITI HOUSE NO-22, CHANDRA SHEKHAR ROAD PITTAL MILL VIDISHA (M.P)
833 BHELSA JAN KALYAN SAMITI PITAL MILL SQUARE, SAGAR ROAD VIDISHA(M.P.)
834 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
835 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
836 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
837 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
838 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NEW RAIPUR
839 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NAYA RAIPUR
840 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
841 BHOJPUR GRAMIN VIKAS PARISHAD AT- SINGH COLONY, JAGDEV NAGAR, NEAR BAZAR SAMITI, PO: ARA, PS: ARA NAWADA, DISTT: BHOJPUR (BIHAR)
842 BHOJPUR MAHILA KALA KENDRA BAZARI SAH KA MANDIR ABAR POOL PAR ARA
843 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
844 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
845 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
846 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
847 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
848 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
849 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
850 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
851 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
852 BHUPINDRA SOCIETY REGISTERED OFFICE : SCF-34, DUKHNIWARAN SAHIB GURUDWARA MARKET, PATIALA, PUNJAB- 147001 CORPORATE OFFICE : SCO-19, 2ND FLOOR, SECTOR 26, MADHYA MARG, CHANDIGARH , 160019
853 BHUSHAN RAJIV INFRATECH PVT LTD CHAKLA-HARCHANDA ROAD,NEAR CHAKLA MORH,ORMANJHI,BIRSA MUNDA RESIDENSIAL SCHOOL BUILDING.
854 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
855 BILASPUR FULE STATION VILLAGE-PARSADA DISTRICT-BILASPUR RAIPUR ROAD BILASPUR
856 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
857 BILQUIS EDUCATION SOCIETY PART D 2ND FLOOR COMMERCIAL COMPLEX T P NAGAR KORBA CHHATTISGARH
858 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
859 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
860 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
861 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
862 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD DIST. KHARGONE M.P. INDIA MOB. NO. 8717828884
863 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD M.P. INDIA 451228, DIST KHARGONE, MOB. 8717828884, 9993596700
864 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
865 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
866 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
867 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4, M.I.D.C, INDUSTRIAL AREA, WALUJ, AURANGABAD, MAHARASHTRA
868 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4 MIDC INDUSTRIAL AREA WALUJ DIST AURANGABAD (MAHARASHTRA)
869 BISMI EDUCATIONAL TRUST NO1 2ND AND 3RD FLOOR AMUTHA COMPLEX NEW SANKARANPALAYAM ROAD TOLGATE VELLORE
870 BISWAAS BAHARANA.NIALI,CUTTACK
871 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
872 BIYANI SHIKSHAN SAMITI BIYANI SHIKSHAN SAMITI, R-4, SECTOR 3, VIDYADHAR NAGAR, JAIPUR
873 BIYANI SHIKSHAN SAMITI SECTOR. NO 3, VIDHYADHAR NAGAR, JAIPUR, RAJASTHAN
874 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
875 BLACKSMITH PROJECTS PRIVATE LIMITED JAGAT COMPLEX,PLOT NO. 354, 100 FEET ROAD, GHITORNI, NEW DELHI 110030
876 BLESSING AND HOPE MISSION HARINARAYANPUR, VIDYASAGARPALLY, SRIDHAR GHOSH ROAD, BURDWAN WEST BENGAL-713101
877 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
878 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
879 BLUEBLOOD VENTURES LIMITED ROOM NO. 101, P-27, MALVIYA NAGAR, NEW DELHI
880 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED #18, SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR, BANGALORE 560043
881 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED NO.18 SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR BANGALORE - 560043
882 BLUE COAST HOTELS LIMITED 263 C AROSSIM,CANSAULIM,GOA
883 BLUE COAST HOTELS LIMITED 263C AROSSIM,CANSAULIM,GOA
884 BLUE OCEAN PERSONNAL AND ALLIED SERVICES 24, 3RD FLOOR NITHYA BUILDING CHAMIERS ROAD NANDANAM
885 BLUE OCEAN PERSONNEL AND ALLIED SERVICES PRIVATE LIMITED 24, NITHYA BUILDING 3RD FLOOR CHAMIERS ROAD NANDANAM CHENNAI
886 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
887 BLUORCHID INTERNATIONAL SERVICES PRIVATE LIMITED U-131,F/F UPADHAYAY BLOCK SHAKARPUR, NEAR LAXMI NAGAR METRO STATION.DELHI
888 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
889 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
890 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
891 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
892 BORAL NUTANHAT YOUTH COMPUTER TRAINING CENTRE C/6 RAJNARAYAN PARK,RANGKAL MORE, BORAL MAIN ROAD , P.O. BORAL,P.S. SONARPUR ,PIN -700154 REGISTERED OFFICE 58/3 MADHYAPARA , ROYNAGAR, P.O.& P.S. BANSDRONI,KOLKATA-700070
893 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA-403601
894 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA 403601
895 BOROK HAMKRAI WELFARE SOCIETY VILL-SHANKHALAPARA, PO-SONARAM BAZAR, PS-SIDHAI, DIST-WEST TRIPURA,BLOCK-HEZAMARA RD BLOCK, PIN-799212
896 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR ASHRAM SOUTH DELHI
897 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR, ASHRAM SOUTH DELHI
898 BPS SHIKSHAN SANSTHAN ION DIGITAL ZONE,BHARTIYA INSTITUTE OF ENGG. &TECH.JAIPUR-BIKANER BYPASS,NEAR SANWALI CIRCLE. POST OFFICE-BAJAJ GRAM.TEH.&DISTT.-SIKAR(RAJASTHAN)-332001
899 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
900 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR
901 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
902 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
903 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
904 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED D-17,THACKER INDUSTRIAL ESTATE,N.M JOSHI MARG,CHINCHPOKALI MUMBAI - 400011
905 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
906 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
907 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
908 BRIGHT FUTURE ACADEMY SHYAM JI MARG ,KETKA ROAD SURAJPUR(CG)
909 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
910 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
911 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
912 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
913 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
914 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
915 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
916 BRIGHT STAR MUSLIM ASSOCIATION 42, INDIRA NAGAR, B.N.P. ROAD, DEWAS
917 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
918 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
919 BRIJ KISHORE JAGRITI SEWA SAMITI VILL AND POST BARGAWAN, TEHSIL MISHRIKH DISTRICT SITAPUR, UTTAR PRADESH
920 BRIJ KISHOR JAGRITI SEWA SAMITI VILL&PO.BARGAWAN DIST.SITAPUR PIN CODE.261151 BLOCK .PISAWAN TAHSIL.MAHOLI
921 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
922 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
923 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED NO 19, CHITALAPAKKAM MAIN ROAD,2ND FLOOR, NEHRU NAGAR, CHROMPET,CHENNAI
924 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED 2ND FLOOR, NO 19, CHITALAPAKKAM MAIN ROAD,NEHRU NAGAR, CHITALAPAKKAM , CHROMPET
925 BRILLIANT CORPORATE SERVICES PRIVATE LIMITED NO 19 CHITALAPAKKAM MAIN ROAD,2ND FLOOR, NEHRU NAGAR ,CHROMPET, CHENNAI
926 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
927 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
928 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
929 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
930 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
931 B R KHOKHAR MEMORIAL SHIKSHAN SANSTHAN KUCHAMAN CITY KHATIYON KA MOHALLA , PADAMPURA ROAD,KUCHAMAN CITY
932 BROADLINE COMPUTER SYSTEMS NO. 7, 2ND FLOOR, KHADER NAWAZ KHAN ROAD, NUNGAMBAKKAM CHENNAI
933 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
934 BROTHERS OF ST GABRIEL EDUCATIONAL SOCIETY C/O DIRECTOR MONTFORT PLOT 256 TAKLI BHANSALI SAVNER ROAD PATANSAVANGI NAGPUR MAHARASHTRA
935 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
936 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
937 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
938 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
939 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
940 BSA CORPORATION LIMITED 18 SUKHWANI FORTUNE , MOREWADI ROAD , PIMPRI, PUNE
941 BSA CORPORATION LIMITED 18,SUKHWANI FORTUREMOREWADI ROAD PIMPRI, PUNE - 411018, MAHARASHTRA , INDIA
942 BSA CORPORATION LIMITED 18-20,SUKHAWANI FORTUNE, MORWADI ROAD PIMPRI , PUNE
943 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
944 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
945 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
946 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
947 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
948 BUILDYOURSELF SEWA SANSTHA 546/718 SARFARAJGANJ LUCKNOW
949 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
950 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
951 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
952 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
953 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
954 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
955 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
956 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
957 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
958 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
959 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
960 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
961 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
962 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
963 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
964 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
965 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
966 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
967 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
968 CALLHEALTH SERVICES PRIVATE LIMITED 1-66/1/RI/08/8, 10TH & 11TH FLOOR, RAMKY GRANDIOSE, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD - 500032, TELANGANA
969 CAMBRIDGE PUBLIC EDUCATIONAL AND WELFARE TRUST VILL SAIDPUR PO SORMAR BAGHALA PS MORO DISTT DARBHANGA
970 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA; DISTRICT CENTRE, JASOLA, NEW DELHI-110025
971 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA DISTRICT CENTRE, JASOLA, NEW DELHI-110025
972 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
973 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
974 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
975 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
976 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
977 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
978 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
979 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
980 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
981 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
982 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY VINOD KUMAR SACHDEV ,SANJAY NAGAR KURUD, WARD 14, MAIN ROAD KURUD , DIST. DHAMTARI, CHHATISGARH 493663
983 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
984 CAREER DEVELOPMENT OPPORTUNITY AND TRAINING C DOT NO 7 ,ST MARYS BUILDING ,R.S.L GOLDEN APARTMENT ROAD (NEAR SELVARAJ TEXTILES) VILLANGUDI,MADURAI
985 CAREER EDUCATION AND TECHNICAL SOCIETY OPP. ITI,RANIA ROAD,SIRSA-125055,HARYANA
986 CAREER EDUCOM ACADEMY 70, JALVIAHAR COLONY, RAIPUR
987 CAREER EDUCOM ACADEMY 70, JALVIHAR COLONY, RAIPUR, CG, 492001
988 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
989 CAREER PARK TRUST CAREER PARK TRUST. 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR SRINAGAR, KASHMIR.
990 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
991 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR, KASHMIR
992 CAREER PLUS EDUCATIONAL SOCIETY H.O301/A37, 38, 39 IIIRD FLOOR ANSAL BUILDING, COMM.COMPLEX DR. MUKHERJEE NAGAR DELHI 110009 REGD.OFFF3/ 8 SEC11 ROHINI DELHI110085
993 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
994 CAREER ZONE EDUCATIONAL AND WELFARE SOCIETY 40 VIVEKANAND NAGAR YADAV COLONY JABALPUR M.P
995 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
996 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR CHHATTISGARH
997 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
998 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
999 CARE PRO BIOSCIENCE PRIVATE LIMITED I - 059 , SITE 5, KASNA IND AREA GAUTAM BUDDH NAGAR GREATER NOIDA UP
1000 CARE PRO BIOSCIENCE PRIVATE LIMITED I - 059 , SITE 5, KASNA IND AREA GAUTAM BUDDH NAGAR GREATER NOIDA UP
1001 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
1002 CARE WORLD BAGHI MEHTAB NEAR BYPASS BRIDGE
1003 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
1004 CASA GRANDE PROP CARE PRIVATE LIMITED 40/129A, SHIVANI TOWERS, 2ND FLOOR, ECR, THIRUVANMIYUR, CHENNAI
1005 CASA GRANDE PROP CARE PVT LTD NO 40/129A, SHIVANI TOWERS, 2ND FLOOR,ECR, THIRUVANMIYUR, CHENNAI
1006 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
1007 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
1008 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
1009 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
1010 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
1011 CDHU EEHDG
1012 CDROME EDUCATION SOCIETY 101, PANSI HOUSE, NEAR PRAYAG SOCIETY BUILDING NO-4, LOK DHARA PHASE - 1, KALYAN (EAST)
1013 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMMEDI HOUSE MOHAMMED ALI ROAD MOHARASHTRA MUMBAI
1014 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMADI HOUSE, MOHAMADALI ROAD, P.O. BOX, 13097, MASJID BUNDER (WEST), MUMBAI
1015 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
1016 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
1017 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
1018 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
1019 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
1020 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
1021 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
1022 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
1023 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
1024 CENTER FOR COMMUNITY SOLIDARITY CENTERFOR COMMUNITY SOLIDARITY TRUST NO.27.BAZAAR STREET AMIRTHAPURAM TIRUTTANI TIRUVALLUR DISTRICT TAMILNADU
1025 CENTER FOR COMMUNITY SOLIDARITY NO 27 AMIRTHAPURAM TIRUTTANI BRANCH CODE 1140
1026 CENTER FOR COMMUNITY SOLIDARITY TRUST NO 27 BAZAAR STREET AMIRTHAPURAM TIRUTTANI
1027 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
1028 CENTER FOR RURAL DEVELOPMENT 1/2 SOUTH GARDEN, THUMAMKURCHI, NALLIPALYAM, NAMAKKAL
1029 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD. OFFICE-VILL:HAIDADPUR(NEAR BISWASREE CLUB),P.O.:KHANTURA,P.S.:HABRA,GOBARDANGA,DIST:24PGS(N),PIN:743273 H.O.-GOBARDANGA,MUNICIPALITY SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO. 3 , 4 & 5
1030 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD.OFFICE - VILL:HAIDADPUR, P.O:KHANTURA, P.S.:HABRA,DIST:NORTH 24 PARGANAS,PIN:743273 H.O.:MUNICIPAL SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO:3,4 & 5 , P.O:GOBARDANGA
1031 CENTRAL EDUCATIONAL AND CHARITABLE TRUST CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI, THALAKKULATHUR POST KOZHIKODE
1032 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR KOZHIKODE
1033 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR
1034 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
1035 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
1036 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
1037 CENTRAL ENGINEERING INSTITUTE OF TECHNOLOGY SOCIETY GOHAIN TEKELA GAON, DIST. JORHAT, ASSAM
1038 CENTRAL ENGINEERING INSTITUTE OF TECHNOLOGY SOCIETY GOHAIN TEKELA GAON, DIST. JORHAT, ASSAM
1039 CENTRAL FOOTWEAR TRAINING INSTITUTE CFTI AGRA C-41 & 42, SITE-C, INDUSTRIAL AREA, SIKANDRA, AGRA
1040 CENTRAL INSTITUTE OF DESIGN CENTRAL INSTITUTE OF TOOL DESIGN (A GOVERNMENT OF INDIA SOCIETY MINISTRY OF MSME) BALANAGAR, HYDERABAD
1041 CENTRAL INSTITUTE OF TOOL DESIGN CENTRAL INSTITUTE OF TOOL DESIGN, NARASPUR CROSS ROADS, BALANAGAR, HYDERABAD
1042 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
1043 CENTRAL PEST CONTROL 25, SAIKRUPA, CENTRAL EXCISE COLONY, CHHATRAPATI SQUARE, NAGPUR
1044 CENTRAL TOOL ROOM AND TRAINING CENTRE KOLKATA CENTRAL TOOL ROOM AND TRAINING CENTRE (CTTC) BONHOOGHLY INDUSTRIAL AREA KOLKATA-700108, WEST BENGAL
1045 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
1046 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
1047 CENTRE FOR COMMUNITY SERVICE AND ALTRUISM NO.14,NEW STREET MANALIESTATE, PUDUPALAYAM MAIN ROAD, CUDDALORE.
1048 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
1049 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
1050 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
1051 CENTRE FOR MENTAL HYGIENE CHANGANGEI UCHEKON AIRPORT ROAD IMPHAL MANIPUR
1052 CENTRE FOR MENTAL HYGIENE CHANGANGEI UCHEKON AIRPORT ROAD
1053 CENTRE FOR MENTAL HYGIENE CHANGANGEI UCHEKON AIRPORT ROAD IMPHAL WEST MANIPUR. 795001
1054 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
1055 CENTRE FOR RURAL ECONOMIC AND EDUCATIONAL DEVELOPMENT TRUST E .N KANDIGAI, VILLAGE , 631205 CHERUKKANUR.POST .TIRUTTANI.TALUK., DISTRICT-THIRUVALLUR, TAMIL NADU
1056 CENTRE FOR RURAL ECONOMIC AND EDUCATIONAL DEVELOPMENT TRUST E .N KANDIGAI, VILLAGE , 631205 CHERUKKANUR.POST .TIRUTTANI.TALUK., DISTRICT-TIRUVALLUR, TAMIL NADU
1057 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
1058 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A1/1, INDUSTRIAL AREA, P.O-MUIDDINPUR JALESHER ROAD FIROZABAD
1059 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1,INDUSTRIAL AREA, P.O:MUIDDINPUR,JALESHER ROAD FIROZABAD
1060 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1 INDUSTRIAL AREA P.O - MUIDDINPUR JALESHAR ROAD FIROZABAD
1061 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
1062 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A
1063 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH SAS NAGAR PUNJAB YUVA BHAWAN SECTOR 42A
1064 CENTRE FOR URBAN AND RURAL DEVELOPMENT PLOT NO 8-3-354/8, FLAT NO 302,SIVA RESIDENCY,HINDI COLONY,PUNJAGUTTA,HYDERABAD,TELANGANA
1065 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
1066 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
1067 CENTRE OF EDUCATION AND DISTANCE LEARNING SAHARA HOSPITAL BASEMENT, NEAR OBC BANK PATAUDI CHOWK, BASAI ROAD,GURUGRAM
1068 CENTUM FOUNDATION 127, NEELAGAGAN, MANDI ROAD, SULTANPUR, MEHRAULI, NEW DELHI – 110030
1069 CENTURION SCHOOL OF RURAL ENTERPRISE MANAGEMENT TRUST HIG 5 BDA DUPLEX PHASE 1 POKHARIPUT BHUBANESHWAR
1070 CENTURION SCHOOL OF RURAL ENTERPRISE MANAGEMENT TRUST HIG 5 BDA DUPLEX PHASE 1, POKHARIPUT BHUBANESHWAR
1071 CENTURION SCHOOL OF RURAL ENTERPRISE MANAGEMENT TRUST HIG 5 BDA COMPLEX,PHASE 1, POKHARIPUT BHUBANESHWAR
1072 CENTURION SCHOOL OF RURAL MANAGEMENT TRUST HIG 5 BDA DUPLEX PHASE 1 POKHARIPUT BHUBANESHWAR
1073 CHAITANYA BHARAT SOCIAL PROMOTIONAL SOCIETY REGED OFFICE-142 A POCKET B MAYUR VIHAR PHASE-2 DELHI-110091 HEAD OFFICE AND CORRESPONDENCE ADDRESS NH-28 VILLEGE BHUJAINI TEHSIL - KHALILABAD DIST.SANT KABIR NAGAR UTTAR PRADESH PINCODE-272175
1074 CHAITANYA BHARAT SOCIAL PROMOTIONAL SOCIETY REGD.OFFICE-142 A POCKET-B MAYUR VIHAR PHASE-2 DELHI-110091 HEAD OFFICE & CORRESPONDENCE ADDRESS- NH-28 VILLAGE BHUJAINI TEHSIL-KHALILABAD DIST. KABIR NAGAR UTTAR PRADESH PIN CODE-272175
1075 CHAITANYA BHARAT SOCIAL PROMOTIONAL SOCIETY 142 A,POCKET B ,MAYUR VIHAR PHASE II NEW DELHI
1076 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
1077 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
1078 CHANAKYA ACADEMY RING ROAD NO 1, NEAR SARONA BRIDGE, TATIBUND, RAIPUR CG
1079 CHANAKYA FOUNDATION E.D-1/740,L.D.A COLONY,KANPUR ROAD,LUCKNOW
1080 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
1081 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
1082 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
1083 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
1084 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
1085 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
1086 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
1087 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
1088 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
1089 CHAPRA ARPITA COMPUTER ACADEMY CHAPRA RANABAND ROAD, CHRISTIAN PARA, P.O. BANGALJHI, DIST. NADIA, WEST BENGAL PIN 741123
1090 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
1091 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
1092 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
1093 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
1094 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
1095 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
1096 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
1097 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
1098 CHATRAPATI SHIVAJI SEVABHAVI SANSTHA PATANGE COMPLEX NEAR MALLIKARJUN MANDIR RING ROAD MANWAT
1099 CHATRAPATI SHIVAJI SEVABHAVI SANSTHA CHATRAPATI SHIVAJI SEVABHAVI SANSTHA PATANGE COMPLEX NEAR MALLIKARJUN TAMPAL RING ROAD MANWAT MAHARASHTRA-431505 MAHARASHTRA TEL. NO.:9860788141
1100 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
1101 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
1102 CH CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1N-3 MIA, ALWAR
1103 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
1104 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
1105 CHERRYPICK INDIA CONSULTING AND BUISINESS SOLUTIONS PRIVATE LTD 2ND FLOOR, CARMEL TOWER, COTTON HILL, VAZHUTHACAUD
1106 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY, VIJETA NAGAR, NEXT TO RNS MOTORS,SHOLAPUR ROAD, VIJAYAPUR-586103
1107 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY, DARGA ROAD BIJAPUR
1108 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY DARGA ROAD BIJAPUR
1109 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY DARGA ROAD BIJAPUR
1110 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
1111 CHETNA ALLAHABAD ROAD KARWI
1112 CHETNA ALLAHABAD ROAD, KARWI
1113 CHHATTISGARH COUNCIL OF ALTERNATIVE MEDICINE CG COUNCIL OF ALT. MED. CAMPUS, NEAR GOVT COLLEGE, MAIN ROAD LORMI, DISTT MUNGELI C.G.
1114 CHHATTISGARH COUNCIL OF ALTERNATIVE MEDICINE CG COUNCIL OF ALT. MED. CAMPUS, NEAR GOVT COLLEGE, MAIN ROAD LORMI, DISTT MUNGELI C.G.
1115 CHHATTISGARH COUNCIL OF ALTERNATIVE MEDICINE CG COUNCIL OF ALT. MED. CAMPUS, NEAR GOVT COLLEGE, MAIN ROAD LORMI, DISTT MUNGELI C.G.
1116 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
1117 CHHATTISGARH TECHNOLOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FORNT OF GOVERNMENT HOSPITAL MAIN ROAD DONDILOHARA
1118 CHHATTISGRAH TECHNALOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FRONT OF GOVERNMENT HOSPITAL MANI ROAD DONDILOHRA
1119 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTISGARH CHANDRANAHU SIKHAN SAMITI ,NEAR BY SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
1120 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI BAGBAHARA ROAD SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
1121 CHHAYA EDUCATIONAL TRUST 2/144/2,RAWLI, AGRA , UTTAR PRADESH
1122 CHHAYA EDUCATIONAL TRUST 2/144/2, RAWLI, AGRA, UTTAR PRADESH
1123 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
1124 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
1125 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
1126 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
1127 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
1128 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
1129 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
1130 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
1131 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
1132 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
1133 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
1134 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
1135 CHILD CARE SOCIETY BEHIND SHIV MANDIR, NAGINA SINGH COLONY, GUDARI, CHAPRA
1136 CHILD CARE SOCIETY BEHIND SHIV MANDIR, NAGINA SINGH COLONY, GUDARI, CHAPRA
1137 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
1138 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
1139 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
1140 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
1141 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
1142 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
1143 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
1144 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
1145 CHORD CHILDWELFARE HOLISTIC ORGANIZATION FOR RURAL DEVELOPMENT PLOT.NO: 496, FLAT.NO: 106, NAGASURI ENCLAVE, GOKUL PLOTS, OPP. BLOOMING DALES SCHOOL, NEAR KPHB 9TH PHASE, KUKATPALLY, HYDERABAD, INDIA – 500072
1146 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
1147 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
1148 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
1149 CHOUDHARY CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1 N-3, M.I.A, ALWAR
1150 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
1151 CHOUHAN HOUSING PRIVATE LIMITED CHOUHAN RESIDENCY, RAJEEV NAGAR, MUKTIDHAM ROAD, AZAD CHOWK, SUPELA, BHILAI-490023, CHHATTISGARH
1152 CHOUHAN INFRA 301,SAHYADRI TOWER,18/A,SAPTGIRI NAGAR,NARENDRA NAGAR
1153 CH RAJPAL SINGH MEMORIAL SANSTHA 400/3, SHASTRI NAGAR, MEERUT
1154 CHRIST EDUCATION AND WELFARE SOCIETY 101, GORE BUILDING, SAHAJANAND CHOWK, BEHIND RAYMOND SHOP, NEAR ZOJOWALA COMPLEX, SANTOSHI MATHA ROAD, KALYAN WEST
1155 CHRIST EDUCATION AND WELFARE SOCIETY 606,A WING, 6TH FLOOR, VERTEX VIKAS BUILDING,NEAR ANDHERI METRO STATION, ANDHERI EAST, MUMBAI , MAHARASHTRA
1156 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
1157 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
1158 CITIZEN CARE INDUSTRIES PRIVATE LIMITED PRAKASH PALACE BASEMENT ,RAJEEV COLONY , NEAR FOOT OVER BRIDGE, N.H .- 8 GURGAON- 122004, HARYANA , INDIA
1159 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
1160 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
1161 CITY MAKERS PRIVATE LIMITED CITY MAKERS PVT.LTD G-1,VASUDEO CITY,OPP-RAJHANSH GUEST HOUSE, BENIBABU BAGICHA, RAJENDRA PATH,PATNA.
1162 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
1163 CKAKPARAN KANTAKHALI CHOKHER AALO WELFARE SOCIETY VILL : MOHANPUR, PO : SOUTH MOHANPUR, PS : MAGRAHAT, SUB-DIST : MAGRAHAT - II, DIST : SOUTH 24 PARGANAS, STATE : WEST BENGAL, PIN : 743610
1164 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
1165 CLAAPS GLOBAL ENTERPRISES FLAT : 105, GREEN LAND VILLA APARTMENT, OPP 99 WINGS, BAKERTPRAKASH NAGAR, NARASARAOPET, ANHRAPRADESH
1166 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
1167 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
1168 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
1169 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
1170 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
1171 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
1172 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
1173 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
1174 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 306, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1175 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 306, 3RD FLOOR INTERNATIONAL TRADE TOWER, NEHRU PLACE
1176 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1177 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1178 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
1179 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
1180 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
1181 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
1182 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
1183 COLLEGE TULLU ROAD KANISI DISTRICT GANJAM BEHRAMPUR OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT GANJAM BEHRAMPUR, 761008
1184 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY BEHIND PT. R. S. UNIVERSITY CAMPUS, DUMAR TALAB (MAHOBA BAZAR), RAIPUR (C.G.)
1185 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY, BEHIND PT. RAVI SHANKAR UNIVERSITY, DUMAR TALAB, MOHBA BAZAR, RAIPUR
1186 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
1187 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
1188 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
1189 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
1190 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
1191 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
1192 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
1193 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
1194 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
1195 COMMUNITY HEALTH EDUCATION SOCIETY NO. 21 5TH CROSS STREET, UNITED INDIA COLONY, KODAMBAKKAM
1196 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
1197 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK
1198 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK.
1199 COMMUNITY SEVA CENTRE NO.25, SEVA ILLAM, POORANAKUPPAM & P.O PONDICHERRY, DISTRICT-PONDICHERRY, PIN CODE-605007
1200 COMMUNITY WELFARE ORGANISATION PLOT NO. 9B, IN FRONT OF BHEL GATE NO. 1, INDRAPURI, BHOPAL
1201 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
1202 COMMUNITY WELFARE ORGANIZATION AND LEAD DEVELOPMENT PLOT NO.86, II MAIN ROAD, V CROSS ST. KANCHI KAMATCHI NAGAR KTC NAGAR, V M CHATHIRAM POST, TIRUNELVELI
1203 COMMUNITY WELFARE ORGANIZATION LEAD AND DEVELOPMENT PLOT NO.86, KANCHI KAMATCHI NAGAR VM CHATHIRAM POST, TIRUNELVELI
1204 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
1205 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
1206 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD 2ND FLOOR, KUNDA HOUSE, MG ROAD, AURANGABAD
1207 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD KUNDA HOUSE,MG ROAD, AURANGABAD, BIHAR
1208 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
1209 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
1210 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER PLOT NO227/120 HOSPITAL ROAD TERVEDI COLONY INSER WARD GADARWARA
1211 COMPUTER EDUCATION SOCIETY NEAR SHAKTI CHOWK, BIJNOR(UP)
1212 COMPUTER EDUCATION SOCIETY NEAR SHAKTI CHOWK, BIJNOR(UP)
1213 COMPUTER EDUCATION SOCIETY BELOW OF UNION BANK, NEAR SHAKTI CHOWK, BIJNOR (UP)
1214 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
1215 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1216 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1217 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1218 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1219 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1220 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
1221 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1222 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1223 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1224 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1225 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
1226 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
1227 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1228 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1229 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
1230 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
1231 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
1232 COODU TRUST H.83.R M.COLONY DINDIGUL
1233 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
1234 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
1235 COREMAGE ACADEMY 518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD JAMNAGAR
1236 COREMAGE INFOTECH 518 INDRAPRASTH COMPLEX PANCHESHWAR TOWER ROAD JAMNAGAR
1237 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
1238 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
1239 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
1240 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
1241 COUNCIL FOR SKILL UTILITY TRAINING ASSOCIATION 5FT FLOOR O2 BUSSINESS CENTER, RING ROAD NO 2, NEAR RELIANCE PETROL PUMP,GONDWARA, RAIPUR C.G.
1242 COUNCIL FOR SKILL UTILITY TRANING ASSOCIATION 5 TH FLOOR, O2 BUSINESS CENTER, GONDWARA,RING ROAD NO.-2, RAIPUR, C.G.
1243 COUNCIL OF EDUCATION AND SKILL DEVELOPMENT TRUST GALI NO. 11, AASHRAM ROAD, RAO TULA RAM VIHAR, RAMPURA, REWARI
1244 COUNCIL OF EDUCATION AND SKILL DEVELOPMENT TRUST GALI NO. 12, AASHARAM ROAD, RAO TULA RAM VIHAR, RAMPURA, REWARI
1245 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
1246 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
1247 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
1248 CR DADHICH MEMORIAL SOCIETY BHATTU ROAD, NEAR PUNJABI SABHA HOSPITAL, FATEHABAD
1249 CR DADHICH MEMORIAL SOCIETY BHATTU ROAD, NEAR PUNJABI SABHA HOSPITAL, FATEHABAD
1250 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
1251 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
1252 CREATIVE FOUNDATION SHILLONGPATTY,SILCHAR,CACHAR,ASSAM
1253 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
1254 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
1255 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
1256 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
1257 CRYSTAL NETWORK SOLUTIONS B-30 , KAPIL VASTU COLONY JHALAWAR , RAJASTHAN
1258 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
1259 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
1260 CSI COMPUTECH INDIA PRIVATE LIMITED INNAVIMUMBAI (HO)CSI COMPUTECH (I) PVT. LTD.106, BUILDING 3, SECTOR 3,MILLENNIUM BUSINESS PARK, MAHAPENAVI MUMBAI-400701
1261 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
1262 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
1263 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1264 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1265 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1266 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1267 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
1268 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
1269 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
1270 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
1271 CURE ACADEMY PLOT NO : 612, RSC -52/D3, SECTOR -6, CHARKOP, KANDIVALI WEST MUMBAI - 400067
1272 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
1273 CYBERLINKS TECHNOLOGIES PRIVATE LIMITED UNIT NO 1506, 15TH FLOOR , UNITECH CYBER PARK, TOWER-B,SECTOR 39, GURGAON
1274 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
1275 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
1276 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
1277 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
1278 CYBOTECH EDUSERVE PVT LTD GOLA ROAD, NEAR IMAMBARA, NAWADA, BIHAR
1279 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
1280 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
1281 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
1282 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
1283 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
1284 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
1285 DAKSH INFOSOFT PRIVATE LIMITED G-2, GS APARTMENT, NR. SUNSHINE HONDA, HAWA SADAK, CIVIL LINES, JAIPUR
1286 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
1287 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1288 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1289 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1290 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1291 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
1292 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
1293 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
1294 DALITSANGH H.NO-13 LATA MARG MITRA KUNJ SOHAGPUR DISTT- HOSHANGABAD (MADHYAPRADESH)
1295 DALIT SANGH HOUSE NO. 13 MITRA KUNJ LATA MARG SOHAGPUR DIST. HOSHANGABAD MP
1296 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
1297 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
1298 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
1299 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
1300 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
1301 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
1302 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
1303 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
1304 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1305 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1306 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1307 DARYAV ELECTRICAL AND H C E COMAPNY DARYAV MANJIL PHASE 3 INDRAPURI COLOY TIKAMGARH
1308 DASARI VEER RAJU AND GUNNAM RAM CHANDRA RAO MEMORIAL TRUST VIKASH ENCLAVE,BARAHAGUDA CANAL CHOWK PO/DIST-BARGARH PS-BARGARH PIN-768028
1309 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
1310 DASHRATH MANJHI EDUCATIONAL CHARITABLE TRUST H/O : PRAKASH SINGH VILL : MIRZAPUR PO+PS : RISHYAP
1311 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
1312 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
1313 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
1314 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
1315 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
1316 DC SHIKSHAN SANSTHAN SIKAR
1317 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1318 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1319 DDUGKY MORD C TEST ALJBSDFLQJHF
1320 DDUGKY MORD C TEST1 LJHWDF
1321 DDUGKY MORD INC TEST2 NEW DELHI
1322 DDUGKY TEST25 AJSGFQJL
1323 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
1324 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
1325 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1326 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
1327 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1328 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
1329 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1330 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
1331 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
1332 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
1333 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
1334 DEEPAK GUPTA EDUCATION TRUST M 78 CONNAUGHT PLACE NEW DELHI
1335 DEEPAK GUPTA EDUCATION TRUST M-78 CONNAUGHT PLACE OPP FIRE STATION NEW DELHI
1336 DEEPAK WOMENS DEVELOPMENT SOCIETY ADDRESS OFFICE 1 ; GHOU MANHASAN JAMMU ADDRESS OFFICE 2 ; LANE NO.1 HUZURI BAGH ROAD TALLAB TILLO JAMMU
1337 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
1338 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
1339 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
1340 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
1341 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1342 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1343 DEEPSHIKHA MAHILA BAL UTTHAN SAMITI C/O KIRAN ITI COLLEGE,KIRAN NURSING HOME CAMPUS, HATWARA ROAD, 4 NO. DISPENSARY, SODALA, JAIPUR
1344 DEEP SMARAK SHIKSHAN SEVA SANSTHAN VILL HARPUR, PO BAGALI PIJARA
1345 DEEP SMARAK SHIKSHAN SEVA SANSTHAN YANTRA PRIVATE INDUSTRIAL TRAINING INSTITUTE, VILL HARPUR, PO BAGALI PIJARA
1346 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
1347 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
1348 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
1349 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
1350 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
1351 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1352 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1353 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
1354 DEMO ADDRESS LINE 1
1355 DEMO TEST CASE LINE ADDRESS 1233
1356 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
1357 DESTITUTE WELFARE TRUST I-228, PREM NAGAR –II, MAIN 40 FEET ROAD, KIRARI NORTH WEST DELHI 110086
1358 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
1359 DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY MAHAKAUSHAL NAGAR, BEHIND – SARASWATI H. S. SCHOOL, ADHARTAL, JABALPUR, MADHYA PRADESH, INDIA. PIN- 482 004
1360 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
1361 DEVELOPMENT INITIATIVE DEVELOPMENT INITIATIVE, SRIRAMCHANDRAPUR, P.O.-SAKHIGOPAL, PURI, ODISHA
1362 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
1363 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
1364 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI WARD NUMBER 12 INDERGARG DATIA
1365 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI INDERGARH SEVDA DATIA(M.P.)
1366 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI, WARD NO. 12 INDERGARH
1367 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
1368 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
1369 DFHDFHFH KJDVNMDV,M DV
1370 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
1371 DHAGAGIA SOCIAL WELFARE SOCIETY SUNDARIKHALI, P.O.-AGARHATI, P.S.-SANDESHKHALI
1372 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
1373 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1374 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1375 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1376 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1377 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1378 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1379 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
1380 DHANVI CHARITABLE AND EDUCATIONAL TRUST SHOP NO 39 ADITYA COMPLEX NEAR KASAK CIRCLE BHARUCH
1381 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
1382 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
1383 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
1384 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1385 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1386 DHAULADHAR EDUCATION SOCIETY VILLAGE AND POST OFFICE DRAMMAN TEHSIL- SHAHPUR DISTRICT-KANGRA
1387 DHAYA EDUCATION AND CHARITY FOUNDATION NEWBUSSTAND BUILDING SANTHANAPURAM FIRST STREET PUDUKKOTTAI
1388 DHAYA EDUCATION AND CHARITY FOUNDATION NEW BUS STAND BUILDING OXFORD CATERING COLLEGE CAMPUS SANTHANATHAPURAM STREET PUDUKKOTTAI-01 TAMILNADU
1389 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
1390 DHRUV GLOBALS LIMITED 14,MILESTONE,MATHURA ROAD ,FARIDABAD
1391 DHYANA HITHA EDUCATIONAL SOCIETY ELURU SHABAD VILLAGE AND MANDAL, RANGAREDDY DIST, TELANGANA STATE
1392 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
1393 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
1394 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
1395 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
1396 DIGITAL LYNC TECHNOLOGIES PVT LTD PLOT NO. 627, SURVEY NO. 40,KHAJAGUDA, NAGA HILLS RD, MADHURA NAGAR COLONY, GACHIBOWLI,HYDERABAD, TELANGANA
1397 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
1398 DIGITAL SHIKSHA AND ROJGAR VIKAS SANSTHAN VPO BAGRI TH PEEPLU DISTRICT TONK RAJASTHAN
1399 DIGITAL SKILL EDUCATION WELFARE SOCIETY WARD NO. 08 PLOT NO. 0153/1481/1413 PRABHAT SKILL TRAINING & COMPUTER SANSTHAN NH. 24 PILIBHIT ROAD RITHORA
1400 DIGITAL SPOKEN ENGLISH LABS PRIVATE LIMITED 191 , TAGORE STREET , RK NAGAR , VALASARAVAKKAM
1401 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR MILAK RAMPUR UP
1402 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK RAMPUR
1403 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK DISTT RAMPUR UP
1404 DIKSHA SAMAJ SEWA SOCITY MOH NAI BASTI ASDULLAPUR MILAK RAMPUR
1405 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
1406 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
1407 DIN DAYAL EDUCATION AND WELFARE TRUST D-4, KEASARBHAVANI SOCIETY, NR.MAHARANA PRATAP NAGAR, GODADARA, SURAT
1408 DIN DAYAL EDUCATION AND WELFARE TRUST D-4 ,KESHARBHAVANI SOCIETY , GODADARA NAHER,GODADARA,SURAT
1409 DISHA DISHA LANE, HISAR ROAD, SIRSA
1410 DISHA DISHA SIRSA ,DISHA LEN, FRINDES COLONY,BIHAIND PREETAM PALECE ,SIRSA PIN NO. 125055
1411 DISHA DISHA SIRSA DISHA LANE, HISAR ROAD, SIRSA- 125055
1412 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
1413 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
1414 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
1415 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
1416 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
1417 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
1418 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
1419 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
1420 DISHA SHIKSHAN AVAM KALYAN SAMITI BRILINT COMPUTER TRILOKI NAGAR NEAR RAILWAY STATION CHHINDWARA
1421 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
1422 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
1423 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
1424 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
1425 DIVERTEX SERVICES PRIVATE LIMITED 2ND FLOOR, AIYSHA COMPLEX, NEW AIRPORT ROAD, HYDERPORA ADDA, NEAR JAMIA MASJID, SRINAGAR, J&K
1426 DIVINE COLLEGE OF COMPUTER LEARNING HOUSE NO 786 ALAPUR ,MAIN MARKET ALAPUR KUNDA PRATAPGARH 229408
1427 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
1428 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
1429 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
1430 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
1431 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1432 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1433 DIVYA BHARTI SHIKSHAN SAMITI ITI SKILL DEVELOPMENT CENTER GT ROAD BULANDSHAHR
1434 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
1435 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
1436 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
1437 DIVYSAGAR SOCIETY 108, SR. MIG,NEAR ALLAHABAD BANK, KOTRASULTANABAD,
1438 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
1439 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
1440 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
1441 D K NAGARATHI EDUCATIONAL TRUST NO:103, RADHA AVENUE, SRI DEVI GARDEN, VALASARAVAKKAM, CHENNAI-87.
1442 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
1443 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
1444 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
1445 DMW CNC CENTRE 89 A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1446 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1447 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
1448 DNYANDEEP RASHTRIY SAMAJIK AND SHAIKSHNIK VIKAS SANSTHA A/P- OND, TAL-KARAD, DIST-SATARA, MAHARASHTRA
1449 DNYANDEEP RASHTRIY SAMAJIK VA SHAIKSHNIK VIKAS SANSTHA AT/POST-OND, TAL-KARAD, DIST-SATARA.
1450 DNYANESHWARI SHIKSHAN PRASARAK MANDAL SUNIL TAMBARE NIVAS, SHAHU NAGAR,BEED.
1451 DNYANESHWARI SHIKSHAN PRASARAK MANDAL C/O,SUNIL TAMBARE NIVAS,SHAHU NAGAR,BEED
1452 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
1453 DOCTORS4 BUILDING PVTLTD G-35, 4TH FLOOR, ABUL FAZAL ENCLEV - II, SHAHEEN BAGH, OKHLA, NEW DELHI
1454 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
1455 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
1456 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
1457 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
1458 DOOR DRISHTI 365 BANK COLONY DEVIL VILLAGE
1459 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
1460 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
1461 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED DQ ENTERTAINMENT (INTERNATIONAL) LIMITED 644, AURORA COLONY. ROAD NO. 3., BANJARA HILLS, HYDERABAD - 500034.
1462 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED DQ ENTERTAINMENT (INTERNATIONAL) PRIVATE LIMITED 644, AURORA COLONY, ROAD NO. 3,, BANJARA HILLS, HYDERABAD - 500034, ANDHRA PRADESH, INDIA
1463 DQ ENTERTAINMENT INTERNATIONAL PRIVATE LIMITED 644, AURORA COLONY ROAD NO 3 BANJARA HILLS HYDERABAD
1464 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
1465 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
1466 DR AMBEDKAR MEMORIAL SOCIAL WELFARE AND EDUCATIONAL TRUST AT/PO-JAGDA, ROURKELA, PS-JHIRPANI, DIST-SUNDARGARH
1467 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
1468 DR A SANKARA SUBRAMANIAN GRG PLYTECHNIC COLLEGE KUPPEPALAYAM S.S KULAM (PO) COIMBATORE
1469 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
1470 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
1471 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
1472 DRAUN SHIKSHA SAMITI CHOLL ROAD MANDLESHWAR DIST. KHARGONE (MP)
1473 DRAUN SHIKSHA SAMITI CHOLI ROAD MANDLESHWAR DIST KHARGONE (MP)
1474 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1475 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1476 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
1477 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
1478 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1479 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1480 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
1481 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
1482 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
1483 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
1484 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
1485 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
1486 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1487 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1488 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
1489 DR G P SHETTY AGRI RESEARCH AND EDUCATIONAL TRUST NO.180, 1ST MAIN, MAHALAKSHMI LAYOUT, BENGALURU
1490 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1491 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1492 DRISTI WELFARE FOUNDATION BASANT VIHAR MADIYAON LUCKNOW
1493 DRISTI WELFARE FOUNDATION AZIZ NAGER NEAR BALNIKUNJ INTER COLLEGE
1494 DRISTI WELFARE FOUNDATION BASANT VIHAR MADIYAON LUCKNOW
1495 DR KALAM EDUCATIONAL FOUNDATION GANDHI CHOWK, GHORASAHAN
1496 DR KALAM EDUCATIONAL FOUNDATION GANDHI CHOWK, GHORASAHAN
1497 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
1498 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1499 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1500 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
1501 DR K R DOSHI TRUST K.R.DOSHI SANKUL, OPP. T.V.KENDRA, GHOGHA CIRCLE, BHAVNAGAR.
1502 DR MOREPEN LIMITED 220 ANTRIKSH BHAWAN ,22 K.G. MARG BARAKHAMBA ROAD NEW DELHI
1503 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
1504 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
1505 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
1506 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
1507 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
1508 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
1509 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
1510 DR VIRENDRA SWARUP EDUCATIONAL FOUNDATION 15/96,CIVIL LINES KANPUR
1511 DR VIRENDRA SWARUP EDUCATIONAL FOUNDATION 15/96,CIVIL LINES,KANPUR,UTTAR PRADESH
1512 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
1513 DSHNFJGFD FDHGF FDSGHFDJ GH F
1514 DUM DUM PARK UNNAYANI SAMANNAY 172, LAKE TOWN, BLOCK-A, FLAT NO. 2, KOLKATA
1515 DUPATI SRI EDUCATIONAL SOCIETY H NO 87-1345-10-1, ENGINEERS COLONY,KURNOOL,AP
1516 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1517 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1518 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1519 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
1520 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1521 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA, P.O- PANAGARH BAZER, DIST- BURDWAN
1522 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
1523 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
1524 DURGAPUR INSTITUTE OF ADVANCED TECHNOLOGY AND MANAGEMENT SOCIETY G.T.ROAD,RAJBANDH.DURGAPUR
1525 DURGAPUR INSTITUTE OF ADVANCED TECHNOLOGY AND MANAGEMENT SOCIETY G.T.ROAD. RAJBANDH. DURGAPUR,DIST= BURDWAN
1526 DURGAPUR SOCIAL AND EDUCATIONAL TRUST MSAV-32, URVASHI (BENGAL AMBUJA), CITY CENTRE, DURGAPUR, DIST- PASCHIM BARDHAMAN, WEST BENGAL, PIN: 713216
1527 DURGAPUR SOCIETY OF MANAGEMENT SCIENCE DR. ZAKIR HUSSAIN AVENUE, BIDHANNNAGAR, DURGAPUR-713206, DIST: PASCHIM BARDHAMAN, STATE: WEST BENGAL
1528 DURGA SHIKSHA SAMITI 76 JYOTI NAGAR THATIPUR
1529 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
1530 DURG EDUCATION AND CHARITABLE SOCIETY DURG EDUCATION & CHARITABLE SOCIETY C/O CHHATTISGARH ENGINEERING COLLEGE BORSI-DHANORA ROAD, DHANORA, DURG
1531 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
1532 DURJAN SAL EDUCATIONAL TRUST RAM SINGH COLLEGE OF ENGG.AND TECHNOLOGY,NAGLA SIKANDAR TUNDLA-ETAH ROAD,FIROZABAD
1533 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
1534 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
1535 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
1536 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
1537 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
1538 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
1539 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
1540 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
1541 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
1542 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1543 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1544 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
1545 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
1546 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
1547 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
1548 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
1549 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
1550 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
1551 ECARTES TECHNOLOGY PVT LTD 4805/24,BHARAT RAM ROAD,DARYAGANJ,NEW DELHI
1552 ECARTES TECHNOLOGY PVT LTD 4805/24,BHARAT RAM ROAD,DARYAGANJ
1553 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
1554 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
1555 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
1556 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
1557 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
1558 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
1559 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
1560 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
1561 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
1562 EDS GADEPAN KOTA
1563 EDUCATIONAL RESEARCH AND HUMAN DEVELOPMENT COMMITTEE TRUST 1/33A,MAIN STREET, ENATHI , KIDATHIRUKKAI(POST)
1564 EDUCATIONAL SYSTEM AND WELFARE SOCIETY 61 CIVIL LINES NEAR ISLAMIYA GIRLS INTER COLLEGE BAREILLY 243001
1565 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
1566 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
1567 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
1568 EDUFUN FOUNDATION TRUST BEHIND MADHUSUDAN PLAZA, NAVGRAH SOCIETY, DHANERA
1569 EDU INSTITUTE ADDRESS
1570 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
1571 EDUSKILLS TRAINING AND DEVELOPMENT PRIVATE LIMITED CTS NO 91 & 92, OFFICE NO 203, 2ND FLOOR SHRI SAI NARAYAN PLAZA, SADASHIV PETH PUNE
1572 EDUSOL EDUCATIONAL AND WELFARE SOCIETY PLOT NO. 740, SECTOR - 82, JLPL INDUSTRIAL PARK, MOHALI
1573 EDUSPARK INTERNATIONAL PRIVATE LIMITED MOTILAL NAGAR-1 SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104, MAHARASHTRA, INDIA
1574 EDUSPARK INTERNATIONAL PRIVATE LINITED MOTILAL NAGAR-1, SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104
1575 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
1576 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
1577 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
1578 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
1579 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
1580 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
1581 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
1582 EKLAVYA DEVELOPMENT SOCIETY VILLAGE POST-KANTOLI TEHSIL- MALPURA DISTRICT-TONK RAJASTHAN 304502
1583 EK ONKAR CHARIATABEL TRUST NIRMAL KUTEYA, VILLAGE SEEECHEWAL, POST OFFICE RUPEWAL, TEHSIL SHAHKOT, DISTT. JALANDHAR, PUNJAB
1584 EK ONKAR CHARIATABEL TRUST VILLAGE SEECHEWAL, POST OFFICE RUPEWAL, TEHSIL SHAHKOT, DISTT. JALANDHAR
1585 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
1586 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
1587 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
1588 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
1589 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX.DHAKURIA,KOLKATA-700068
1590 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
1591 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
1592 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
1593 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
1594 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX,NR.CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1595 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1596 EMERTXE INFORMATION TECHNOLOGIES 83, FARAH TOWERS, 1ST FLOOR, MG ROAD, BANGALORE
1597 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
1598 E MISSION EDUCATION AND WELFARE TRUST AT- AMWATOLI, MAHUADANR, PO PS- MAHUADANR, DIST- LATEHAR, JHARKHAND
1599 E MISSION EDUCATION AND WELFARE TRUST AT- AMWATOLI, MAHUADANR, PO PS- MAHUADANR, DISTLATEHAR, JHARKHAND
1600 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
1601 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
1602 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
1603 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1604 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1605 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
1606 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
1607 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
1608 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
1609 ENTHRALLTECH PRIVATE LIMITED 3 KACHARE CLASSIC, 1ST FLOOR, NEAR KARNATAKA HIGH SCHOOL, ERANDWANE, PUNE, MAHARASHTRA
1610 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
1611 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
1612 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
1613 ENVIRONMENTAL ACTION TRUST 168, CHERANMMA NAGAR,VILANKURICHI,COIMBATORE
1614 ENVIRONMENTAL ACTION TRUST NO-6,MRG BUILDING,NAVAB THOTTAM,WORAIYUR,TRICHY
1615 ENVIRONMENTAL ACTION TRUST 58,KAMARAJ STREET EXTERN,NARASIMMAPURAM NEW PLACE,KUNIYAMUTHUR,COIMBATORE
1616 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
1617 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
1618 E PARIVARA SAGARA NIVASA SPM ROAD SAGAR 577401
1619 E PARIVARA SAGAR NIVASA SPM ROAD SAGAR 577401
1620 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
1621 EPI SKILLS FOUNDATION 5/8, PODDAR NAGAR, GROUND FLOOR, BESIDE PODDAR NAGAR HIGH SCHOOL, PRINCE ANWAR SHAH ROAD, KOLKATA - 68
1622 EPI SKILLS FOUNDATION 5/8, PODDAR NAGAR, GROUND FLOOR, PRINCE ANWAR SHAH ROAD, KOLKATA - 68 (NEAR PODDAR NAGAR HIGH SCHOOL)
1623 EPITOME HOLDINGS PRIVATE LIMITED 217, 2ND FLOOR, ANTRIKSH BHAWAN, 22 K.G. MARG NEW DELHI
1624 ERAM EDUCATIONAL SOCIETY LUCKNOW C-BLOCK INDIRA NAGAR, LUCKNOW 226016
1625 ERAM TECHNOLOGIES PVT LTD III FLOOR INKEL TOWER, ANGAMALY SOUTH PO, NEAR TELK ANGAMALY
1626 ERAM TECHNOLOGIES PVT LTD III FLOOR, INKEL TOWER, ANGAMALY
1627 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1628 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1629 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1630 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1631 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1632 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1633 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1634 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1635 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1636 ESSCO MOTORS PRIVATE LIMITED ESSCO MOTORS PVT LTD ESSCO TOWER,NEAR NEERAMANKARA PAPPANAMCODE PO,TRIVANDRUM
1637 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1638 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1639 ESTEX TELECOM PRIVATE LIMITED ESTEX TELECOM PVT. LTD., ESTEX HOUSE,38, KIRTINAGAR, DLF INDUSTRIAL AREA, NEAR SYNDICATE BANK, NEW DELHI
1640 ESTEX TELECOM PRIVATE LIMITED ESTEX HOUSE 38, DLF INDUSTRIAL AREA KIRTI NAGER
1641 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1642 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1643 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1644 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1645 EVEREST INSTITUTE OF COMPUTER EDUCATION VILL- SHOULMARI, PO- NAZIRHAT, PS- SAHEBGANJ, SUB DIV- DINHATA, DIST - COOCHBEHAR
1646 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1647 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1648 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1649 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1650 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1651 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1652 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1653 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1654 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1655 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1656 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY SHOP 1 NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1657 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1658 EXPERT SKILL DEVELOPMENT PRIVATE LIMITED 163 C BLOCK NEW MANDI SIRSA ( HARYANA )
1659 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1660 EXPLORE IT SERVICES PRIVATE LIMITED FLAT NO.42,JALVAYU VIHAR SECTOR 7,VIDHADHAR NAGAR,JAIPUR(RAJ.)
1661 EXTERIOR INTERIOR LIMITED ABHISHEK POINT BUILDING 5TH FLOOR 152 S P MUKHERJEE ROAD KOLKATA
1662 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1663 FAANS CONSULTANTS PVT LTD C#6,LIGHT HOUSE HILL ROAD,OPPOSITE KASTHURBA MEDICAL COLLEGE,HAMPANKATTA
1664 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1665 FACE INDIA TRUST FACE INDIA TRUST,141B/5B OM GAYATRI NAGAR POST TELIYARGANJ DISTRICT ALLAHABAD UP 211004 PH 0532 2544222
1666 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1667 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1668 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1669 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1670 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1671 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1672 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1673 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1674 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1675 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1676 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1677 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1678 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1679 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1680 FALKAN PVT LTD COURT ROAD MAGAM, BUDGAM, J&K
1681 FARIDSAB WELFARE SOCIETY ADARSH COMPUTER, OPP. JANTA HIGH SCHOOL, DB PATIL COMPLEX, NAIGAON
1682 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1683 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1684 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1685 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1686 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1687 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1688 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1689 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1690 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1691 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1692 FIDERE FACILITIES MANAGEMENT PVT LTD 7 CLUB DRIVE ROAD, MG ROAD, GHITTORNI NEW DELHI-1110030
1693 FINCRONY CONSULTING PRIVATE LIMITED 1ST FLOOR, ALOK BHARATI TOWER, SAHEED NAGAR, BHUBANESWAR
1694 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1695 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1696 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1697 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1698 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1699 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1700 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1701 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1702 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1703 FOOD CRAFT INSTITUTE FOOD CRAFT INSTITUTE,RONGAGORA,SAMAGURI,NAGAON,ASSAM
1704 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1705 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1706 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1707 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1708 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1709 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1710 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1711 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1712 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1713 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS REGISTER :- 61, DESHBANDHU APARTMENT, KALKAJI CONTACT DETAIL C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1714 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1715 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS UDAAN C-27, DAYANAND COLONY
1716 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS UDAAN REGISTERED OFFICE O61, DESHBANDHU APARTMENT, KALKAJI, NEW DELHI 110019 CORPORATE OFFICE :- C-27, DAYANAND COLONY, LAJPAT NAGAR IV, NEW DELHI 110024
1717 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1718 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1719 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1720 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1721 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1722 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1723 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1724 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1725 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1726 FUTURE BUILD NADAF BUILDI 2ND FLOOR NEAR RAHUL HOTEL BUS STAND ROAD HUKKERI 591309
1727 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1728 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA AULINA
1729 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA , DIST BULANDSHAHAR
1730 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1731 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1732 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1733 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1734 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1735 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1736 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1737 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1738 GAIA CONSULTING AND SOLUTION PVT LTD NO 19,1ST FLOOR,1ST MAIN ROAD,KAMARAJ NAGAR,THIRUVANMIYUR, CHENNAI - 600041, TAMILNADU
1739 GAIA CONSULTING AND SOLUTION PVT LTD NO.2, PRAKASAM STREET, BAKTHAVACHALAQPURAM, AVADI, CHENNAI - 600 054, TAMILNADU, INDIA
1740 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1741 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1742 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1743 GAJBA RESEARCH AND TRAINING INSTITUTE PVT LTD LANE NO 02, SANTOSH NAGAR, BEHIND KATRAJ LAST BUS STOP, NEAR DELIGHT BAKERY, PUNE
1744 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1745 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1746 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1747 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1748 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1749 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1750 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1751 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1752 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1753 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1754 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1755 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1756 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1757 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1758 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1759 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1760 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1761 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1762 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1763 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1764 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1765 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1766 GANGA DEVI MEMORIAL TRUST PRABHUNATH NAGAR CHAPRA GROUND FLOOR GDMT CAMPUS
1767 GANGASAGARHOMESPVTLTD D-508 ASHOK NAGAR SHADHARA DELHI 110093
1768 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1769 GANPAT UNIVERSITY GANPAT UNIVERSITY, GANPAT VIDYANAGAR
1770 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1771 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1772 GARV FOUNDATION AGAR NAGAR RAILWAY ROAD, NABHA
1773 GARV SHIKSHAN SANSTHA PURAI BHILAI
1774 GARV SHIKSHAN SANSTHA MALVIYA NAGAR DURG PURAI, UTAI, BHILAI
1775 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1776 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1777 GAURAV MEMORIAL TRUST E/5 VARDHMAN CITY PATEL NAGAR RAISEN ROAD BHOPAL 462021
1778 GAURI EDUCATIONAL SOCIETY 28-LAXMI NAGAR, SANJAY NAGAR BYPASS ROAD BAREILLY (UTTAR-PRADESH)
1779 GAUTAM BUDH HEALTH CARE FOUNDATION C-1 SECTOR 12 NOIDA
1780 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1781 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1782 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1783 GAYAK MARKETING PRIVATE LIMITED 40, MUMBAI ROAD,BANSWARA, RAJASTHAN
1784 GAYAK MARKETING PRIVATE LIMITED 40 INDUSTRIAL AREA DAHOD ROAD, BANSWARA, RAJASTHAN
1785 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1786 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1787 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1788 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1789 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1790 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTI PARK SOCIETY B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1791 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1792 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1793 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1794 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1795 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1796 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1797 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1798 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1799 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1800 GENUINESOFT ST.HINDUCOLLEGE ROAD
1801 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1802 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1803 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1804 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1805 GET SOURCE EDUCATION PRIVATE LIMITED 324-C,MODEL TOWN
1806 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1807 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1808 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1809 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1810 GFHDYHDBAH VSGYCGDHFGSDY
1811 GFHDYHDBAH QSDWEFWE
1812 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1813 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1814 GIMIT E SERVICES GIMIT BUILDING H-11 SOUTH EXTENTION PART 1
1815 GI POWER CORPORATION LIMITED GI POWER CORPORATION LIMITED 91A MITTAL COURT, NARIMAN POINT, MUMBAI 400021
1816 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1817 GIRIRAJ FOUNDATION 2ND FLOOR NAIKWADI BUILDING NEAR KSRTC BUS STAND OPP S R PATIL PETROL PUMP S G ROAD SANKESHWAR
1818 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1819 GITANJALI FOUNDATION VILLAGE BARABAGAN PO BARABAGAN PS SURI DISTRICT BIRBHUM
1820 GITANJALI FOUNDATION VILLAGE BARABAGAN POST OFFICE BARABAGAN POLICE STATION SURI
1821 GITANJALI FOUNDATION BARABAGAN, SURI, BIRBHUM, 731103
1822 GITANJALI FOUNDATION GITANJALI BUILDING, VILL-BARABAGAN, PO-BARABAGAN, PS-SURI,
1823 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1824 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1825 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1826 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1827 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1828 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1829 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1830 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1831 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1832 GK EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1833 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1834 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1835 GK FOUNDATION 36/B KALKAJI NEW DELHI
1836 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1837 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1838 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1839 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1840 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1841 GLOBAL EDUCATIONAL TRUST 17/483 SREEKANTESWARA COMPLEX BEHIND INDOOR STADIUM PUTHIYAMBALAM
1842 GLOBAL EDUCATIONAL TRUST 17/483 SREEKANTEAWARA COMPLEX PUTHIYAMBALAM PUTHIYARA PO
1843 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1844 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1845 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1846 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1847 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1848 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1849 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1850 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1851 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX,DAKBANGLOW CHOWK,OPP. PUNJAB & SINDH BANK, PATNA - 1
1852 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY PARIJAT COMPKEX, 1ST FLOOR,OPP - PUNJAB & SINDH BANK, DAKBUNGLOW CHOWK, PATNA, BIHAR
1853 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX, DAKBANGLOW CHOWK, OPP.PUNJAB & SINDH BANK, PATNA - 1
1854 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1855 GLOBAL IT SOLUTIONS 1749/2D 3RD FLOOR MUJAWAR COMPLEX ABOVE STATE BANK OF INDIA KIRLOSKAR RAOD BELGAUM
1856 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1857 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1858 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1859 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1860 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1861 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE, RAMBAGH ROAD, MUZAFFARPUR BO: 2ND FLOOR, MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1862 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1863 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1864 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1865 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1866 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1867 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1868 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1869 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1870 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1871 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1872 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101,
1873 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1874 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1875 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1876 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1877 GLOWDOWN SERVICES PRIVATE LIMITED MADHUKUNI, 2 FLOOR, BANK COLONEY, NEAR UNION BANK OF INDIA
1878 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1879 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1880 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1881 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1882 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1883 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1884 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1885 GOBARDHANDANGA EDUCATION SOCIETY VILL PO -GOBARDHANDANGA, PS-SAGARDIGHI, DIST-MURSHIDABAD,PIN-742122, WEST BENGAL
1886 GOBARDHANDANGA EDUCATION SOCIETY VILL & PO-GOBARDHANDANGA,PS-SAGARDIGHI,DIST-MURSHIDABAD
1887 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR.PO+PS-CHANDRAKONA ,DIST-PASCHIM MEDINIPUR
1888 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR,PO+PS-CHANDRAKONA
1889 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
1890 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,P.O.+P.S.-CHANDRAKONA TOWN
1891 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1892 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1893 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1894 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTEL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERALA
1895 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTEL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERALA
1896 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTAL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULAM, SOUTH RAILWAY STATION, COCHIN KERALA
1897 GOLDEN FORK RESTAURANT AND CATERING COMPANY PRIVATE LIMITED CONTINENTAL TOWERS, KARIKKAMURI CROSS ROAD, ERNAKULUM, SOUTH RAILWAY STATION, COCHIN KERELA
1898 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1899 GOLDEN GLOBE IMPEX PRIVATE LIMITED 18A, SECTOR 7 TRIKUTA NAGAR, JAMMU, JAMMU JK
1900 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1901 GOMAL JAN SEWA SANSTHAN JANKI NAGAR, WARD NO- 07, NAGAR PANCHAYAT KUSHINAGAR
1902 GOODWORTH FOREX AND SERVICES PVT LTD A-276, BASEMENT, SHIVALIK, NEW DELHI
1903 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1904 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1905 GOPAL KIRAN SIKSHA AVAM SANSKRITIK SAMITI NIMRAJE SADAN, NEW MOHAN NAGAR, THATIPUR
1906 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1907 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1908 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1909 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST JONIHA FATEHPUR
1910 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANTHAN VILL & POST JONIHA FATEHPUR
1911 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SASTHAN VILL & POST JONIHA FATEHPUR
1912 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1913 GOUSIA CHARITABLE SOCIETY OPP. GOVT. BOYS DEGREE COLLEGE PULWAMA
1914 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1915 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1916 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1917 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1918 GOYAL CELLULAR INDIA PRIVATE LIMITED SCF 184, NEAR BSNL OFFICE, HUDA COMPLEX, ROHTAK
1919 GOYAL CREATION PVT LTD OFFICE A-150(B),AMBAJI INDUSTRIAL AREA.SANTPUR,ABUROAD
1920 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1921 GPR RESOURCES PRIVATE LIMITED GPR RESOURCES PRIVATE LIMITED, DOOR NO 22A & 22B, NO 47, GROUND FLOOR, DESBANDHU PLAZA, WHITES ROAD, ROYAPETTAH, CHENNAI 600 014
1922 GPR RESOURCES PRIVATE LIMITED GPR RESOURCES PRIVATE LIMITED, 22A & 22B, GROUND FLOOR, DESBANDHU PLAZA, NO. 47, WHITES ROAD, ROYAPETTAH, CHENNAI
1923 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1924 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1925 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1926 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1927 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1928 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1929 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1930 GRAMDEEP MADHUBANI GOSAITOLA, PO - RAGHOPUR BLAT, VIA- RAMPATTI, DIST.- MADHUBANI, BIHAR
1931 GRAMDEEP MADHUBANI VILL - GOSAITOL, POST - RAGHOPURBALAT,VIA - RAMPATTI, DIST. - MADHUBANI, BIHAR.
1932 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1933 GRAMIN BAL EVAM MANAV VIKAS SAMITI AT JAGIRMAHESHKHUNT GRAM, PO: HALDHARA HAAT, PANCHAYAT: LAXMIPUR, BLOCK: KURSAKANTA, DISTT: ARARIA, PINCODE: 854331 (BIHAR)
1934 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1935 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL, SADPURA NEW COLONY, NEAR SADPURA KABRISTAN, NEEM CHOWK, MUZAFFARPUR -842002, BIHAR
1936 GRAMIN LOK SEVA SANSTHA GUMMALKONDA AT GUMMALKONDA POST ASARALLI TAH SIRONCHA DIST GADCHIROLI-442505
1937 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1938 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1939 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR, GUJARAT-384315
1940 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR
1941 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1942 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1943 GRAMIN UTHAN MANAV SANSTHAN VILL-MANDI DANTOUR,TALUKA-KHAJUWALA,DISTBIKANER, RAJASTHAN
1944 GRAMIN UTHAN MANAV SANSTHAN VILL-MANDI DANTOUR,TALUKA-KHAJUWALA,DISTBIKANER, RAJASTHAN-334023
1945 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1946 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1947 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1948 GRAMIN VIKAS SAMITI COLLEGE WARD-54 GOAL CHOWK ROHINIPURAM RAIPUR
1949 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1950 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1951 GRAMIN VIKAS SEVA SANSTHAN VILL POST TARIA LACCHIRAM KUSHINAGAR U.P
1952 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1953 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD NEAR KOTWALI SAHARA INDIA OFFICE 02ND FLOOR, MOHALLA- MURLIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1954 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD, NEAR KOTWALI, SAHARA INDIA 02ND FLOOR, MOHALLA- MULIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1955 GRAMIN VIKAS SEWA SAMITI MOHALLA- SHAKITI NAGAR POST- GANDHI NAGAR DISTRICT- BASTI, UTTAR PRADESH
1956 GRAMIN VIKAS SHIKSHAN SANSHTA GRAMIN VIKAS SHIKSHAN SANSHTA ORGANISED CAREER COMPUTER AND TECHNICAL INSTITUTE, FIRST FLOOF, STATE BANK TO GOVT. HOSPITAL ROAD, BANOSA,TQ. DARYAPUR, DIST. AMRAVATI.
1957 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1958 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1959 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1960 GRAMMYA YUBA JAGRATA SAMITY SH-47, SSD ROAD, PREMNAGAR, HAIBARGAON, DISTRICT-NAGAON, ASSAM
1961 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1962 GRAMODYOG SEWA SANSTHAN GAURIGANG ROAD MUSAFIRKHANA DIST AMETHI UP PIN 227813
1963 GRAMODYOG SEWA SANSTHAN GAURIGANJ ROAD MUSAFIRKHANA AMETHI UP
1964 GRAMODYOG SEWA SANSTHAN GAURIGANJ ROAD MUSAFIRKHANA AMETHI
1965 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1966 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1967 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1968 GRAM SHIKSHAN EVAM VIKAS SAMITI VILL +POST KAHLA MALIHABAD LUCKNOW
1969 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1970 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1971 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1972 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1973 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1974 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1975 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1976 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, 100 FT.. ROAD, AMRITSAR
1977 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1978 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1979 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1980 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1981 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1982 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1983 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1984 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1985 GREEN INDIA FOUNDATIONAL TRUST 4/66-1 SUMANGALINAGAR, PURATHAUDI, TRICHY.
1986 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1987 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1988 GREENMILE CONSULTANCY SERVICES PRIVATE LIMITED 2/5, GOLDEN ARCADE, NACHATRA HOMES NEAR ZEE SCHOOL, HOSUR
1989 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1990 GREEN THINK VENTURES PVT LTD WEBEL BHAWAN, MONIBHANDAR, 4TH FLOOR EP & GP BLOCK, SALTLAKE, SECTOR V
1991 GREEN VIEW EDUCATIONAL AND SKILLS INDIA PVT LTD PRADHAN COMPLEX THAKUR MARKET MAIN ROAD MAIRWA DHAM MAIRWA SIWAN BIHAR
1992 GRG POLYTECHNIC COLLEGE KUPPEPALAYAM S.S.KULUM POST COIMBATORE
1993 GRG POLYTECHNIC COLLEGE GRG POLYTECHNIC COLLEGE KUPPEPALAYAM S.S. KULAM POST COIMBATORE
1994 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1995 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
1996 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1997 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1998 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1999 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR PHASE-1, DELHI.
2000 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR, PHASE-1, DELHI.
2001 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
2002 GROWTH FOUNDATION OF INDIA L-46A, MALVIYA NAGAR NEW DELHI-110017
2003 G S PILLAY AND SONS CHARITABLE AND EDUCATIONAL TRUST 47, PERUMAL SANNATHI STREET, NAGAPATTINAM.
2004 G S PILLAY AND SONS CHARITABLE AND EDUCATIONAL TRUST 47, PERUMAL SANNATHI STREET, NAGAPATTINAM - 611 001
2005 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
2006 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
2007 G T TRUST 693 BAZZAR STREET, ATTUR,SALEM
2008 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
2009 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
2010 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
2011 GUJARAT ASSOCIATION FOR RURAL AND URBAN DEVELOPMENT M 11 SUMAN TOWER SECTOR 11 CH ROAD GANDHINAGAR
2012 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
2013 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
2014 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
2015 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
2016 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
2017 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
2018 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
2019 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
2020 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
2021 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
2022 GUNDADHUR SEVA SHIKSHAN SANSTHA NAYAPARA ANTAGARH BLOCK:- ANTAGARH DISTRICT:-KANKER
2023 GUNDADHUR SEVA SHIKSHAN SANSTHA NAYAPARA ANTAGARH BLOCK:- ANTAGARH DISTRICT:-KANKER
2024 GUNJ SHIKSHA SEWA EVAM VIKAS SAMITI ATHNER COLLEGE ROAD ATHNER DIST- BETUL (M.P.)
2025 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
2026 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
2027 GURU EDUCATIONAL TRUST NO-2/229E, SALEM MAIN ROAD, B. NADOOR. BOMMIDI, DHARMAPURI-635301.
2028 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
2029 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
2030 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
2031 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
2032 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
2033 GURUKRUPA EDUCATIONAL TRUST MAHABAHU ENCLAVE, PLOT NO. 1753/3, AT - KALARAHANGA, POST - KIIT SQUARE, BHUBANESWAR, KHORDHA, ODISHA
2034 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
2035 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
2036 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
2037 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
2038 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
2039 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
2040 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
2041 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
2042 GVK EMERGENCY MANAGEMENT AND RESEARCH INSTITUTE MEDCHAL ROAD, DEVARYAMZAL, SECUNDERABAD, TELANGANA
2043 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
2044 GYANARPAN SAMAJ SEVI SANSATHAN IN FRONT OF SUPTESHWAR GANESH MANDIR RATAN NAGAR ROAD JABALPUR MADHYA PRADESH
2045 GYANARPAN SAMAJ SEVI SANSATHAN IN FRONT OF SUPTESHWAR GANESH MANDIR RATAN NAGAR ROAD JABALPUR
2046 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR RSM TIRAHA, KALAGARH ROAD, DHAMPUR
2047 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, RSM TIRAHA, KALAGARH ROAD, DHAMPUR
2048 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
2049 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
2050 GYAN KALP CHARITABLE TRUST INDIC HEIGHTS, AT/PO-MUKTAPUR, KHORDHA
2051 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
2052 GYAN SAROVAR SHIKSHA EVAM JAN KALYAN SAMITI 5, NEAR GAS AGENCY, S.A.T.I ROAD
2053 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
2054 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
2055 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
2056 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
2057 HAIR RAISERZ SCO 27, SECTOR 15C, CHANDIGARH
2058 HAIR RAISERZ SCO 27, SECTOR 15C, CHANDIGARH
2059 HAIR RAISERZ LLP SCO 27, SECTOR 15C, CHANDIGARH
2060 HAIR RAISERZ LLP SCO 27, SECTOR 15C, CHANDIGARH
2061 HAIR RAISERZ LLP SCO 27, SECTOR 15C, CHANDIGARH
2062 HAIR RAISERZ LLP SCO 27, SECTOR 15C CHANDIGARH
2063 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
2064 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
2065 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
2066 HANKER SOLUTIONS PVT LTD B610, LOGIX TECHNOVA, SECTOR 132, NOIDA
2067 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
2068 HAPPINESS FOR ALL WELFARE AND EDUCATION SOCIETY 1ST FLORE SAMADHAN CAREER ACADEMY TANDON BAGICHA DAMOH 470661
2069 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
2070 HAPPY WELFARE SOCIETY PLAT NO 11 PURWANCHAL NAGAR ALOK DUBEY ROAD KALYANPUR LUCKNOW
2071 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
2072 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
2073 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
2074 HARIBALA TRUST 2/173,HARIBALA ILLAM, T PUDUR, SIVAGANGAI TAMILNADU
2075 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
2076 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
2077 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
2078 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
2079 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
2080 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
2081 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
2082 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
2083 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
2084 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
2085 HARSHAMITRA ONCOLOGY PRIVATE LIMITED 1273-13, KALINGIPATTI SALAI BLOCK VIRALIMALAI ILLUPPUR TALUK PUDUKKOTTAI TN 621316 IN
2086 HARSHAMITRA ONCOLOGY PRIVATE LIMITED HARSHAMITRA ONCOLOGY PVT LTD, 1273-13,KALINGAPATTI SALAI BLOCK, VIRALIMALAI, ILUPPUR TALUK
2087 HARSH PVT LTD SDFAAFDSSDF
2088 HARYANA ESTATE SOLUTIONS HARYANA ESTATE SOLUTIONS,SHOP NO.-1,GROUND FLOOR,NEAR FOOD HUB SEC 37,MAIN SECTOR ROAD,BASAI ENCLAVE EXTN. ,GURGAON 122001
2089 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
2090 HASAN EDUCATIONAL SOCIETY HASAN EDUCATIONAL SOCIETY MAIN ROAD VPO JAULA TEHSIL BUDHANA DIST MUZAFFARNAGAR UTTAR PRADESH PIN 251309
2091 HATE KALAME SHIKSH KENDRA AUSHGRAM ROAD, GUSHKARA KALITALA, PURBA BARDDHAMAN, WEST BENGAL
2092 HATE KALAME SHIKSH KENDRA AUSHGRAM ROAD (KALITALA), P.O.: GUSKARA, P.S.: AUSHGRAM, DIST.- BURDWAN, PIN- 713128 (W.B)
2093 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
2094 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
2095 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
2096 HEAD HELD HIGH FOUNDATION 22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
2097 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
2098 HEAD HELD HIGH FOUNDATION VILLA 21-22, PALM MEADOWS, PHASE-1, RAMAGONDANAHALLI, WHITEFILED ROAD, BANGALORE
2099 HEAD HELD HIGH FOUNDATION NO.22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
2100 HEALTH AND EDUCATION FOR ALL HEAL HEAL PARADISE, THOTAPALLI, AGIRIPALLI, KRISHNA DISTRICT,ANDHRA PRADESH
2101 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
2102 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
2103 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
2104 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
2105 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
2106 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
2107 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
2108 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
2109 HEERA HOSPITALITY PRIVATE LIMITED S.NO. 298, DHULE ROAD, NANDURBAR
2110 HEERA HOSPITALITY PRIVATE LIMITED SAI SEVA HOSPITAL, DHULE ROAD, NANDURBAR, MAHARAHSTRA
2111 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
2112 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414 BLOCK NO 22,23,24,25
2113 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414,BLOCK NO 22/23/24/25 HUMNABAD ,BIDAR
2114 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
2115 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
2116 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
2117 HELPING HAND WELFARE SOCIETY REG.OFFICE VILL SARSOPAR POST BHUSWAL BU DIST GORAKHPUR 273403 HEAD OFFICE- BHITAHA, KAURIRAM GORAKHPUR-273413
2118 HELP TRUST HELP TRUST 2/535C, C.S.COMPLEX, SAMATHUVAPURAM, THONDI ROAD, SIVAGANGAI 630561.
2119 HELP TRUST HELP TRUST, 2/535C, C.S. COMPLEX, SAMATHUVAPURAM, THONDI ROAD, SIVAGANGAI.
2120 HENRIA UNIQUE EDUCATION CENTRE VILL&P.O-HENRIA,P.S-KHEJURI,DIST-PURBA MEDINIPUR,W.B-721430,MOB.NO-09333826577,09733849073
2121 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
2122 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
2123 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
2124 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
2125 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
2126 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
2127 HEROTOM INFRASTRUCTURE PRIVATE LIMITED HEROTOM INFRASTRUCTURE PRIVATE LIMITED J 71, GALI NO-4, LAXMI NAGAR - 110092, DELHI, INDIA
2128 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
2129 HEWTECH SYSTEM C-2, JAIPRAKASH NAGAR ASHIYANA, PATNA, BIHAR
2130 HGS INTERNATIONAL SERVICES PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI
2131 HGXDNG CBGNCBNMCNFMHXFVM
2132 HHHH 43434
2133 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
2134 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
2135 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
2136 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
2137 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
2138 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
2139 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
2140 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
2141 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
2142 HINDUJA OUTSOURCING SOLUTIONS INDIA PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI - 400018, MAHARASHTRA, INDIA
2143 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
2144 HINDUSTANI TANZEEM FROGHE ILMOFUN FLAT NO. 202, KALYANI COMPLEX, LANGERTOLI CHAURAHA, PATNA - 800004
2145 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
2146 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
2147 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
2148 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
2149 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
2150 HIRANYAM VIKAS SANSTHAN 2/C, MAHIMA TOWER, OPPOSITE CHANDNI CHOWK APARTMENTS, PIPLOD, SURAT, GUJARAT.
2151 HIRANYAM VIKAS SANSTHAN 2/C, MAHIMA TOWER, PIPLOD SURAT GUJARAT
2152 HIREEX CAREER SOLUTIONS SHOP NO 1 AND 2 KAPEESH MALL, M G ROAD MULUND WEST MUMBAI 400080
2153 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
2154 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
2155 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
2156 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
2157 HLL MANAGEMENT ACADEMY HLL MANAGEMENT ACADEMY TC 4/1607, KESTON ROAD, KOWDIAR P O, TRIVANDRUM
2158 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
2159 HOLISTIC CORPORATE SERVICES PRIVATE LIMITED 5 HETAL APT, 1ST FLOOR, NEAR DEEPALI TRAVELS, NS ROAD, MULUND - WEST
2160 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
2161 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
2162 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
2163 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
2164 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
2165 HOPE INDIA CA-5,GOVINDO NIWAS SANYUKTA APPARTMENT KOLKATA
2166 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
2167 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
2168 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
2169 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
2170 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
2171 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
2172 HRDS INDIA HRDS INDIA DOOR NO: XIV/273, NEAR POST OFFICE, CHANDRANAGAR,PALAKKAD,KERALA
2173 HRDS INDIA THE HIGHRANGE RURAL DEVELOPMENT SOCIETY HRDS INDIA, XIV/273, NEAR POST OFFICE, CHANDRANAGAR, PALAKKAD, KERALA, INDIA
2174 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
2175 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG H. NO.52 PATHALGAON LINEPARA PATHALGAON
2176 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
2177 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
2178 HR SQUARE LLP PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
2179 HSADALO FFSE
2180 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
2181 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
2182 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
2183 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
2184 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
2185 HUMANITY WELFARE SOCIETY 860/22, LANE NO. 2 AMBA VIHAR MUZAFFARNAGAR
2186 HUMANITY WELFARE SOCIETY 860/22, LANE NO.2, AMBA VIHAR MUZAFFARNAGAR
2187 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
2188 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
2189 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
2190 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
2191 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
2192 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
2193 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
2194 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
2195 HYDERABAD COUNCIL OF HUMAN WELFARE 12-2-790/56, AYODHYA NAGAR COLONY, MEHDIPATNAM, HYDERABAD
2196 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
2197 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
2198 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
2199 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
2200 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
2201 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
2202 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
2203 ICCO C-19/A, FIRST FLOOR GREENPARK EXTENSION NEW DELHI
2204 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
2205 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA ,DHAKOLI ,ZIRAKPUR, MOHALI
2206 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
2207 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
2208 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA, DHAKOLI ZIRAKPUR, MOHALI PUNJAB
2209 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
2210 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA VILLAGE DHAKULI ZIRAKPUR, MOHALI
2211 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
2212 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA ,DHAKOLI ZIRAKPUR, MOHALI
2213 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
2214 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
2215 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
2216 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
2217 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
2218 ICTPMU DDUGKY TEST NEW DELHI
2219 ICTPMU TEST11 NEW DELHI110001
2220 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
2221 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
2222 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
2223 IDEN GRAPHICS PRIVATE LIMITED 19, JAWAHARLAL NEHRU ROAD 2ND FLOOR, KOLKATA - 700 087
2224 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
2225 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
2226 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
2227 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
2228 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
2229 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
2230 IGEP TRUST C-5-C/22B, JANAKPURI
2231 IIAE EDUCATIONAL SOCIETY REGD OFFICE: 104-C, FLOWER ENCLAVE, DUGRI, LUDHIANA CORP OFFICE: SCF 20, 2ND FLOOR, PHASE 1, URBAN ESTATE, DUGRI, LUDHIANA
2232 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
2233 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
2234 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
2235 IITS EDUCATIONAL AND HEALTH TRUST NEAR HDFC BANK COLLEG ROAD KULGAM
2236 IITS EDUCATIONAL AND HEALTH TRUST NEAR HDFC BANK
2237 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
2238 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
2239 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
2240 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
2241 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
2242 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
2243 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2244 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2245 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
2246 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
2247 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2248 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE PULWAMA J&K
2249 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2250 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
2251 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
2252 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
2253 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
2254 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
2255 IMPS EDUCATIONAL TRUST VIDYAPITH ROAD, DESHBANDHUPARA, SILIGURI,
2256 IMPS EDUCATIONAL TRUST BIDYAPITH ROAD, DESHBANDHUPARA,SILIGURI,
2257 IMPULSIVE SOCIAL AWARENESS COMMITTEE WARD NO 02 JAWALAMUKHI MOHLLA SIHORA DIST.JABALPUR M.P.
2258 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
2259 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
2260 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
2261 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2262 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2263 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
2264 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2265 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2266 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2267 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
2268 INDIA LIVESTOCK ORGANIC CO 572/2,ADRASH NAGAR, NEW RAILWAY ROAD, GURGAON, HARYANA-122001
2269 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
2270 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, POST-HATIBERIA,HALDIA
2271 INDIANEERS MEDIA PRIVATE LIMITED A-494, SHAHPURA, BHOPAL, MADHYA PRADESH
2272 INDIAN HUMAN WELFARE SOCIETY D316, HADEVPURI, SHAHADARA, DELHI
2273 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
2274 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
2275 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR SHIBPUR BOTANIC GARDEN HOWRAH
2276 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR POST OFFICE BOTANIC GARDEN SHIBPUR HOWRAH WEST BENGAL
2277 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
2278 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
2279 INDIAN INSTITUTE OF FLEET MANAGEMENT 602 & 603, QUEENS COURT, JAN KALYAN NAGAR, OFF MARVE ROAD, MALAD WEST,
2280 INDIAN INSTITUTE OF FLEET MANAGEMENT 602 & 603, QUEENS COURT, JANKALYAN NAGAR,MALAD WEST, MUMBAI.
2281 INDIAN INSTITUTE OF HARDWARE TECHNOLOGY LIMITED #15, SRI LAKSHMI COMPLEX, 4TH FLOOR , ST MARKS ROAD BANGALORE-560001
2282 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
2283 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
2284 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
2285 INDIAN INSTITUTE OF INFORMATION TECHNOLOGY VILL-CHHOTOJIRAKPUR,PO-BASIRHAT(RS),PS-BASIRHAT
2286 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
2287 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
2288 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2289 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2290 INDIAN MEDICAL TRUST NIMS UNIVERSITY DELHI JAIPUR HIGHWAY JAIPUR
2291 INDIAN MEDICAL TRUST 4, GOVIND MARG, NEAR MOTI DUNGRI CIRCLE, JAIPUR
2292 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
2293 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
2294 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
2295 INDIAN SOCIETY FOR TRAINING AND DEVELOPMENT TRAINING HOUSE, B-23 QUTAB INSTITUTIONAL AREA, NEW MEAHRULI ROAD, NEW DELHI
2296 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
2297 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
2298 INDIAN TECHNICAL INSTITUTE A UNIT OF NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION CAMPUS:NALAPARA,NEW VIP,LOKHRA,GUWAHATI-781040,ASSAM REGISTERED OFFICE:16NO TINIALI,ABOVE ALLAHABAD BANK,KAMLABARI,ROAD,DULIAJAN-786602,DISTRICT-DIBRUGARH,ASSAM
2299 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PRIVATE LIMITED B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BR 800004 INDIA
2300 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PVT LTD B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BIHAR INDIA
2301 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
2302 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
2303 INDO AMERICAN FRIENDS GROUP TEHSIL ROAD , SALON , RAEBARELI , UTTERPRADESH
2304 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
2305 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
2306 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
2307 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
2308 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5003 PHASE-4,GIDC,VATVA MEHMDABAD ROAD,AHMEDABAD-382445 GUJARAT
2309 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5000/ PHASE - 4 GIDC, VATVA, MEHMEDABAD ROAD, AHMEDABAD, GUJARAT
2310 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
2311 INDOSYS WELFARE SOCIETY OPP. UNIVERSITY CAMPUS, TALWANDI SABO
2312 INDOTECH INFORMATION SYSTEMS PRIVATE LIMITED 2ND FLOOR, OPP HOTEL SEPAL, NEAR TINKONI, BATHINDA, PUNJAB-151001
2313 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
2314 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
2315 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
2316 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
2317 INDRAKAMAL CHARITABLE TRUST MUKHERRJEE, HATA, ARA, BHOJPUR, BIHAR, INDIA
2318 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
2319 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
2320 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
2321 INDUS CORE EDUCATION FOUNDATION G-7,KARAN GREENS ,MUMBAI BANGALORE HIGHWAY, NEAR ROSARY INTERNATIONAL SCHOOL, WARJE
2322 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
2323 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
2324 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
2325 INDUS FOUNDATION 156-GA, UMAR PUR NIWA, NEAE NEHRU PARK,DHOOMANGANJ, ALLAHABAD,U.P.-211001, INDIA
2326 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
2327 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
2328 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
2329 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
2330 INFLIGHT AIRWAYS TRAINING PRIVATE LIMITED VIKAS APARTMENT FLAT NO. 101, NEAR GLENN HILL SCHOOL, MANDUADIH, VARANASI
2331 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
2332 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
2333 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
2334 INFOSOFT COMPUTER EDUCATION 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, NEAR DAY & NIGHT JN., SRIKAKULAM
2335 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
2336 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
2337 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
2338 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
2339 INITIATIVE FOR SOCIAL DEVELOPMENT AND EDUCATION WELFARE SOCIETY B-311, YASHWANT SHOPPING CENTER , CARTER ROAD NO. 7 BORIVALI (EAST), MUMBAI -400066
2340 INITIATIVE FOR SOCIAL DEVELOPMENT AND EDUCATION WELFARE SOCIETY CURE ACADEMY D 3 CHARKOP ANITA CHS LTD SECTOR 6 PLOT NO 612 RSC 52 CHARKOP KANDIVALI WEST MUMBAI 400067
2341 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
2342 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
2343 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
2344 INNODUST TECHSOLUTION PRIVATE LIMITED S3/75/1,MANCHESWAR INDUSTRIAL ESTATE, RASULGAD,BHUBANESWAR,751010
2345 INNODUST TECHSOLUTION PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR,SAHIDNAGAR, BHUBANESWAR, 751007
2346 INNODUST TECHSOLUTIONS PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR, SAHIDNAGAR, BHUBANESWAR, ODISHA
2347 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED 21-1-60,3RD FLOOR JANDYALA VARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA,TENALI
2348 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED, 21-1-60, 3RD FLOOR JANDYALA VAARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA, TENALI - 522201, GURNTUR DISTRICT, ANDHRA PRADESH, INDIA
2349 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR, 21ST. CENTURY PLAZA, SECTOR 8 COMM. CENTRE, ROHINI, DELHI
2350 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
2351 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
2352 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR 21ST. CENTURY PLAZA, SECTOR 8 COMM CENTRE, NEAR ICICI BANK ROHINI, DELHI
2353 INNOVATIVE EDUCATION SOCIETY 3RD FLOOR, VIMAL SHANTI TOWERS, NAPIER TOWN, JABALPUR, M.P.
2354 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
2355 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
2356 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
2357 INODE TALENT INSTITUTE PRIVATE LIMITED 3RD FLOOR, SEETHYS TOWER, VALLATHOL JUNCTION, THRIKKAKARA
2358 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
2359 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
2360 INSIGHT TV NEWS NETWORK PRIVATE LIMITED 314, AKANSHA BUILDING, 2, PRESS COMPLEX, M.P. NAGAR, ZONE-1, BHOPAL
2361 INSPIREDGE IT SOLUTIONS PRIVATE LIMITED H.NO: 1-111-19, PLOT NO 142, SECTOR 8, MVP COLONY, VISAKHAPATNAM
2362 INSPIRE EDUCATION AND CHARITABLE TRUST PLOT NO-1392/1 SECTOR-2B
2363 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2364 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2365 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
2366 INSTITUTE OF COMPUTER MANAGEMENT SCIENCE AND TECHNICAL EDUCATION RAZVI BUILDING MIRZA KAMIL HAWAL
2367 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
2368 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
2369 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
2370 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
2371 INSTITUTE OF ENVIRONMENT AND ECO DEVELOPMENT SHYAM NAGAR COLONY, MAURYAPATH, P.O.- B.V.COLLEGE, KHAJPURA, PATNA(BIHAR)
2372 INSTITUTE OF GOOD MANUFACTURING PRACTICES INDIA PRIVATE LIMITED H-119, SECTOR-63, NOIDA (UTTAR PRADESH) 201307
2373 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA-700049
2374 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA
2375 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35.M.B ROAD, UDAYPUR,BELGHARIA,KOLKATA
2376 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
2377 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
2378 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FLOUR SIRMOUR CHOUK REWA M.P.
2379 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
2380 INSTITUTE OF SKILL MANAGEMENT SYSTEM 568/2A JEYANKONDAM ROAD, ARIYALUR - 621704 TAMIL NADU
2381 INSTITUTE OF SKILL MANAGEMENT SYSTEM 568/2A JEYANKONDAM ROAD, ARIYALUR 621704 TAMILNADU
2382 INSTITUTE OF SKILL MANAGEMENT SYSTEM 568/2A JEYANKONDAM ROAD, ARIYALUR 621704
2383 INSTITUTE OF SKILL MANAGEMENT SYSTEM 568/2A, JEYANKONDAM ROAD, ARIYALUR -621704 TAMILNADU
2384 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT HO:GI-31,ANUKAMPA-II,KALINDIPURAM PHASE II,ALLAHABAD-211011 48/9,SRK TOWER,ELGIN ROAD,CIVIL LINES ALLAHABAD-211001 U.P.
2385 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT 48/9,SRK TOWER,ELGIN ROAD ,CIVIL LINES,ALLAHABAD-211001 U.P.
2386 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
2387 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
2388 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
2389 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
2390 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
2391 INTEGRATED INFOTECH AND CONSULTANCY SERVICES PRIVATE LIMITED ITI BAHERI VILLAGE PO PS - BAHERI DARBHANGA
2392 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY OPP.GOVT UP SCHOOL PERINJANAM P O THRISSUR DIT
2393 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY, REG NO: TSR/TC/503/2014, P O PERINJANAM THRISSUR KERALA
2394 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SERVICE SOCIETY REG NO: TSR/TC/503/2014 P O PERINJANAM THRISSUR KERALA
2395 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
2396 INTEGRATED RURAL PEOPLE WELFARE ASSOCIATION NEAR SAIRAM DEGREE COLLEGE BY PASS ROAD PARVATHIPURAM VIZIANAGARAM DISTRICT
2397 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
2398 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
2399 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
2400 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
2401 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
2402 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
2403 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
2404 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
2405 INTELLISENSE INFOTECH PRIVATE LIMITED DSM 448, 449 DLF TOWER, SHIVAJI MARG, MOTI NAGAR, NEW DELHI
2406 INTELNET IT SOLUTIONS PRIVATE LIMITED 20/1 ASHUTOSH CHOWDHURY AVENUE, 2ND FLOOR, KOLKATA, WEST BENGAL, INDIA
2407 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
2408 INTERNATIONAL CENTRE FOR ENTREPRENEURSHIP AND CAREER DEVELOPMENT SECTOR E-1/41, LANE 11C, STERLING CITY, BOPAL, AHMEDABAD
2409 INTERNATIONAL CENTRE FOR ENTREPRENEURSHIP AND CAREER DEVELOPMENT SECTOR E-1/41, LANE 11C, STERLING CITY, BOPAL, AHMEDABAD
2410 INTERNATIONAL CENTRE FOR INTELLECTUAL TRAINING AND EMPOWERMENT SRI RAMS, NH ROAD KAZHAKUTTOM
2411 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
2412 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
2413 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
2414 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
2415 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
2416 INTER NATIONAL INSTITUTE OF SKILL AND EXCELLENCE #13, 3RD FLOOR, ST.JOHN'S CHURCH ROAD BANGALORE-560005
2417 INTERNATIONAL INSTITUTE OF SKILL AND EXCELLENCE 13TH,3RD FLOOR.ST-JOHN'S CHURCH ROAD NEXT BHARATHI NAGAR POLICE STATION BANGALORE5
2418 INTERNATIONAL INSTITUTE OF SKILL AND EXCELLENCE NO.64 DODDABIDREKALLU OF YESWANTHAPURA HOBLI GANGONDANHALLI MIAN ROAD NAGASANDRA POST NEAR PEENYA DASARAHALLI NEAR 8TH MILE
2419 INTERNATIONAL INSTITUTE OF SKILL AND EXCELLENCE PVT LTD NO.64 DODDABIDREKALLU OF YESWANTHAPURA HOBLI GANGONDANHALLI MIAN ROAD NAGASANDRA POST NEAR PEENYA DASARAHALLI NEAR 8TH MILE
2420 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
2421 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
2422 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET, POLUR TALUK,TIRUVANNAMALAI DISTRICT, TAMILNADU.
2423 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET,POLUR TOWN,TIRUVANNAMALAI DITRICT,TAMILNADU.
2424 INTERNATIONAL RURAL EDUCATION AND CULTURAL ASSOCIATION INRECA SANSTHAN INRECA SANSTHAN, INRECA COMPLEX RAJPIPLA ROAD DEDIAPADA DIST NARMADA GUJARAT
2425 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2426 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2427 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
2428 INTERNATIONAL TRACEABILITY SYSTEM LIMITED 3RD FLOOR, SHREE SHARDA FORTUNE TOWER,198/2/1, EAST OF KAILASH, NEW DELHI
2429 INVISION CMPUTER EDUCATION SOCIETY CHHATTISGARH GIRISH KUMAR SAHU INVISION COMPUTER MATIYA ROAD DONGARGAW
2430 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
2431 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
2432 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
2433 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
2434 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
2435 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
2436 ISECT WELFARE AND EDUCATION SOCIETY BARAN NEAR KUMHARON KA MANDIR VISHNU VYAYAMSHALA SABJI MANDI KI TEK BARAN 325205
2437 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
2438 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
2439 ISHAN JAN SEVA SANSTHAN K-206,YASHODA NAGAR,KANPUR
2440 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
2441 ISHWARDAS MEMORIAL SHIKSHA ANUSANDHAN EVAM PRASHIKSHAN SANSTHAN KHASRA NO. 1522 WARD NO. 05 NEAR PHED OFFICE LADNUN NAGAUR RAJASTHAN 341306
2442 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
2443 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
2444 ISTI EDUCATION PRIVATE LIMITED E-15, BASEMENT, LAJPAT NAGAR-I, NEW DELHI
2445 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
2446 ISWARD CHURCH BIDAR, RAJKAHAR, DUDHI, SONEBHADRA PIN - 231208
2447 IT LITERACY MISSION CHARITABLE SOCIETY PAMMAM COMPLEX, NEAR MUTHUMARIAMMAN TEMPLE, SATHRAM JN NEDUMANGAD, TRIVANDRUM, KERALA
2448 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
2449 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
2450 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2451 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2452 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2453 ITRC TECHNOLOGIES PRIVATE LIMITED "ITRC HOUSE", 306-EB, SECTOR B, SCHEME NO. 94, OPPOSITE BOMBAY HOSPITAL, INDORE
2454 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
2455 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
2456 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
2457 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
2458 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
2459 IVYS DESIGN PRIVATE LIMITED 46-SINDHU NAGAR PATEL PATH MURALIPURA JAIPUR RAJ.
2460 JAAT INSTITUTE OF INFORMATION TECHNOLOGY VPO BHARATIA THANA BALDEV TEHSIL MAHAVAN DISTRICT MATHURA STATE UTTAR PRADESH PIN 281302 M NO 8755202277
2461 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
2462 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
2463 JADISH MISHRA SIKSHA PRACHAR PRASAR SAMITI JADISH MISHR SHIKSHA PRACHAR PRASAR SAMITI, SONDA(EAST), SALEMPUR ROAD, DIST- DEORIA, CITY-DEORIA, UP
2464 JAFRI EDUCATION SOCIETY A 143/D-6/W, QAZI TOLA(PEELI KOTHI) MORADABAD-244001 UP
2465 JAGANNATH GUPTA FAMILY TRUST NISCHINTAPUR, BUDGE BUDGE
2466 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE;26GANESH CHANDRA AVENUE KOLKATA MAILING ADDRESS;BUDGE BUDGE INSTITUTE OF TECHNOLOGY BUDGE BUDGE KOLKATA
2467 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE :26,GANESH CHANDRA AVENUE,KOLKATA 700013 MAILING ADDRESS: BUDGE BUDGE INSTITUTE OF TECHNOLOGY, BUDGE BUDGE, KOLKATA
2468 JAGAN NATH GUPTA MEMORIAL EDUCATIONAL SOCIETY PLOT NO-4, SECTOR-3, ROHINI, DELHI
2469 JAGAN RAJ PROFESSIONAL STUDIES PVT LTD 223,PRATAP NAGAR HOUSING SOCIETY,VASHISHATH MARG,VAISHALI NAGAR,JAIPUR,RAJ.
2470 JAGDAMBA TECHNICAL SOCIAL ORGANISATION AT & PO BHAMBLA TEH SARKAGHAT DISTT MANDI HP
2471 JAGDAMBA TECHNICAL SOCIAL ORGANIZATION VPO BHAMBLA, TEHSIL SARKAGHAT, DISTT. MANDI H.P. INDIA
2472 JAGDISH MISHRA SIKSHA PRACHAR PRASAR SAMITI JADISH MISHR SHIKSHA PRACHAR PRASAR SAMITI,SONDA(EAST), SALEMPUR ROAD, DIST- DEORIA, CITY-DEORIA,UP
2473 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
2474 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
2475 JAGO GAON REGISTERED OFFICE-47A,B2,SEWAK PARK,UTTAM NAGAR,NEW DELHI FIELD OFFICE-VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR, ADMIN OFFICE-HOUSE NO- A2/7/31,PLOT NO-23,PH-V, AYA NAGAR EXT,NEW DELHI-110047
2476 JAGO GAON JAGO GAON PRIVATE ITI VILLAGE-DAMODARPUR,POST-PASOPUR,BLOCK-BHAGWANPUR,DISTRICT-BEGUSARAI,BIHAR
2477 JAGO GAON VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR
2478 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
2479 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2480 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2481 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2482 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2483 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2484 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2485 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2486 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2487 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
2488 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
2489 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
2490 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
2491 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
2492 JAHNAVI TECHNICAL EDUCATIONAL SOCIETY JAHNAVI INSTITUTE OF MULTIMEDIA TECHNOLOGY C/O JAHNAVI DIGITAL STUDIO, BRIDGE ROAD, NEAR 7 ROAD JUNCTION, OPP : SBI ATM, SRIKAKULAM-532001 ANDHRA PRADESH
2493 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
2494 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
2495 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1, GOMTINAGAR
2496 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1 GOMTI NAGAR, LUCKNOW, UP
2497 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
2498 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
2499 JAI MAMAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN CHOWK, DAYALBAND
2500 JAIN COMPUTER ACADEMY SAMITI WARD NO 01 MAHATMA GANDHI WARD BANDA BELAI
2501 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
2502 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
2503 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR
2504 JAIN WELFARE TRUST 107, OLD DHANMANDI, SRI GANGANAGAR
2505 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRIGANGANAGAR RAJ-335001
2506 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
2507 JAISHREEHARI JANKALYAN AVAM SHIKSHA PRASAR SMITI NEAR BY ATTA CHAKKI ,H.NO 1,BLOCK-A,SHASTRI NAGAR BHIND ,MADHYAPRADESH
2508 JAI SIKSHAN SAMITY WARD NO. 21 BHALESAR ROAD, MAHASAMUND
2509 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2510 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2511 JAMMU AND KASHMIR INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION LTD DIC COMPLEX, EXHIBITION GROUND, JAMMU
2512 JAMMU AND KASHMIR INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION LTD DIC COMPLEX EXHIBITION GROUND JAMMU
2513 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
2514 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
2515 JANAMBHUMI PRAGATI SAMAJ VILL SHASTRINAGAR PO BALADMARI PS AND DISTRICT GOALPARA
2516 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
2517 JANASNEHI SOCIAL WELFARE SOCIETY SHIGGAON JANASNEHI SOCIAL WELFARE SOCIETY BVK PLAZA NEAR JMFC COURT COMPLEX, MAIN ROAD HANGAL-581104
2518 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
2519 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
2520 J AND K INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANISATION LIMITED DIC COMPLEX, EXHIBITION GROUND JAMMU
2521 J AND K YOUTH DEVELOPMENT FORUM BAKTOO COMPLEX BEEHAMA GANDERBAL
2522 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2523 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
2524 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2525 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2526 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
2527 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2528 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
2529 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
2530 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
2531 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
2532 JAN KALYAN SAMITI JAIN
2533 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
2534 JAN KALYAN SHIKSHA SAMITI A-1413/3
2535 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
2536 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
2537 JANKI DEVI EDUCATIONAL WELFARE SOCIETY 74/35, RAJPUR ROAD, OPP. HOTEL MADHUBAN DEHRAUN
2538 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
2539 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
2540 JANMAT VIKASH PRAGTI PATH SAMITI BEHIND OF SBI BANK A.B ROAD KOLARAS SHIVPURI MADHYA PRDESH
2541 JAN PRAGATI EDUCATION SOCIETY NEAR VIDHAN SABHA VILLAGE - TEKARI POST - MANDHAR
2542 JAN SAHARA SARAI VILL + PO- SARAI, PS - MANER, DIST - PATNA
2543 JAN SAHARA SARAI VILL + PO - SARAI,PS - MANER, DIST- PATNA
2544 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
2545 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
2546 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
2547 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
2548 JAN SEWA YUVA MANDAL BAJRANG NAGAR, WARD NO.15, NAGAR PANCHAYAT UTAI DIST-DURG (C.G.)
2549 JAN SEWA YUVA MANDAL VILLAGE AND POST - UTAI DIST-DURG CHHATTISGARH.
2550 JAN SEWA YUVA MANDAL BAJRANG NAGAR, WARD NO.15, NAGAR PANCHYAT UTAI.
2551 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2552 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
2553 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
2554 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2555 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
2556 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
2557 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM NORTH PARAVOOR ERNAKULAM DISTRICT
2558 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
2559 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
2560 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
2561 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
2562 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
2563 JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA - 441601 (MS)
2564 JANVIKAS FOUNDATION KMJ HOSPITAL ROAD SHASTRI WARD
2565 JAN VIKAS KRANTI VILLAGE-DEOGHAR, POST+ BLOCK-JAGDISPUR , DIT- BHOJPUR ( BIHAR)
2566 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
2567 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
2568 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
2569 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
2570 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
2571 JAYALAKSHME HEAVY DRIVING SCHOOL NO 26 INDRANAGAR, POLLACHIMAIN ROAD, MALUMICHAMPATTI COIMBATORE
2572 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
2573 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2574 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2575 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
2576 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
2577 JAYA SKILLS OPC PRIVATE LIMITED TULSI NAGAR COLONY,KHADI BHANDAR CHOWK
2578 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
2579 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
2580 JAY KAY WOMEN WELFARE SOCIETY NAI BASTI SATWARI, JAMMU CANTT
2581 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
2582 JAY RAJHARA BABA SHIKSHAN SAMITI DALLIRAJHARA SHOP NUMBER-39,BSP COMPLEX,DALLI RAJHARA IN FRONT OF JALA RAM MANDIR
2583 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
2584 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
2585 JB PLASTOCHEM PRIVATE LIMITED JAIN FOOD COMPOUND, GUT NO. 43/B/2, N. H. NO. 06, SAVKHEDA (BK.)
2586 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
2587 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2588 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2589 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2590 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU, KOZHIKODE.
2591 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE,JAMIATH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2592 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
2593 JEEVAK RASHTRIYA VIDHYAPEETH E - 13 SANTPURA BISHOKHAR ROAD BEHIND MODI PARK GOVINDPURI MODINAGAR - 201201 GHAZIABAD UTTAR PRADESH
2594 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
2595 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2596 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2597 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
2598 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
2599 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
2600 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
2601 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
2602 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
2603 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
2604 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
2605 JEEVANTI SEWA SAMITI 9, CIVIL LINES VIDISHA
2606 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
2607 JET KNITWEARS LTD 119/410-B-1, DARSHAN PURWA, KANPUR, UTTAR PRAESH -208012
2608 JET KNITWEARS LTD 119/410-B-1, DARSHAN PURWA, KANPUR, UTTAR PRAESH -208012
2609 JFJGF 9ODPJ
2610 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
2611 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
2612 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
2613 JIAGANJ EDUCATIONAL AND WELFARE SOCIETY TANTIPARA,GULZARBAGH P.O+P.S - JIAGANJ DIST - MURSHIDABAD 742123
2614 JINDAL INFRA SOLUTION LIMITED 214, AMBA TOWER DC CHOWK SEC-9 ROHINI
2615 JINDAL INFRA SOLUTIONS LIMITED 214,2ND FLOOR AMBA TOWER D.C. CHOWK SEC-9 ROHINI NEW DELHI
2616 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
2617 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
2618 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
2619 JIVAN JYOTI TRUST CION NAGAR NR MUKTIFOZ CHURCH, BEHRAMPURA, AHMEDABAD, GUJARAT
2620 JIVAN JYOTI TRUST CHRISTIAN COLONY BEHIND C.N.I. CHURCH BEHRAMPURA AHMEDABAD
2621 JIVAN JYOTI TRUST CION NAGAR NR MUKTIFOZ CHURCH, BEHRAMPURA, AHMEDABAD, GUJARAT
2622 JIVAN JYOTI TRUST CHRISTIAN COLONY BEHIND C.N.I. CHURCH, PANDIT NEHRU VIDYA VIHAR, BEHRAMPURA, AHMEDABAD GUJRAT
2623 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
2624 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
2625 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI
2626 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI BANDIPORA JAMMU AND KASHMIR
2627 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
2628 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
2629 J M J EDUCATION SOCIETY ACHARYA & BM REDDY COLLEGE OF PHARMACY, SOLDEVANHALLI, ACHIT NAGAR POST, BANGALORE
2630 J M J EDUCATION SOCIETY ACHARYA & BM REDDY COLLEGE OF PHARMACY, SOLDEVANAHALLI, ACHIT NAGAR POST, BANGALORE - 560107
2631 J M J EDUCATION SOCIETY ACHARYA & BM REDDY COLLEGE OF PHARMACY, SOLDEVANAHALLI, ACHIT NAGAR POST, BANGALORE
2632 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
2633 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
2634 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2635 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2636 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
2637 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
2638 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD.
2639 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2640 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2641 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2642 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2643 JOY HOTEL AND RESORTS PRIVATE LIMITED PLOT NO 33-34 INDUSTRIAL AREA PHASE 2 CHANDIGARH
2644 JOY HOTEL AND RESORTS PRIVATE LIMITED PLOT NO 33-34 INDUSTRIAL AREA,PHASE 2 ,CHANDIGARH
2645 J P FOUNDATION SANSTHA KASTURI DEVI COLLEGE PHAGI MODE CHAKSU JAIPUR
2646 J P FOUNDATION SANSTHA CHAMPESWAR COLONY CHAKSU, WARD NO. 19, CHAKSU, JAIPUR
2647 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
2648 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
2649 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
2650 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2651 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2652 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
2653 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
2654 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
2655 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
2656 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
2657 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
2658 JUPITER CRAFTS PLOT NO 55 – A, E.P.I.P., PHASE I, JHARMAJRI,BADDI,DISTT-SOLAN, HIMACHAL PRADESH
2659 JUPITER FOUNDATION 62/60, RANI ILLAM, POST OFFICE ROAD, TIRUPATHUR.
2660 JUPITER FOUNDATION NO.62/60, "RANI ILLAM", 2ND FLOOR, POST OFFICE ROAD, THIRUPATHUR.
2661 JYOTI CNC AUTOMATION LTD PLOT NO. G 506, LODHIKA GIDC, VILLAGE - METODA RAJKOT
2662 JYOTI CNC AUTOMATION LTD PLOT NO. G-506, LODHIKA GIDC, VILL. METODA, RAJKOT - 360021
2663 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
2664 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
2665 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
2666 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2667 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2668 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2669 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2670 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2671 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2672 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
2673 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
2674 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
2675 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING 3RD FLOOR, ZODIN SQUARE
2676 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
2677 KAILASH EDUCATIONAL TRUST VILL GANOH RAJPUTAN PO BANI TEH BARSAR DISTT HAMIRPUR HP
2678 KAILASH EDUCATIONAL TRUST VILL GANOH RAJPUTAN PO BANI TEH BARSAR DISTT HAMIRPUR HP
2679 KAILASH EDUCATIONAL TRUST VILL GANOH RAJPUTAN PO BANI TEH BARSAR
2680 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
2681 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
2682 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
2683 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2684 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2685 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2686 KAIZEN METAL FORMING PRIVATE LIMITED 132 SITE 5, KASNA INDUSTRIAL AREA, GREATER NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
2687 KAKUMANI EDUCATIONAL SOCIETY PARAMESWARA MANGALAM,PUTTUR,CHITTOOR(DIST), ANDHRA PRADESH
2688 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2689 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
2690 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2691 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
2692 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
2693 KALAM EDUCATIONAL AND CHARITABLE TRUST 344/13A VALLIMALAI X ROAD THARAPADAVEDU KATPADI
2694 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
2695 KALEKE LIVETECH SERVICES PRIVATE LIMITED SCO 5,6 FIRST FLOOR, LANDRA ROAD,SOHANA, SEC. 78,SAS NAGAR, MOHALI - 140308
2696 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
2697 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
2698 KALPATARU GRAMODYOG SAMITI JUNIOR HIG 9 KEHKASHA APT KOH-E-FIZA BHOPAL
2699 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
2700 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
2701 KALPTARU EDUCATION SOCIETY KANTI ENCLAVE SAMITI DREAM VALLEY COLLEGE , NEAR RAILWAY SPRING FACTORY NH-10 SITHOLI GWALIOR (M.P.)
2702 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
2703 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
2704 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
2705 KALVI INSTITUTE PRIVATE LIMITED NO.9-1-66, DOUBLE AGRAHARAM STREET, SHOLAVANDAN, MADURAI, TAMIL NADU - 625214
2706 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2707 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2708 KALYANI WELFARE SOCIETY WARD NO. 21, PANJABI GURUDWARA ROAD, GHARAULA MOHALLA, SHAHDOL
2709 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
2710 KALYANSUNDARAM WELFARE AND EDUCATIONAL TRUST G01, VASUDEO CITY,RAJENDRA PATH, BENI BABU KA BAGAICHA,NEAR ASHIYANA HYUNDAI SHOWROOM, PATNA BIHAR
2711 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
2712 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
2713 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
2714 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2715 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
2716 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2717 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
2718 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
2719 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
2720 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
2721 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
2722 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
2723 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED HOUSE NO-15,PLOT NO-1149,GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA
2724 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
2725 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
2726 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
2727 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
2728 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GHALIB GHS, PITAMPURA NEW DELHI
2729 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GROUND FLOOR GHALIB APARTMENT PITAMPURA NEW DELHI
2730 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2731 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2732 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2733 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
2734 KANCHAN INDIA LIMITED AN ISO 9001:2008, 14001:2004 CERTIFIED COMPANY) (SPINNING DIVISION) 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2735 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2736 KANCHAN INDIA LIMITED 5-O-5 RC VYAS COLONY BHILWARA
2737 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2738 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2739 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
2740 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
2741 KANHA BHARAT VIKASH EVAM JANKALYAN SAMITI HAVELI ROAD BEHIND SHAKTI CINEMA
2742 KANPUR SUBHASH SHIKSHA SAMITI 127/470, W-1, SAKET NAGAR, KANPUR
2743 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
2744 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
2745 KARCHER CLEANING SYSTEMS PRIVATE LIMITED D-120, SEC-63, NOIDA, GHAZIABAD, UTTAR PRADESH
2746 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
2747 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
2748 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
2749 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
2750 KARMYOGI EMPOWERMENT ORGANIZATION 45 NAHADEVAS NEAR OLD SWA
2751 KARMYOGI EMPOWERMENT ORGANIZATION 45 MAHADEVVAS NEAR OLD SWAMINARAYN TEMPLE RANIPGAM AHMEDABAD
2752 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
2753 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
2754 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2755 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2756 KARSHAK VIDYA PARISHAD G2, SBI COLONY, BAGH AMBERPET, HYDERABAD
2757 KARSHAK VIDYA PARISHAD G2, SBI COLONY, BAGH AMBERPET, HYDERABAD
2758 KARSHAK VIDYA PARISHAD G2, SBI COLONY, BAGH AMBERPET, HYDERABAD
2759 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
2760 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
2761 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
2762 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, 4TH CROSS STREET, RAGAVENDIRA CITY, VADALUR
2763 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, RAGAVENDIRA CITY VADALUR
2764 KARUNAI EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST NO.48, 1ST AVENUE, 4TH CROSS STREET RAGAVENDIRA CITY VADALUR KURINJIPADI TALYK
2765 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
2766 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
2767 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
2768 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
2769 KASHA GOUD EDUCATIONAL SOCIETY VINAYAKA NAGAR NIZAMABAD
2770 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
2771 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
2772 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
2773 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
2774 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
2775 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
2776 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
2777 KATYANI ENERGY SOLUTION PRIVATE LIMITED HEAD OFFICE: A-86, 3RD FLOOR, MCD NO. – 944, ARJUN NAGAR, KOTLA MUBARAKPUR, NEW DELHI
2778 KATYANI ENERGY SOLUTION PVT LTD WZ 490/A BRITANNIA CHOW SRI NAGAR NEW DELHI
2779 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2780 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HRAYANA, 122001
2781 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2782 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2783 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2784 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2785 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
2786 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
2787 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
2788 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
2789 KAUTALA VIVEKANANDA SOCIAL DEVELOPMENT SOCIETY VILL- KAUTALA, P.O- D/GANGADHAR PUR, P.S- DHOLA HAT
2790 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
2791 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
2792 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
2793 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
2794 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
2795 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
2796 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
2797 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
2798 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2799 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2800 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2801 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2802 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2803 KAYZEY SOCIETY MAWNGAP MAWSMAI
2804 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
2805 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
2806 KENDRIYA BHANDER B-1 SHYAMALI HOUSING ESTATE, SALT LAKE CITY, KOLKTA
2807 KERALA HOLY CROSS SISTERS SOCIETY HOLY CROSS INSTITUTE THRIKKAKARA P.O KOCHI, ERNAKULAM DISTRICT, KERALA
2808 KERALA INDUSTRIAL PROMOTION COUNCIL 20/460,1ST FLOOR,PALM PLAZA,KALMANDAPAM,PALAKKAD-678001
2809 KERALA INDUSTRIAL PROMOTION COUNCIL 20/460,1ST FLOOR,PALM PLAZA,KALMANDAPAM,PALAKKAD-678013
2810 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
2811 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
2812 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR,
2813 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR, P.S-PANCHLA, DIST-HOWRAH
2814 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR,
2815 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
2816 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
2817 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
2818 KGVK NEORI VIKAS RUKKA RANCHI
2819 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
2820 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
2821 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
2822 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP KIICT BUILDING NEAR REST HOUSE, INFRONT OF WRD OFFICE MAIN ROAD PAWANI BALODABAZAAR,RAIPUR-493338
2823 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP IICT BUILDING NEAR REST HOUSE INFRONT OF WRD OFFICE MAIN ROAD PAWANI BLOCK BILAIGARH DISTRICT BALODABAZAAR
2824 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP IICT BUILDING NEAR REST HOUSE INFRONT OF WRD OFFICE MAIN ROAD PAWANI BLOCK BILAIGARH DISTRICT BALODABAZAAR
2825 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
2826 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
2827 KHATRA TOWN EDUCATIONAL WELFARE SOCIETY DR. A.P.J ABDUL KALAM ROAD , PAPRA BRIDGE ( CANAL GATE) KHATRA , BANKURA
2828 KHATRA TOWN EDUCATIONAL WELFARE SOCIETY DR. A.P.J ABDUL KALAM ROAD , PAPRA BRIDGE ( CANAL GATE) KHATRA , BANKURA
2829 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
2830 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
2831 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
2832 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
2833 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2834 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2835 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
2836 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
2837 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2838 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2839 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
2840 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
2841 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
2842 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
2843 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
2844 KIRANMAYI SOCIO EDUCATIONAL SOCIETY 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA
2845 KIRANMAYI SOCIO EDUCATIONAL SOCIETY H. NO. 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA-520008, A.P.
2846 KIRANMAYI SOCIO EDUCATIONAL SOCIETY H. NO. 54-20/9-10A, SRINAGAR COLONY, VIJAYAWADA A.P.
2847 KIRAN PRAKASHAN PRIVATE LIMITED NAYA TOLA ,PATNA (BIHAR)
2848 KISANKARTS AGRO MANAGEMENT PRIVATE LIMITED DHALUABARI WEST POST GHUGHUMARI PANISHALA
2849 KISANKARTS AGRO MANAGEMENT PRIVATE LIMITED DHALUABARI WEST POST GHUGHUMARI PANISHALA
2850 KISANKARTS AGRO MANAGEMENT PRIVATE LIMITED VILLAGE DHALUABARI WEST POST GHUGHUMARI DISTRICT COOCHBEHAR WEST BENGAL 736170
2851 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
2852 KISAN SEWA SANSTHAN MAHESH BHAWAN, AWAS VIKAS COLONY, KATRA, BASTI U.P.-272001
2853 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
2854 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
2855 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
2856 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
2857 KITES SKILLS PRIVATE LIMITED 6-122/2, ABOVE LIC OFFICE, VISAKHA ROAD, PENDURTHI, VISAKHAPATNAM
2858 KITES SKILLS PRIVATE LIMITED 18-52, VELAMATHOTA, PENDURTHI, VISAKHAPATNAM, ANDHRA PRADESH
2859 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
2860 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
2861 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
2862 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
2863 K L FITNESS OPC PRIVATE LIMITED K L FITNESS OPC PRIVATE LIMITED III FLOOR, BUILDING NO. 1, BEDI GARDEN, JINDAL HOSPITAL ROAD, HISSAR - 125001, HARYANA, INDIA
2864 K L FITNESS OPC PRIVATE LIMITED K L FITNESS OPC PRIVATE LIMITED III FLOOR, BUILDING NO. 1, BEDI GARDEN, JINDAL HOSPITAL ROAD, HISSAR - 125001, HARYANA, INDIA
2865 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
2866 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
2867 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
2868 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
2869 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
2870 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2871 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2872 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
2873 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
2874 KOKAN BHUMI PRATISHTHAN 25 & 26, AJAY SHOPPING CENTRE, T H K MARG, MATUNGA ROAD (WEST), MUMBAI
2875 KOKAN BHUMI PRATISHTHAN 25 & 26, AJAY SHOPPING CENTRE, T H K MARG, MATUNGA ROAD (WEST), MUMBAI
2876 KOLKATA PRIYODORSHINI GHATAK PUKUR; BHANGURU BLOCK 1
2877 KOLKATA PRIYODORSHINI GHATAK PUKUR GOBINDAPUR BHANGAR BLOCK 1
2878 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
2879 KOLKATA VOCATIONAL ACADEMY PULIN AVENUE, P.O- RAJBARI, KOLKATA- 700081
2880 KOMAL CONSTRACTION COMPANY MAIN BAZAR ROAD, DANTA, TEHSIL DANTARAMGARH,DIST. SIKAR RAJSTHAN PIN 332701
2881 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
2882 KORAZON TECHNOLOGIES PRIVATE LIMITED KORAZON TECHNOLOGIES PVT. LTD. IMRAN COMPLEX 1ST FLOOR OPPOSITE WOODLAND RESTAURANT,ULUBARI ,G.S ROAD GWAHATI.
2883 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
2884 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
2885 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
2886 KRAFT OUTDOOR MEDIA PVT LTD ABHAY BHAWAN, 5TH FLOOR FRASER ROAD PATNA BIHAR 800001 INDIA
2887 K RAM FOUNDATION 118-C, POCKET-F, PHASE-2, MAYUR VIHAR, DELHI
2888 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
2889 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
2890 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2891 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2892 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
2893 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
2894 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
2895 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
2896 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
2897 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
2898 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
2899 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
2900 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
2901 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
2902 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
2903 KRITI EDIFY PRIVATE LIMITED NAYA TOLA, SARISTABAD, GARDANIBAGH, PATNA.
2904 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
2905 KRUSHI VIKAS PRATISTHAN KH 304, AT/POST BARADPAUNI,THADIPAUNI, TALUKA NARKHED, DISTRICT- NAGPUR, MAHARASHTRA
2906 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
2907 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
2908 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
2909 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
2910 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
2911 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
2912 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
2913 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
2914 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
2915 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
2916 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
2917 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28,JANAKPURI FLAT NO.2,OPPOSITE TO METRO PILLAR NO. 626, NEW DELHI
2918 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A1/28 JANAK PURI, MAIN NAJAFGARH ROAD, OPPOSITE METRO PILLAR NO. - 626, NEW DELHI - 110058
2919 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28 JANAKPURI, FLAT NO:2, MAIN NAJAFGARH ROAD, NEW DELHI - 110058
2920 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28 FLAT NO.2 JANAKPURI NEW DELHI
2921 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
2922 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
2923 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2924 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2925 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
2926 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
2927 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD, PARGANA DIST- SHIVPURI (MP)
2928 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD PARGANA
2929 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD ,PARGANA, DISTT SHIVPURI,
2930 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS POWAI
2931 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS IIT BOMBAY POWAI
2932 LAAN E GOVERNANCE AND EDUCATION PVT LTD 404, 6-3-667/4, SIRIMALLE TOWERS, JAFFAR ALI BAGH, SOMAJIGUDA, HYDERABAD
2933 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2934 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2935 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
2936 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
2937 LAKECITY PRIYADARSHNI SOCIAL WELFAR SOCIETY HAYAT HOSPITAL, LIYAQAT MARKET, NEW KABARKHANA ROAD, BHOPAL - MP
2938 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
2939 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
2940 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
2941 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
2942 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
2943 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
2944 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
2945 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
2946 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
2947 LAL BAHADUR SHIKSHA SAMITI KATKAR TEHSIL HINDAUN, DIST. KARAULI, RAJSTHAN PINCODE 322234
2948 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
2949 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
2950 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UTTAR PRADESH
2951 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UP, INDIA
2952 LAMIKA EDUCATIONAL AND CHARITABLE TRUST S.F.NO 806, AVINASHI ROAD, NEELAMBUR, COIMBATORE
2953 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE, 2ND FLOOR, KOLKATA
2954 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE, 2ND FLOOR, KOLKATA
2955 LAPISCO BROKING AND AGENCY PVT LTD 11, INDIA EXCHANGE PLACE 2ND FLOOR
2956 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
2957 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
2958 LATE APPASAHEB SHRAWAN CHINDHU WANI GRAMIN SEVABHAVI SANSTHA DHULE 14 AYODHYA NAGAR ,NEAR MANGALMURTI COLONY ,BEHAND SHREERAM MANDIR,WEST SIDE OF G.T.P STOP DEOPUR DHULE
2959 LATE LALA BARU MAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA
2960 LATE LALA BARUMAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING BAJRANG MARKET SIRSA CHANDIGARH ROAD UKLANA MANDI HISAR
2961 LATELALABARUMALGOYALSOCIALWELFAREEDUCATIONALSOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA-125113
2962 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2963 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2964 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
2965 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
2966 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
2967 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2968 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2969 LBS LNS HBJHCDJNSJBSBCANM
2970 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
2971 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
2972 LC EDUCATION SOCIETY 9-A, GALI NO.12, JAWAHAR NAGAR, HISAR
2973 LC EDUCATION SOCIETY 9-A, GALI NO 12, JAWAHAR NAGAR, HISAR - HARYANA
2974 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
2975 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
2976 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
2977 LEAF TRUST 385/15,JS PLAZA,SAB MAIN ROAD,ATHANI ,ANTHIYUR TALUKA
2978 LEAF TRUST 103A,KARUPPUSAMY KOVIL ST, NALLIGOUNDANPUDUR, KOOTHAMPOONDI POST, ANTHIYUR TALUKA,ERODE DT,TAMILNADU
2979 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
2980 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
2981 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
2982 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
2983 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
2984 LEED SOCIAL WELFARE SOCIETY E-40, MANIPURAM SOCIETY, BITTAN MARKET, BHOPAL.
2985 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
2986 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
2987 LEMON ELECTRONICS PRIVATE LIMITED M 79, GROUND FLOOR MALVIYA NAGAR NEW DELHI
2988 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYA NAGAR NEW DELHI
2989 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYA NAGAR NEW DELHI
2990 LEMON ELECTRONICS PRIVATE LIMITED M79 GROUND FLOOR MALVIYANAGAR NEW DELHI 110017
2991 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
2992 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
2993 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
2994 LIFE CIRCLE HEALTH SERVICES PRIVATE LIMITED T HUB, IIIT HYDERABAD CAMPUS, GACHIBOWLI
2995 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
2996 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
2997 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
2998 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
2999 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD.
3000 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
3001 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
3002 LIFE SKILL TRUST 362/1,ROAD STREET,IRUMBEDU,ARANI-TK, THIRUVANNAMALAI-DT
3003 LIFE SKILL TRUST NO.362/1, ROAD STREET,IRUMBEDU,ARANI-TK,THIRUVANNAMALAI-DT,
3004 LIFE SKILL TRUST NO.362/1, ROAD STREET, IRUMBEDU, ARANI-TK,THIRUVANNAMALAI-DT
3005 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
3006 LIGHTNING INDIA FOUNDATION FOR EXCELLENCE GIRDHARI NAGAR, JAROTHI ROAD NEAR BHARAT GAS GODOWN HAPUR UTTAR PRADESH
3007 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
3008 LIMPID SERVICES PRIVATE LIMITED ASHAJIPORA ANANTNAG
3009 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
3010 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
3011 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
3012 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
3013 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
3014 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
3015 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
3016 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
3017 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
3018 LIQUID HOLDINGS PRIVATE LIMITED 217,2ND FLOOR,ANTRIKSH BHAWAN,22 K.G MARG,NEW DELHI-110001
3019 LITCHITREE SKILLS AND SOLUTIONS PVT LTD MIG(S)-1,PRAGATI ENCLAVE,NEAR ST.XAVIAR HIGH SCHOOL,BHUBANESWAR
3020 LITERACY HOUSE ANDHRA MAHILA SABHA LITERACY HOUSE, DDMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
3021 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
3022 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
3023 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
3024 LOGISTICS SECTOR SKILL COUNCIL LOGISTICS SKILL COUNCIL IIT MADRAS RESEARCH PARK, UNIT–E, 10TH FLOOR KANAGAM ROAD, TARAMANI
3025 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
3026 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
3027 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA.
3028 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA
3029 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
3030 LOK SEVA KENDRA VILL - KARPI SHERPUR MAIN ROAD, ARWAL, BIHAR.
3031 LOK SEVA KENDRA VILL KARPI, SHERPUR ROAD,DIST.- ARWAL, BIHAR
3032 LOK SEVA KENDRA VILL - KARPI, KARPI SHERPUR MAIN ROAD, PO.- KARPI, DIST.- ARWAL, BIHAR
3033 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
3034 LORD BUDDHA EDUCATIONAL AND WELFARE TRUST A-18, KH.NO. 67/6, VEER SINGH COLONY, BUDH VIHAR, PHASE-2, DELHI.
3035 LORD BUDDHA EDUCATIONAL AND WELFARE TRUST FLAT NO.76, FIRST FLOOR, POCKET 9 NASIRPUR, SECTOR-1A DWARKA NEW DELHI-110077
3036 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO-7 NEAR PNB BANK ROADWAYS BUS STAN ROAD ROBERTSGANJ
3037 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS BUS STAND ROAD ROBERTSGANJ SONEBHADRA
3038 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO- 7 ARYA NAGAR ROBERTSGANJ SONEBHADRA
3039 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
3040 LORD KRISHNA EDUCATION SOCIETY HOUSE NO 313/16,MAHAVIR COLONY HISAR
3041 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
3042 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
3043 LORVEN MEDICARE PRIVATE LIMITED H.NO 16/11/D/22 NEAR STATE BANK OF INDIA MOOSARAMBAGH
3044 LOTUS EDUCATIONAL SOCIETY D-55 JYOTI MARG BAPU NAGAR, JAIPUR
3045 LOTUS EDUCATIONAL SOCIETY D-55,JYOTI MARG, BAPU NAGAR, JAIPUR
3046 LOTUS EDUCATIONAL SOCIETY D-55 JYOTI MARG, BAPU NAGAR, JAIPUR
3047 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
3048 LOVE AND CARE SOCIAL ORGANIZATION FOR DEVELOPMENT 3658, PALPAKURIA ROAD, KAZIPARA, BARASAT,24 PGS (N), KOLKATA -700125, (W.B), INDIA
3049 LOYAL ENVIRONMENTAL AWARENESS AND PROTECTION SOCIETY 115,116,PUDUCHERRY IT PARK, PEC CAMPUS,PILLAICHAVADY,ECR ROAD, PUDUCHERRY -605014
3050 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
3051 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
3052 LSSBM PADM DR V B KOLTE COLLEGE OF ENGINEERING MALKAPUR MUKTAI NAGAR ROAD, MALKAPUR
3053 LTA SCHOOL OF BEAUTY PVT LTD 101/102 PRARTHANA STAR, SAHARA ROAD, ABOVE S MART DEPARTMENTAL STORE, NEAR ANDHERI EAST STATION
3054 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
3055 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
3056 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
3057 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
3058 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
3059 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
3060 LUIT VALLEY ENGINEERING PRIVATE LIMITED H. NO. 51 & 52, M. E. ROAD, BYE LANE 01, PALTAN BAZAR, GUWAHATI 781008 ASSAM, INDIA
3061 LUTHFA FOUNDATION LUTHFAA POLYTECHNIC INSTITUTE, P.O: MOLANDIGHI, P.S: KANKSA, DURGAPUR, PASCHIM BURDWAN, WEST BENGAL
3062 LUTHFA FOUNDATION 48B, DR. SUNDARI MOHAN AVENUE, P.S- BENIAPUKUR, KOLKATA
3063 LUTHFA FOUNDATION 48B, DR. SUNDARI MOHAN AVENUE, P.S- BENIAPUKUR, KOLKATA
3064 LUTHFA FOUNDATION LUTHFAA POLYTECHNIC INSTITUTE, P.O: MOLANDIGHI, P.S: KANKSA, DURGAPUR-713212
3065 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN 164, BRAHMNAGAR COLONY LEHARGIRD SIPRI BAZAR JHANI U.P.
3066 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN MAHARANA PRATAP NAGAR GUMNAWARA PICHHOR ROAD JHANSI
3067 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
3068 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
3069 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
3070 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
3071 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
3072 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
3073 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
3074 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
3075 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
3076 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
3077 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
3078 MAA PARMBA BHAGAWATI DEVI SEWA SAMITI GRAM JAKHANIA POST JAKHANIA DISTRICT GHAZIPUR UP
3079 MAA PURNAGIRI JAN KALYAN SAMITI H.NO.-3 VANGOAN NITHOLI ROAD (NEAR OM SWEET BHANDHAR) ETAH U.P
3080 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
3081 MAA SARADA KRISHI VIGYAN MANDIR NAZARGANJ,NEAR-3 NO PUMP HOUSE PO-MIDNAPORE
3082 MAA SARADA KRISHI VIGYAN MANDIR MAA SARADA KRISHI VIGYAN MANDIR NAZARGANJ, NEAR 3 NO PUMP HOUSE
3083 MAA SARASVATI SHIKSHAN SANSTHAN NINDOLA KHEJROLI,TEH-CHOMU,DIST-JAIPUR RAJ
3084 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
3085 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
3086 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
3087 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
3088 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
3089 MAA SHAKTI SHIKSHAN AVAM KALYAN SAMITI PRABHAG KRAMANK 13 KRISHNA NAGAR WARDHA 442004
3090 MAA UMA ELECTRONIC TRAINING INSTITUTE HIG-102,PUSHPUM APPARTMENT, NEAR BHARAT TALKIES BHOPAL M.P.
3091 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
3092 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
3093 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
3094 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
3095 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
3096 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST CUDDALORE
3097 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST, CUDDALORE.
3098 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
3099 MADHYANCHAL UTKARSH BAHUUDDESHIYA VIKAS SAMITI COLLEGE STADIUM ROAD, NEAR CMIT COLLEGE, VIVEKANAND NAGAR, NORTH KARAUDIYA, SIDHI, MADHYA PRADESH
3100 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
3101 MAESTROS TECHNICAL SERVICES PRIVATE LIMITED STPI CAMPUS, GROUND FLOOR, OLD BUILDING ,PATLIPUTRA PATNA
3102 MAFOI EDUCATIONAL SERVICES PRIVATE LIMITED NO. 41, PLOT NO. 3726, Q BLOCK, 6TH AVENUE, ANNA NAGAR, CHENNAI, TAMIL NADU – 600 040
3103 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF EAST STREET, PUNE
3104 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF. EAST STREET, PUNE
3105 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
3106 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
3107 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
3108 MAGNUM SUPER DISTRIBUTORS INDIA PRIVATE LIMITED KALANIKETAN - I, VAISHALI NAGAR, KOTRA SULTANABAD, BHOPAL
3109 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
3110 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
3111 MAHAKALI TRUST EEE
3112 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
3113 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
3114 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
3115 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
3116 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
3117 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
3118 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP BEHLOT BYPASS ROAD INFRONT OF DEHAT THANA GANJ BASODA VIDISHA
3119 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
3120 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
3121 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH VILL POST PARSADA TEH JAIJAIPUR DIST JANJGIR CHAMPA CHHATTISGARH
3122 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH HNO-27,WARD NO 02,AWASPARA VILL-POST PARSADA,TEH-JAIJAIPUR,DIST-JANJGIR CHAMPA CHHATTISGARH
3123 MAHANADI AASTHA WELFARE FOUNDATION CHHATTISGARH HNO 27 WARD NO 02 AWASPARA VILL POST PARSADA TEH JAIJAIPUR DIST JANJGIR CHAMPA
3124 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
3125 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
3126 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
3127 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY GHAZIABAD, U.P.
3128 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
3129 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
3130 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
3131 MAHARASHATRA INDUSTRIAL TRAINING CENTER KOLHAPUR PATIL COMPELX 3RD FOOR, NEAR BHAGYAREKHA TOKIES ICHALKARNJI TAL- HATKANGALE DIST KOLHAPUR
3132 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
3133 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
3134 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
3135 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
3136 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
3137 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
3138 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
3139 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
3140 MAHARASHTRA VYAVSAY PRASHIKSHAN MANDAL 740,'E' WARD, SHAHUPURI 3RD LANE KOLHAPUR 416001
3141 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
3142 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
3143 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
3144 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
3145 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
3146 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
3147 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA NIVAS,SANATHANAM WARD,ALAPPUZHA.
3148 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA ITI BUILDINGS,SANATHANAM WARD,WEST OF YMCA,KERALA,ALAPPUZHA.
3149 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
3150 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
3151 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
3152 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
3153 MAHAVIR SHIKSHA SAMITI 29 WAZIR CHAND COLONY KARNAL 132001 HARYANA
3154 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, N.H. – 58, DELHI HARIDWAR BYPASS ROAD
3155 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, NH-58, DELHI HARIDWAR BYPASS ROAD, MEERUT
3156 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, NH-58, DELHI HARIDWAR , BYPASS ROAD, MEERUT.
3157 MAHAYANA THERAVADA VAJRAYANA BUDDHIST RELIGIOUS AND CHARITABLE TRUST SUBHARTIPURAM, N.H. – 58, DELHI HARIDWAR BYPASS ROAD, MEERUT.
3158 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
3159 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
3160 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
3161 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
3162 MAHENDRANATH EDUCATIONAL AND SOCIAL WELFARE ASSOCIATION VILL+PO-PRATAPDIGHI, PS-PATASHPUR, DIST-PURBA MEDINIPUR
3163 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
3164 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
3165 MAHESHWARI MINING PRIVATE LIMITED SHILPANGAN, BLOCK LB, PLOT 1, SECTOR-III, MODULE 1, 4TH FLOOR, CF BUILDING, SALT LAKE KOLKATA
3166 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
3167 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
3168 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
3169 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
3170 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
3171 MAHILA JAN SWASTHYA SHISHU KALYAN KENDRA KAILASH NAGAR, WARD 11, HOUSE OF RAJ NARAYAN SINGH, CHAS, BOKARO
3172 MAHILA MANDAL BARMER AGOR NEAR POWER HOUSE ROAD, INDRA COLONY, BARMER (RAJ)
3173 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR NEAR POWER HOUSE ROAD INDRA COLONY
3174 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR, NEAR NEW POWER HOUSE INDRA COLONY
3175 MAHILA MANDAL BARMER AGOR MAIN CC ROAD, NEAR SAINIK VISHRAM GRAH, INDIRA COLONY, BARMER
3176 MAHILA MANDAL BARMER AGOR MAIN CC ROAD, NEAR SAINIK VISHRAM GRAH, INDIRA COLONY, BARMER
3177 MAHILA MANDAL BARMER AGOR MAIN CC ROAD,NEAR SAINIK VISHRAM GRAH INDIRA COLONY,BARMER
3178 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR, NEAR POWER HOSUE ROAD INDRA COLONY BARMER
3179 MAHILA MANDAL BARMER AGOR MAIN CC ROAD, NEAR SAINIK VISHRAM GRAH, INDIRA COLONY
3180 MAHILA MANDAL BARMER AGOR MAIN CC ROAD, NEAR SAINIK VISHRAM GRAH, INDIRA COLONY, BARMER
3181 MAHILA UTTHAN SANSTHAN AHMAD NAGAR NEAR CHANDNA DISTT. BARABANKI
3182 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
3183 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
3184 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
3185 MAHIMA FIBRES PVT LTD 406, CORPORATE HOUSE, 4TH FLOOR 169 R.N.T. MARG INDORE MP
3186 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
3187 MAHISHADAL RAJ COLLEGE NAAC ACCREDITED GRADE A COLLEGE MAHISHADAL RAJ COLLEGE, POST OFFICE: MAHISHADAL, DISTRICT: PURBAMEDINIPUR, PIN: 721628, WEST BENGAL.
3188 MAHNAR FAL SABZI SAHYOG SAMITI LTD MAHNAR, PO+PS- MAHNAR
3189 MAHNAR FAL SDABZI MAHNAR MAHNAR VAISHALI
3190 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
3191 MAHOBIA COMPUTER INSTITUTE SOCIETY GYAN TARANG PARISAR, BALOD ROAD, HALDI, RAJNANDGAON, C.G.
3192 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
3193 MAITREYEE SHIKSHAN SANSTHAN VPO-RAYAN BADI,TEH-RIYAN BADI, DIST-NAGAUR RAJASTHAN
3194 MAITRI MAHILA BAHUUDDESHIYA SANSTHA 41, MADHAV NAGAR, WAGHAPUR ROAD, YAVATMAL
3195 MAITRI MAHILA BAHUUDDESHIYA SANSTHA 41, MADHAV NAGAR, WAGHAPUR ROAD, YAVATMAL
3196 MALABAR AGGREGATES PRIVATE LIMITED MALABAR AGGREGATES PRIVATE LIMITED, OZHKUR, KONDOTTY, MALAPPURAM DT., KERALA.
3197 MALABAR EDUCATIONAL SOCIETY OPP.GRIFI SUPER MARKET EDODI VATAKARA
3198 MALABAR EDUCATIONAL SOCIETY MALABAR EDUCATIONAL SOCIETY OPP.GRIFI SUPER MARKET EDODI VATAKARA KOZHIKODE KERALA 673101
3199 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
3200 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
3201 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
3202 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
3203 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
3204 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
3205 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
3206 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
3207 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
3208 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
3209 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
3210 MAMTA PARADISE PRIVATE LIMITED BHAGWATI NAGAR NIWARU ROAD JHOTWARA JAIPUR
3211 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
3212 MANAH GRAMIN EVAM SAMAJ SEVA SAMITI NEAR JANPAD PANCHYAT BORODIPA PUSSORE
3213 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
3214 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
3215 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
3216 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
3217 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
3218 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
3219 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
3220 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
3221 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
3222 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
3223 MANAV MITRA HOUSE NO-287,SAMTA COLONY RAIPUR C.G.
3224 MANAV MITRA HOUSE NO-287 SAMTA COLONY RAIPUR C.G.
3225 MANAV MITRA HOUSE NO-287 SAMTA COLONY RAIPUR C.G.
3226 MANAV RACHNA EDUCATION SOCIETY VIDYA VIHAR NH.30 VILLAGE BHELWADHI NAYA RAIPUR (C.G.)
3227 MANAV RACHNA EDUCATION SOCIETY VIDYA VIHAR NH.30 VILL. BHELWADIH NAYA RAIPUR(C.G)
3228 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
3229 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
3230 MANAV SEVASHARAMBR VILL-KAPIYA NIZAMAT POST-MAHARAJGUNJ DIST- SIWAN
3231 MANAV SEVASHRAM VILL-KAPIYA NIJAMAT POST-MAHARAJ GUNJ DIST-SIWAN
3232 MANAV SEVASHRAM VILLAGE - KAPIYA NIJAMAT, P.O. - MAHARAJGAN, DISTRICT - SIWAN
3233 MANAV VIKAS SEWA SANGH 1 SUDAMA PARK GAS RAHAT WORKSHED GOVIND GARDEN BHOPAL
3234 MANBHAWAN KALYAN SAMITI B-2/144, ASHIYANA PHASE-II, KANTH ROAD, MORADABAD
3235 MANBHAWAN KALYAN SAMITI B-2/144, ASHIYANA PHASE-II, KANTH ROAD MORADABAD
3236 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
3237 MANGAL JAN KALYAN SAMITI AGRASEN WARD NO.-8 PO-LORMI DISTT-MUNGELI MO.-9893452562
3238 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
3239 MANI ADRS
3240 MANI KASHYAP ADRS XYZ
3241 MANI KASHYAP ADDRESS LINE 1
3242 MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, UDAYAVANI ROAD, MANIPAL
3243 MANIPAL MEDIA NETWORK LIMITED MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, TILE FACTORY ROAD, UDAYAVANI ROAD, MANIPAL
3244 MAN MANAGEMENT SERVICES PERVITED LIMITED MAN MANAGEMENT SERVICES PVT. LTD.,PLOT NO-4,SECTOR NO.6,SANPADA, NAVI MUMBAI,MAHARASHTRA.
3245 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
3246 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
3247 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
3248 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
3249 MANNAT ADD LINE 2
3250 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V - EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
3251 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V-EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
3252 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
3253 MANSOORI ACADEMY MOHAMMADI SARAY NEAR HAJI JI KI DARGAH, AMROHA-244221 DIST- AMROHA U.P.
3254 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
3255 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
3256 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
3257 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
3258 MANUH GLOBAL TECHNOLOGIES PRIVATE LIMITED 49-28-13 MADHURANAGAR VISAKHAPATNAM
3259 MANUMATA BAHUUDDESHIYA SANSTHA JALGAON 10, SAMARTH COLONY, ABOVE UNION BANK ATM, MJ COLLEGE ROAD, JALGAON DIST. JALGAON - 425001
3260 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
3261 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
3262 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
3263 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
3264 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
3265 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
3266 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
3267 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
3268 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
3269 MARG DARSHAN MANAV SEWA SANSTHAN TEACHER COLONY SALEMPUR DEORIA
3270 MARG DARSHAN MANAV SEWA SANSTHAN WARD NO 7 SUGAHI TEACHER COLONY SALEMPUR
3271 MARIAN COLLEGE KUTTIKKANAM AUTONOMOUS PRINCIPAL MARIAN COLLEGE KUTTIKKANAM (AUTONOMOUS) KUTTIKKANAM (PO) PEERMADE IDUKKI (DIST) KERALA STATE
3272 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
3273 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
3274 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
3275 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
3276 MARUDHAR EDUCATION SOCIETY MARUDHAR CAMPUS, NH-11, JAIPUR ROAD, RAISAR, BIKANER
3277 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
3278 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
3279 MARUTHI EDUCATIONAL SOCIETY # 84/132-B,SHAREEN NAGAR,B CAMP (POST),KURNOOL (D.T)
3280 MARUTI SUZUKI INDIA LIMITED MARUTI SUZUKI TRAINING ACDEMY, MARUTI SUZUKI INDIA LIMITED,PALAM GURGAON ROAD, GURGAON
3281 MA SARBAMANGALA SOCIETY FOR CULTURAL AND EDUCATION PANAGARH,P.O-PANAGARH BAZAR,DIST:-PASCHIM BARDHAMAN
3282 MA SARBAMANGALA SOCIETY FOR CULTURAL AND EDUCATION PANAGARH, P.O- PANAGARH BAZAR,DIST:- BURDWAN, PIN-713148 ,
3283 MAS CALLNET INDIA PRIVATE LIMITED A-94/10 SECTOR-58 NOIDA
3284 MASK MAGIC REGD OFFICE H.NO. F-1/172 SUNDARNAGARI, NANDNAGARI DELHI N.E 110093 ADMIN OFFICE. H.NO. D-27 SHASTRINAGAR GHAZIABAD 201002 UP
3285 MAS SHIKSHAN PRASHIKSHAN SEWA SANSTHAN PLOT NO 15,16,17 MINI INDUSTRIAL ESTATE TENDUAI KALAN AMBEDKAR NAGAR
3286 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
3287 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
3288 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
3289 MASTERMIND INSTITUTE OF EDUCATION PRIVATE LIMITED NATIONAL HIGHWAY NEAR POLICE STATION BIJBEHARA
3290 MASTER MINDS SOLUTIONS 2ND FLOOR, 17-1-383/95, VIJAYANAGAR COLONY ,HYDRABAD(SOUTH)
3291 MASTER MINDS SOLUTIONS 2ND FLOOR, 17-1-383/95, VIJAYANAGAR COLONY, HYDRABAD (SOUTH)
3292 MASTER MINDS SOLUTIONS P.NO:14,GANDI REDDY COLONY,BADANGPET,RANGAREDDY-500058
3293 MASTERPRO INSTITUTE OF TECHNOLOGY MASTERPRO BUILDING NOWGAM BYPASS SRINAGAR
3294 MASTERPRO INSTITUTE OF TECHNOLOGY MASTERPRO BUILDING, NOWGAM BYPASS SRINAGAR
3295 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
3296 MATA KITAB KAUR MEMORIAL WELFARE SOCIETY OPPOSITE ITI,SURATGHAR ROAD, HANUMANGHAR JN. RAJSTHAN
3297 MATHA EDUCATIONAL SOCIETY MATHA EDUCATIONAL SOCIETY #12-21-13/1, BESIDE FIRE STATION NEAR GOKAVARAM BUS STAND, ARYAPURAM RAJAHMUNDRY
3298 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
3299 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
3300 MATHAN KANCHANA CHARITABLE TRUST NO 151, POTHIKULAM VILLAGE,KADALADI TALUK,RAMANATHAPURAM DISTRICT.
3301 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITI SUNHERA ROAD SABALGARH MORENA M.P.
3302 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITTI 224,NIMBAJI KI KHO NEAR MATA MANDIR JIWAJI GNJ LASHKAR GWALIOR
3303 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KLAYAN SAMITI 224,NIMBAJI KI KHO LASHKAR GWALIOR
3304 MATOSHRI PRATISHTHAN NANDED MATOSHRI PRATISHTHAN GROUP OF INSTITUTIONS, JIJAU NAGAR, OFF LATUR NANDED HIGHWAY, KHUPSARWADI, POST VISHNUPURI, NANDED- 431606 (MS).
3305 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
3306 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
3307 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
3308 MATREYA EDUCATIONAL TRUST SURYA PATH,CHANDMARI ROAD,KANKARBAGH,PATNA
3309 MATREYA EDUCATIONAL TRUST SURYA PATH,CHANDMARI ROAD,KANKARBAGH,PATNA
3310 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
3311 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVANI NAGAR PAITHAN TQ. PAITHAN DIST.AURANGBAD
3312 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVNI NAGAR PAITHAN TQ.PAITHAN DIST.AURANGABAD
3313 MAULANA HUSSAIN AHMAD MADANI CHERITABLE TRUST SECRETARY,MAULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST,QUASIMPURA ROAD, DEOBAND, SAHARANPUR DIST.
3314 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
3315 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
3316 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
3317 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
3318 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
3319 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
3320 MAYATECH SOLUTIONS PRIVATE LIMITED A-1/8, SUMIT COMPLEX, VIBHUTI KHAND, GOMTINAGAR, LUCKNOW, UTTAR PRADESH
3321 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
3322 MAYOCARE HEALTH PRIVATE LIMITED 538, IST FLOOR, TRANSPORT NAGAR, NEAR DHARMVEER MURTI,IN FRONT OF MUNDERA MANDI, ALLAHABAD
3323 MAYURAKSHI JANAKALYAN SOCIETY PO-ABADANGA, PS-LABPUR,DIST-BIRBHUM,PIN-731303
3324 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
3325 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
3326 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
3327 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
3328 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
3329 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
3330 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
3331 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
3332 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
3333 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
3334 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET
3335 MEDIWORLD EDUCATIONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEW DELHI
3336 MEDIWORLD EDUCATIOONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEAR FATHER AGNEL SCHOOL
3337 MEDLIFE FOUNDATION BAHAL MEDLIFE HOUSE. NO.968, A/P: BAHAL, TAL: CHALISGAON, DIST: JALGAON - 424101
3338 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
3339 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
3340 MEERA INSTITUTE OF TECHNOLOGY AND MANAGEMENT PRIVATE LIMITED 538/5-C, BANKERS COLONY JHANSI
3341 MEERA PROFESSIONAL EDUCATIONAL AND WELFARE SOCIETY FAZILKA ROAD, ABOHAR
3342 MEERA PROFESSIONAL EDUCATIONAL AND WELFARE SOCIETY FAZILKA ROAD, ABOHAR (PB.)
3343 MEERA PROFESSIONAL EDUCATIONAL AND WELFARE SOCIETY FAZILKA ROAD, ABOHAR(PB)
3344 MEERA SAHIB EDUCATIONAL WELFARE SOCIETY 64/19, VEER NAGAR, MANSA
3345 MEERA SAHIB EDUCATIONAL WELFARE SOCIETY MEERA SAHIB EDUCATIONAL WELFARE SOCIETY, ELECTRA INSTITUTE, VEER NAGAR, MANSA
3346 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
3347 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
3348 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
3349 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
3350 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
3351 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
3352 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
3353 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
3354 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
3355 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
3356 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
3357 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
3358 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
3359 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
3360 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
3361 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
3362 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
3363 MELGHAT DIGITAL SEVA LLP HNO 71 TINGRYA ROAD DHARNI
3364 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159 5TH. FLOOR INDUSTRY HOUSE H.T. PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
3365 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159, 5TH. FLOOR INDUSTRY HOUSE H.T.PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
3366 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
3367 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
3368 MER PEDAGOGY PVT LTD NO 289, TTK ROAD, MANICKAM AVENUE, ALWARPET, CHENNAI
3369 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
3370 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
3371 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
3372 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
3373 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
3374 METORES ISPAT PRIVATE LIMITED METORES ISPAT PRIVATE LIMITED, O-12, CIVIL TOWNSHIP, ROURKELA ORISSIA
3375 METROBIT NETWORKS PRIVATE LIMITED #6 - 8, GOKUL COMPLEX, NEAR SANKALP RESTURANT, GURUKUL, DRIVE IN ROAD, AHMEDABAD
3376 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
3377 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI,BEHIND HOTEL MAAN,GULAB BAGH ROAD, UDAIPUR
3378 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI BEHIND HOTEL MAAN , GULAB BAGH ROAD, UDAIPUR
3379 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
3380 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
3381 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
3382 M G CHARITABLE TRUST EAST POINT CAMPUS JNANA PRABHA VIRGO NAGAR POST BANGALORE
3383 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
3384 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
3385 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
3386 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA
3387 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA 560004 IN
3388 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
3389 MIDNAPUR UNIQUE EDUCARE EDUCATIION WELFARE SOCIETY VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
3390 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
3391 MIGS EDUCTECH PRIVATE LIMITED A-86, DDA SHED, OKHLA INDUSTRIAL AREA, PHASE-2, NEW DELHI
3392 MILAT FOUNDATION BEEHAMA GANDERBAL
3393 MILE MULTIMURPOSE FOUNDATION WARDHA
3394 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
3395 MILKY FASHION CLOTHES PRIVATE LIMITED B-68, CHANAKYA PLACE, JANAKPURI, DELHI
3396 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
3397 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
3398 M INDIA VIKASH SAMITI PLOT NO–C\11, CENTRE MARKET, SECTOR-12A, BOKARO STEEL CITY, JHARKHAND
3399 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
3400 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
3401 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
3402 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
3403 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
3404 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
3405 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
3406 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
3407 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
3408 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
3409 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
3410 MISAWITE TECHNOLOGIES PRIVATE LIMITED I-701, I BLOCK GOVINDPURAM
3411 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
3412 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
3413 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
3414 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
3415 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
3416 MITRA HOLISTIC HELTH SOCIETY #39/601-2,PATEL ROAD,ARAVIND NAGAR,KADAPA-516001
3417 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
3418 MITR PROMOTERS PRIVATE LIMITED 139,NOBEL ENCLAVE,SECTOR-22,BEHIND ROTARY PUBLIC SCHOOL,GURGAON,HARYANA-122001.
3419 MITTAL WELFARE SOCIETY CHATTISGARH 2ND FLOOR OF UNION BANK GOURI SHANKAR MANDIR(GSM) ROAD,SUNDAY MARKET RAIGARH
3420 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
3421 MMCC SKILL FOUNDAION S.C.O-192,195 SECTOR-16
3422 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
3423 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
3424 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
3425 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
3426 M M SHAWL ENGIREES AND CONTRACTORS PRIVATE LIMITED CHINAR COMMERCIAL COMPLEX THE BUND RESIDENCY SRINAGAR J & K
3427 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
3428 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
3429 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
3430 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
3431 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
3432 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
3433 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
3434 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
3435 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
3436 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
3437 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
3438 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
3439 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
3440 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
3441 MOHAMMADIA EDUCATIONAL AND WELFARE SOCIETY CHAND COLONY, POST PHULWARI SHARIF, DIST PATNA BIHAR 801505
3442 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
3443 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
3444 MONDAL CONSTRUCTION COMPANY LIMITED UTTARAYAN STATION ROAD CHINSURAH R.S. HOOGHLY, WEST BENGAL
3445 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
3446 MONIKA REAL BUILDCON PRIVATE LIMITED 81,JAIRAM COMPLEX, SHARDA CHOWK, RAIPUR
3447 MOODLAKATTE NAGARATHANA BHUJANGA SHETTY TRUST NO.158/D,3RD BLOCK,3RD STAGE, BASAVAESHWAR NAGAR, BANGALORE.
3448 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
3449 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
3450 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
3451 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D,3RD BLCOK,3RD STAGE, BASAVESHWAR NAGAR, BANGALORE
3452 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
3453 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D, 3RD BLOCK, 3RD STAGE, BASAVESHWARA NAGAR, BANGALORE.
3454 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST NO.158/D, 3RD BLOCK, 3RD STAGE, BASAVESHWARA NAGAR,BANGALORE
3455 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST REGD P O MOODLAKATTE KUNDAPURA TALUK UDUPI DISTRICT KARNATAKA
3456 MORD TEST ND
3457 MORD TEST1 SBJFLJ
3458 MORD TEST2 ADVCDS
3459 MORD TEST NEW DELHI ND
3460 MOREPEN LABORATRIES LIMITED 4TH FLOOR ANTRIKSH BHAWAN,22 K.G. MARG BARAKHAMBA ROAD NEW DELHI
3461 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
3462 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
3463 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
3464 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
3465 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
3466 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
3467 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
3468 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
3469 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
3470 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
3471 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
3472 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
3473 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
3474 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
3475 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST SECRETARY, MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST,QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3476 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST SECRETARY, MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD DEOBAND, SAHARANPUR DIST UP
3477 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3478 MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST MOULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST, QUASIMPURA ROAD, MADANI MANZIL, DEOBAND, SAHARANPUR, UTTAR PRADESH
3479 MOULI FITNESS GYM PRIVATE LIMITED BLOCK NO- 7, PLOT NO- 7, NEHRU NAGAR EAST, BHILAI- 490020, CHHATTISGARH, INDIA
3480 MOUNT EVEREST BREWERIES LIMITED 106A SHYAM BAZAR STREET 1ST FLOOR KOLKATA WEST BENGAL 700005
3481 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
3482 MOURYADASS COMMOSALES PRIVATE LIMITED KANCHAL VIMAL, 166 SHIVAJI NAGAR, NAGPUR, MAHARASHTRA
3483 MOURYADASS COMMOSALES PRIVATE LIMITED AVISH EDUCOM, OM PARISAR, ARYA NAGAR, DURG
3484 MOZAVI TECHNOLOGIES PVT LTD 26-27, MADHAVHILL NEAR TAKHTESHWAR TEMPLE,BHAVNAGAR-364001
3485 MOZAVI TECHNOLOGIES PVT LTD MOZAVI TECHNOLOGIES PVT LTD 26-27 MADHAVHILL NEAR TAKHTESHWAR TEMPLE WAGHAVADI ROAD BHAVNAGAR
3486 MPB CONSTRUCTION PRIVATE LIMITED KAMLA BHAWAN, 138 ADARSH VIHAR, JOOHAMAL SCHOOL ROAD, SAINIK COLONY, BYE PASS, JAMMU (J&K)
3487 MPB CONSTRUCTION PRIVATE LIMITED KAMLA BHAWAN, 138 ADARSH VIHAR, JODHAMAL SCHOOL ROAD, SAINIK COLONY, BYPASS, JAMMU (J&K)
3488 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING CENTER NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR KULALI ROAD MUDHOL
3489 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING INSTITUTE NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR KULALI ROAD MUDHOL
3490 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING INSTITUTE NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR KULALI ROAD MUDHOL
3491 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING INSTITUTE NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR KULALI ROAD MUDHOL
3492 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING INSTITUTE NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR KULALI ROAD MUDHOL
3493 MRN NIRANI FOUNDATION RURAL DEVELOPMENT AND SELF EMPLOYMENT TRAINING INSTITUTE NEAR VIJAY INTERNATIONAL SCHOOL VIJAY NAGAR MUDHOL
3494 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
3495 MS IMAGINE INSTITUTE OF FELLOWSHIP AND LEARNING IIFL 57 AADARSH COLONY NEAR MAAN PETROL PUMP MUZAFFAR NAGAR
3496 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3497 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3498 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
3499 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
3500 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
3501 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
3502 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
3503 MS POPULAR AGENCIES 60 B/69B, HEWETT ROAD, ALLAHABAD
3504 MS RAJ ASSOCIATES B1/181, VINEET KHAND, GOMTINAGAR, LUCKNOW (U.P.)
3505 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
3506 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R K COMPLEX , OPP ARRS SLIKS , HOSUR KRISHNAGIRI , TAMIL NADU 635109. CELL : 9442372741.
3507 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
3508 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
3509 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
3510 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
3511 MUKTAI SHIKSHAN PRASARAK MANDAL PULUJWADI TAL-PANDHARPUR DIST-SOLAPUR
3512 MUKTI INDIA FOUNDATION A-105,FIRST FLOOR, ABOVE BANK OF INDIA , OPP. PILLOR NO 749, UTTAM NAGAR
3513 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
3514 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
3515 MUSKAN D-6/54, THIRD FLOOR, SECTOR-6 ROHINI, DELHI-110085
3516 MUSKAN D-6/54, THIRD FLOOR, SECTOR-6 ROHINI, DELHI
3517 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
3518 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
3519 MVIGYAN CONSULTING PRIVATE LIMITED 137-E,PKT,KONDLI,GHAROLI,MAYUR VIHAR, PHASE-III, DELHI
3520 MVIGYAN CONSULTING PRIVATE LIMITED NO-137-E, PKT-A2, KONDLI, GHAROLI MAYUR VIHAR PH-III DELHI DL 110096
3521 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
3522 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
3523 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
3524 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
3525 NABA PRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIKHAR CHANDI TEMPLE AND INFOCITY) PATHARGADIA, PO - KIIT, BHUBANESWAR, DIST -KHORDHA, ODISHA
3526 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
3527 NABAPRAVAT TRUST PLOT NO-540/1780, NILACHAL NAGAR (NEAR SIKHARCHANDI TEMPLE & INFOCITY), PATHARGADIA, PO-KIIT, BHUBANESWAR, ODISHA,
3528 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
3529 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
3530 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
3531 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
3532 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
3533 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
3534 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
3535 NALANDA BAHU UDDESHIYA SHIKSHAN SANSTHA GEWARDHA AT POST GEWARDHA TAH KURKHEDA DISTRICT GADCHIROLI
3536 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
3537 NALANDA EDUCATION AND RESEARCH CHARITABLE TRUST VILLAGE + P.O. - PARWALPUR, DIST. - NALANDA, MAHADEV STHAN KE SAMNE
3538 NALANDA EDUCATION AND RESEARCH CHARITABLE TRUST C/O - SG INSTITUTE OF SYSTEMATIC EDUCATION VILLAGE + P.O. - MURGAWAN,
3539 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
3540 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
3541 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
3542 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
3543 NANAK SINGH RAWAT SHIKSHA SAMITI C-232, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
3544 NANAK SINGH RAWAT SHIKSHA SAMITI C-2252, JAWAHAR NAGAR MHOW, TEHSIL MHOW DISTT. INDURE (M.P.)
3545 NANAK SINGH RAWAT SHIKSHA SAMITI C-252,JAWAHAR NAGAR,MHOW,TEHSIL-MHOW,DISTT. INDORE
3546 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR. MHOW, TEHSIL MHOW DISTT. - INDORE
3547 NANDAN DENIM LIMITED SURVEY NO 198/1 203/2 SAIJPUR GOPALPUR,PIRANA ROAD,PIPLAJ,AHMEDABAD
3548 NANDAN DENIM LIMITED SURVEY NO.198/1 & 203/2,SAIJPUR,GOPALPUR PIRANA ROAD,PIPLAJ,AHMEDABAD,GUJARAT
3549 NANDI SHIKSHA AWAM SAMAJIK SANSTHAN BRAHMPURI COLONY,DEOBAND SAHARANPUR
3550 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
3551 NARASHINGAPUR NIBEDITA EDUCATIONAL SOCIETY AND SOCIAL WELFARE NARASHINGAPUR, SAGARPARA, JALANGI, MURSHIDABAD, 742306
3552 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
3553 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
3554 NARAYAN EDUCATIONAL SOCEITY FIRST FLOOR DESIGN COMPLEX, IN FRONT OF BDA COMPLEX,PILIBHIT ROAD BAREILLY, UP INDIA-243001
3555 NARAYAN INSTITUTE OF COMPUTER SCIENCE 885, VINOD NAGAR, COURT ROAD, NEAR BANK OF INDIA, ETAWAH, UTTAR PRADESH
3556 NARAYAN INSTITUTE OF COMPUTER SCIENCE 885, VINOD NAGAR, COURT ROAD, NEAR BANK OF INDIA
3557 NARAYAN INSTITUTE OF COMPUTER SCIENCE 885, VINOD NAGAR, COURT ROAD, NEAR BANK OF INDIA, ETAWAH
3558 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
3559 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
3560 NARAYAN TRAINING SERVICES NO 546,OPP RUCHI GARDENS, BH ROAD , PRASHANTHNAGAR, NAGAPPA BLOCK , GOWRIBIDANUR , CHIKKABALLAPUR DISTRICT ,KARNATAKA - 561208
3561 NARAYAN TRAINING SERVICES NO 546 OPP RUCHI GARDENS ,B H ROAD PRASHANTHNAGAR,NAGAPPA BLOCK , GOWRIBIDANUR,CHIKKABALAPUR DISTRICT , KARNATAKA
3562 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
3563 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
3564 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
3565 NARPAVAI EDUCATIONAL AND CHARITABLE TRUST NO 1-75, CHEKKADI STREET, KEELA KADAYAM, KADAYAM- 627415. TIRUNELVELI - TAMILNADU
3566 NARPAVAI EDUCATIONAL AND CHARITABLE TRUST NO 1/75, CHEKKADI STREET, KEELA KADAYAM, KADAYAM. TIRUNELVELI DIST
3567 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
3568 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
3569 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
3570 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION D.L.ROY ROAD, BOWBAZAR, PO-KRISHNAGAR, PS-KOTWALI, DIST-NADIA, WEST BENGAL
3571 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION 28/1, D.L.ROY ROAD, BOWBAZAR,KRISHNAGAR,NADIA
3572 NATIONAL CENTRE FOR DEVELOPMENT OF TECHNICAL EDUCATION 28/1, D.L.ROY ROAD, BOWBAZAR,KRISHNAGAR, NADIA,WEST BENGAL
3573 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
3574 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
3575 NATIONAL COUNCIL FOR CHURCH AND SOCIAL ACTION INDIA GEORGE AVENUE, SRCCE CAMPUS, A-CAMP, KURNOOL – 518004
3576 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
3577 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
3578 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
3579 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
3580 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
3581 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION ANANTNAG NEAR MART INFOTECH COLLEGE ANANTNAG
3582 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION KP ROAD ANANTNAG KASHMIR 192101
3583 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION C/O MART INFOTECH COLLEGE ANANTNAG NEAR BUS STAND ANANTNAG
3584 NATIONAL EDUCATION AND WALFARE SOCIETY DEGLOOR NEAR BSNL TOWER,TEACHER COLONY,UDGIR ROAD,DEGLOOR DIST.NANDED
3585 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3586 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3587 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
3588 NATIONAL EDUCATION SOCIETY 3RD FLOOR CITY CENTER TOWER KRISHNA NAGAR
3589 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
3590 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
3591 NATIONAL FEDERATION OF FARMERS PROCUREMENT PROCESSING AND RETAILING COOPERATIVE OF INDIA LIMITED BLOCK-A, 25/17A ,1ST FLOOR,SUJAN SINGH BUILDING,MIDDLE CIRCLE ,CONNAUGHT PLACE,NEW DELHI
3592 NATIONAL FEDERATION OF FARMERS PROCUREMENT PROCESSING AND RETAILING COOPERATIVE OF INDIA LIMITED FIRST FLOOR,BLOCK A-25/19A,SUJAN SINGH BUILDING MIDDLE CIRCLE,CONNAUGHT PLACE,NEW DELHI
3593 NATIONAL FEDERATION OF FARMERS PROCUREMENT PROCESSING AND RETAILING COOPERATIVE OF INDIA LIMITED FIRST FLOOR,BLOCK A25/19A,SUJAN SINGH BUILDING,MIDDLE CIRCLE,CONNAUGHT PLACE,CENTERAL DELHI ,DELHI
3594 NATIONAL FEDERATION OF FARMERS PROCUREMENT PROCESSING AND RETAILING COOPERATIVE OF INDIA LIMITED 25/19A,1ST FLOOR,BLOCK A,SUJAN SINGH BUILDING,MIDDLE CIRCLE,CONNAUGHT PLACE,CENTRAL DELHI,NEW DELHI
3595 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
3596 NATIONAL HUMAN RURAL DEVELOPMENT INSTITUTE NHRDI AT/PO-BALIPATNA, VIA-BHUBANESWAR, DIST-KHURDA, ORISSA, [INDIA]
3597 NATIONAL INNOVATIONS PUBLIC SCHOOL ZAINAPORA SHOPIAN ZAINPORA SHOPIAN
3598 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
3599 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
3600 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
3601 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
3602 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
3603 NATIONAL INSTITUTE OF COMPUTER STUDIES NICS MADANMOHAN PARA, PO-BOXIRHAT DIST- COOCHBEHAR WEST BENGAL
3604 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
3605 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY AKAMPAT, IMPHAL EAST
3606 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
3607 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
3608 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
3609 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
3610 NATIONAL INSTIUTE OF LIFE SKILLS 76-18-63, GONGRESS OFFICE ROAD, GOVERNORPET, VIJAYAWADA
3611 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
3612 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
3613 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
3614 NATIONAL PARAMEDICAL SCIENCES SOCIETY CHAUDHARY COLONY,GOVT COLLEGE ROAD,INDRI,DISTT- KARNAL
3615 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
3616 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
3617 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
3618 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
3619 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
3620 NATIONAL WOMEN DEVELOPMENT TRUST 53 GRAMMASAVADI STREET CUMBUM
3621 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
3622 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
3623 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
3624 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
3625 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
3626 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
3627 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
3628 NATURAL AGROTECH RESEARCH AND PROCESSING SERVICE BLOCK 5 DIC/LBI OPP TUIBONG POST OFFICE
3629 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
3630 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO,66 B SENGALUNEARODAI STREET, KANCHIPURAM - 631502, TAMIL NADU
3631 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
3632 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
3633 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
3634 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
3635 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
3636 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
3637 NAVACHETHANA MALLAPPALLY INSTITUTE
3638 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
3639 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
3640 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3641 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3642 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
3643 NAV BHARAT FOUNDATION 3852/9, 2ND FLOOR, KANHAIYA NAGAR, DELHI
3644 NAV BHARTIYA NARI VIKAS SAMITI VILLAGE AND POST BAHERI DISTRICT BALLIA
3645 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
3646 NAVIGATION EDUCATIONAL AND WELFARE SOCIETY WARD 4 BARTHARA ROAD KHOJAWARE WALA KUWAN KE PASS GOHAD DISTT- BHIND MP
3647 NAV JAGRAN YUVA MANCH VILL+PO:-LAUKAHA NEAR BSNL TOWER,BLOCK-KHUTAUNA DIST-MADHUBANI BIHAR -847421
3648 NAV JAGRAN YUVA MANCH VILL+PO-LAUKAHA NEAR BSNL TOWER BLOCK-KHUTAUNA DIST-MADHUBANI BIHAR-847421
3649 NAV JAGRAN YUVA MANCH VILL+PO-LAUKAHA NEAR BSNL TOWER, BLOCK -KHUTAUNA DIST -MADHUBANI BIHAR-847421
3650 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
3651 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
3652 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
3653 NAV JYOTI WEFARE SOCIETY MESAUDHA,WARD NO.-10,PIPRAHI
3654 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
3655 NAVKAR EDUCATION TRUST NAVKAR PLOT NO.634/9/A, OPP. VASUNDHARA BUS STOP, GULBAI TEKRA, AHMEDABAD, GUJARAT
3656 NAVKAR EDUCATION TRUST NAVKAR PLOT NO. 634/9/A, OPP. VASUNDHARA BUS STOP, GULBAI TEKRA, AHMEDABAD, GUJARAT INDIA
3657 NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE, GADHINGLAJ TAL GADHINGLAJ
3658 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
3659 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
3660 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
3661 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
3662 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
3663 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3664 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3665 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3666 NAVRAJ EDUCATIONAL SOCIETY B-19, RIYAL RESIDENCY, NEAR SHAHPURA THANA, GULMOHAR, BHOPAL
3667 NAVRAJ EDUCATIONAL SOCIETY C-1, SAHYOG PARISAR, GULMOHAR COLONY. TRILANGA, BHOPAL 462039
3668 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
3669 NAVRATAN FOUNDATION NGO 41-D T/F PKT -2 SECTOR -6 DWARKA NEW DELHI 110075
3670 NAVRATAN FOUNDATION NGO 41-D T/F PKT -2 SECTOR -6 DWARKA NEW DELHI 110075
3671 NAVRATANFOUNDATION NGO 41-D T/F PKT -2 SECTOR -6 DWARKA NEW DELHI 110075
3672 NAV SAHYADRI EDUCATION SOCIETY NAV SAHYADRI EDUCATION SOCIETY, 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3673 NAV SAHYADRI EDUCATION SOCIETY 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3674 NAV SAHYADRI EDUCATION SOCIETY NAV SAHYADRI EDUCATION SOCIETY, 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3675 NAV SAHYADRI EDUCATION SOCIETY 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3676 NAV SAHYADRI EDUCATION SOCIETY 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3677 NAV SAHYADRI EDUCATION SOCIETY 725/1, PUNYAINAGAR, DHANKAWADI, PUNE
3678 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
3679 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
3680 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
3681 NAWAPARA LAXMINARAYAN KHADI O GRAMONNAYAN MAHILA SANSTHA NAWAPARA LAXMINARAYAN KHADI -O- GRAMONNAYAN MAHILA SANSTHA ADD- VILL- NAWAPARA P.O-N-MAHADWIPA DIST-BIRBHUM VIA- SAINTHIA WEST BENGAL PIN-731234.
3682 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3683 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3684 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS , AZAD NAGAR DIGHA BAGICHA PATNA
3685 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS AZAD NAGAR DIGHA BAGICHA DIGHT GHAT PATNA BIHAR
3686 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS , AZAD NAGAR DIGHA BAGICHA PATNA
3687 NAYE DRISHTI NAYA SABERA RAM LAKHAN NIWAS AZAD NAGAR DIGHA BAGICHA DIGHAT GHAT PATNA
3688 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
3689 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
3690 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
3691 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3692 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3693 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
3694 NCFT EDUCATIONS PRIVATE LIMITED 122 A/2 IIND FLOOR, OPP.VAIKALPALAM BUS STOP, TRIVANDRUM ROAD, PALAYAMKOTTAI, TIRUNELVELI DIST. TAMIL NADU.
3695 NCFT EDUCATIONS PRIVATE LIMITED 122 A/2 IIND FLOOR, OPP.VAIKALPALAM BUS STOP TRIVANDRUM ROAD, PALAYAMKOTTAI, TIRUNELVELI DIST, TAMILNADU.
3696 NCLM SHIKSHAN SANSTHAN 546 K.L KYDGANJ BANK OF BARODA BUILDING ALLAHBAD UTTAR PRADESH
3697 NCLM SHIKSHAN SANSTHAN 546, KHALSI LINE KYDGANJ ALLAHABAD
3698 NDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -30203
3699 N D MEMORIAL SHIKSHAN SANSTHAN SANTI NAGAR NIMBOL ROAD JAITARAN
3700 N D MEMORIAL SHIKSHAN SANSTHAN JAITARAN SANTI NAGAR NIMBOL ROAD JAITARAN
3701 N D MEMORIAL SHIKSHAN SANSTHAN JAITARAN SANTI NAGAR NIMBOL ROAD JAITARAN
3702 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
3703 NEBRDA NORTH EASTERN BIO ECONOMIC RURAL DEVELOPMENT ACTIVITIES NIT COMPLEX NEAR BRIGHTER SCHOOL NEW CHECKON IMPHAL EAST
3704 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
3705 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD, AGRA
3706 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD
3707 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
3708 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
3709 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
3710 NEHRU ADARSH YOUTH CLUB VPO SALEHAR TEHSIL BISHNAH, DISTRICT JAMMU
3711 NEHRU MAHILA MANADAL GOVIND BHAWAN KHAJURI SADAK KHAJURI
3712 NEHRU MAHILA MANDAL GOVIND BHAWAN KHAJURI SADAK BHOPAL
3713 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
3714 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
3715 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
3716 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
3717 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
3718 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
3719 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
3720 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
3721 NEMPACT TECHNOLOGY LLP A-313, DEFENCE COLONY, 2ND FLOOR, NEW DELHI
3722 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
3723 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
3724 NERAVU FOUNDATION 6/1, 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET,KUMARA PARK WEST, SHESHADRIPURAM, BLORE- 560020
3725 NEST NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3726 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
3727 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
3728 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
3729 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
3730 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
3731 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
3732 NETSPOT SERVICES INDIA PRIVATE LIMITED DIGITAL SEWA KANDRA NEAR HDFC BANK ,VPO. JAURA CHHATTRAN,GURDASPUR
3733 NETSPOT SERVICES INDIA PRIVATE LIMITED NETSPOT SERVICES INDIA PVT.LTD DIGITAL SEWA KENDRA,NEAR HDFC BANK, VPO. JAURA CHHATTRAN DISTT GURDASPUR PUNJAB
3734 NETSPOT SERVICES INDIA PRIVATE LIMITED NETSPOT SERVICES INDIA PRIVATE LIMTED DIGITAL SEWA KANDRA NEAR HDFC BANK VPO.JAURA CHHATTRAN
3735 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3736 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3737 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
3738 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
3739 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
3740 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
3741 NEW ERA EDUCATION DEVELOPMENT SOCIETY CO TARA INFOTECH NEAR PS BANK MALL GODOWN ROAD RAMPURA PHUL
3742 NEW ERA EDUCATION DEVELOPMENT SOCIETY NEED TARA INFOTECH NEAR PS BANK RAMPURA PHUL
3743 NEWERA SKILLS LLP E 607 TITANIUM CITY CENTRE 100 FT RING ROAD SATELLITE AHMEDABAD
3744 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3745 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
3746 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
3747 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3748 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3749 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3750 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3751 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3752 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3753 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3754 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3755 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3756 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
3757 NEW LBS SANSTHAN ZERO MILE CHORAHA , PRATAPGARH
3758 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
3759 NEW LBS SANSTHAN PRATAPGARH ZERO MILE CHOURAHA , PRATAPGARH , RAJASTHAN
3760 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
3761 NEW MOON RUPASHPUR, KAMALPUR, DHALAI KAMALPUR
3762 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
3763 NEW SIMBOL TAKNIKI PRASHIKSHAN SANSTHAN CIVIL LINE KATNI
3764 NEW SWIFT EDUCATION AND EMPLOYMENT CONSULTANCY PRIVATE LIMITED 29/238 KHALSHA CHAMBERS BEAWAR RAOD AJMER
3765 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3766 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
3767 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3768 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3769 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
3770 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
3771 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
3772 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3773 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
3774 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
3775 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3776 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
3777 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3778 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3779 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3780 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
3781 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
3782 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3783 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3784 NEXT STEP LOGISTICS MANAGEMENT PVT LTD NO 14, 1ST FLOOR, SAI NIVAS, 5TH CROSS, 1ST BLOCK, AKSHAYA NAGAR, RAMMURTHY NAGAR EXTN, BANGALORE
3785 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
3786 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
3787 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
3788 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAR MIRAN SAHIB
3789 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
3790 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
3791 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
3792 NIELIT IMPHAL NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY (NIELIT) IMPHAL AKAMPAT P.O BOX 104, IMPHAL, MANIPUR 795001
3793 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
3794 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
3795 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
3796 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
3797 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
3798 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3799 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3800 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3801 NILAGIRI INSTITUTE OF HOTEL MANAGEMENT AND CATERING TECHNOLOGY INDUSTRIAL SCHOOL 12-687H NEAR JUDICIAL MAGISTRATE COURT MYSORE ROAD GUDALUR THE NILGIRIS TAMILNADU
3802 NILAI EDUCATIONAL TRUST OPP.NATH HOSPITAL ,KADRU,
3803 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
3804 NILANCHAL CHEMICAL AND FERTILIZERS LIMITED C/O RAM RADHIKA MAHAVIDHYALAY GRAM : - CHATIYA POST :- MEHRUNA LAR , SALEMPUR
3805 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
3806 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
3807 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
3808 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
3809 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
3810 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
3811 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
3812 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
3813 NIRBAL VARG SWASTHYA KALYAN SAMITI 448 WAZIDPUR SOUTH JAUNPUR 222002 UP
3814 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
3815 NIRMALA MAHILA SHILP KALA KENDRA ADARSH NAGAR SECT-1 LAKHIMPUR PUR ROAD SITAPUR
3816 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA AHMEDABAD
3817 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA, AHMEDABAD-
3818 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
3819 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
3820 NISHKAM SEWA SANSTHAN NEAR 101 NO. RAILWAY GETA, MERTA ROAD TAHSIL MERTA CITY DISTRICT NAGAUR
3821 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, PO - SOUTH SINTHEE, PS - SINTHI,
3822 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, P.S.- SINTHI, P.O.- SOUTH SINTHEE, KOLKATA
3823 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
3824 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
3825 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
3826 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3827 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3828 NITEOIT SOLUTIONS PVT LTD HYDERABAD: PLOT NO 6, H NO 1-66/4/6, KAVURI HILLS, MADHAPUR, HYDERABAD BANGALORE: NITEOIT, #118, 2ND FLOOR, HORAMAVU CROSS, BANASWADI RING ROAD, BANGALORE – 560043
3829 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
3830 NITYANANDA E LEARNING PVT LTD BLOCK NO. 5/6, MAHATMA PHULE COMPLEX, SHIVAJI CHOWK, VADUJ-415506
3831 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
3832 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3833 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3834 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
3835 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
3836 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
3837 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
3838 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SITALA MATA LANE, P.S. BARANAGAR, KOLKATA-90
3839 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SHITALA MATA LANE GROUND FLOOR, FLAT NO- AS 6
3840 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 2O/1 SITALA MATA LANE GROUND FLOOR FLAT NO AS6
3841 NOBAL ORGANIZATION OF ZEST YIELDING NOZY SOCIETY 1. D-56, SHANTI NAGAR, KHATI PURA ROAD, JAIPUR- 302006 2. SIS SCHOOL CAMPUS, RIDHI SHIDHI PULIYA, SHIPRA PATH, MANSAROVAR, JAIPUR - 302020
3842 NOBAL ORGANIZATION OF ZEST YIELDING NOZY SOCIETY 1. D-56, SHANTI NAGAR KHTI PURA, JAIPUR, RAJ. 302006 2. SIS SCHOOL CAMPUS, RIDHI SIDHI PULIYA, SHIPRA PATH, MANSAROVAR, JAIPUR, RAJ 302020
3843 NOBEL ORGANIZATION OF ZEST YIELDING SOCIETY SIS SCHOOL CAMPUS, RIDHI SIDHI PULIA, SHIPRA PATH, MANSAROVAR,JAIPUR
3844 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
3845 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
3846 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
3847 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
3848 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
3849 NOBLE MUSLIM MINORTIY EDUCATIONAL AND WELFARE SOCIETY YUNUS COLONY,AURANGABAD, 431001
3850 NODAL SOCIETY OF HUMAN RESOURCES AND DEVELOPMENT BHONAWASH ,HULDA PLAZA POATA KOTPUTLI JAIPUR
3851 NO EDUCATION RAVINDRA NAGAR RAIPUR
3852 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
3853 NOMISMA NETWORKS PRIVATE LIMITED NOMISMA NETWORKS PVT LTD GROUND FLOOR PLOT NO 2673 SECTOR 2 FARIDABAD
3854 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
3855 NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION REGISTERED OFFICE ADDRESS:2ND FLOOR,NEW MARKET,ITI COMPLEX,KAMLABARI ROAD,16 NO TINIALI,DULIAJAN,DIBRUGARH,ASSAM,PIN:786602 CAMPUS ADDRESS:NALAPARA,NEW VIP,SARUSAJAI,LOKHARA,GUWAHATI,ASSAM,PIN:781040
3856 NORTH EASTERN SOCIETY FOR TECHNICAL EDUCATION CAMPUS:NALAPARA,NEW VIP,LOKHRA,GHY-781040 REGISTERED OFFICE:16NO TINIALI,ABOVE ALLAHABAD BANK,KAMALABARI ROAD,DULIAJAN-786602,DIBRUGARH,ASSAM
3857 NORTH EAST INSTITUTE FASHION TECHNOLOGY NEIFT,SECOND FLOOR,(NEXT TO SBI EVENING BRANCH) G.N.B. ROAD,GUWAHATI
3858 NORTH EAST INSTITUTE OF PROFESSIONAL STUDIES MAWBYRSHEM, NEW NONGSTOIN, WEST KHASI HILLS DITSRICT
3859 NORTH EAST INSTITUTE OF PROFESSIONAL STUDIES C/O NEIPS, IB ROAD, UPPER NEW NONGSTOIN, WEST KHASI HILLS DISTRICT
3860 NORTH EAST INSTITUTE OF PROFESSIONAL STUDIES UPPER NEW NONGSTOIN, WEST KHASI HILLS DISTRICT
3861 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
3862 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
3863 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
3864 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
3865 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
3866 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
3867 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
3868 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
3869 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
3870 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
3871 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
3872 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
3873 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
3874 NRLM SKILLS SAMRAT,CHANKYAPURI
3875 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
3876 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
3877 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
3878 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3879 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3880 NST ACADEMY REGD OFFICE : NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3881 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
3882 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3883 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3884 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3885 NVR AND ASSOCIATES LIMITED 2E/6 MOTI BHAWAN JHANDEWALA EXTENSIONS, NEW DELHI-110055.
3886 NVR AND ASSOCIATES LIMITED 2E/6 MOTI BHAWAN JHANDEWALA EXTENSIONS, NEW DELHI
3887 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
3888 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3889 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3890 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
3891 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3892 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
3893 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3894 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
3895 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
3896 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
3897 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
3898 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
3899 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
3900 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
3901 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
3902 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
3903 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
3904 ODISA TECHNICAL AND MANAGEMENT EDUCATIONAL SOCIETY SHREE LAXMI NIVAS , LAXMINAGAR , BABUA BAGICH , COX COLONY , PO INDUSTRIAL ESTATE , JHARSUGUDA DIST JHARSUGUDA ORRISA
3905 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3906 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3907 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3908 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
3909 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
3910 OLIRUM INDIA TRUST NO.175, VALLUVAR STREET, CHINNAKALLAPADI VILLAGE AND POST, TIRUVANNAMALAI
3911 OLIRUM INDIA TRUST NO.175, VALLUVAR STREET, CHINNAKALLAPADI VILLAGE AND POST TIRUVANNAMALAI
3912 OLIRUM INDIA TRUST A1143, IISTREET, THAMARAI NAGAR, TIRUVANNAMALAI
3913 OLIRUM INDIA TRUST A1143, THAMARAI NAGAR, TIRUVANNAMALAI
3914 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
3915 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
3916 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
3917 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
3918 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
3919 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
3920 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
3921 OMKARESHWAR CONSULTING AND OUTSOURCING SERVICES PRIVATE LIMITED 58 ELDECO GREENS GOMTI NAGAR UTTAR PRADESH LUCKNOW
3922 OM SAI CONTRUCTION OM SAI CONSTRUCTION 61/2 MAHAVEER CHOWK NARAYANPUR CHHATTISGARH
3923 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
3924 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH SANGEWAR COPMLEX MAIN ROAD LOHA TQ LOHA DIST NANDED
3925 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH MAIN ROAD LOHA TQ LOHA DIST NANDED
3926 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH BUS STAND OPPOSITE MAIN ROAD LOHA TQ LOHA DIST NANDED
3927 OM SAKTHI EDUCATIONAL TRUST 1/1 SALEM MAIN ROAD,DEVARASAMPATTI(V),ADHIYAMANKOTTAI(PO),DHARMAPURI
3928 OMSAKTHI EDUCATIONAL TRUST 1/1 SALEM MAIN ROAD,DEVARASAMPATTI (V),ADHIYAMANKOTTAI (PO), DHARMAPURI
3929 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
3930 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
3931 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
3932 OMTECH COMPUTER SOCIETY I FLOOR ALLAHABAD BANK NAINITAL ROAD BAHERI BAREILLY
3933 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
3934 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
3935 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
3936 ONE INDIA INFORMATION TECHNOLOGY PRIVATE LIMITED ONE INDIA INFORMATION TECHNOLOGY PRIVATE LIMITED OFFICE NO.501 FIFTH FLOOR VAISHALI TOWER -II NURSERY CIRCLE VAISHALI NAGAR JAIPUR RAJASTHAN
3937 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
3938 ONE TRADE GLOBAL LIMITED S/5-480 1ST FLOOR, NILANDRI VIHAR
3939 ONEWAY SKILL MANAGEMENT AND TECHNOLOGY PRIVATE LIMITED FLAT NO. 1645-A DHANAS CHANDIGARH
3940 ONE WINDOW SOLUTION PVT LTD PLOT NO. 331, SECTOR - 8 VIDHYADHAR NAGAR JAIPUR
3941 ONE WINDOW SOLUTIONS PVT LTD PLOT # 331, SECTOR - 8 VIDHYADHAR NAGAR
3942 ONEX MEDICAL AND EDUCATION WELFARE SOCEITY 178/14 NEAR- SARSWATI SCHOOL, NEHRU NAGAR, SAMAN , REWA, MADHYA PRADESH -486001
3943 ONFIELDIN PRIVATE LIMITED #16, ANJANAVILAS, S.R. LAYOUT, SRIRAMPURA - II STAGE, MYSORE - 570023
3944 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
3945 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY PUNGH, SUNDERNAGAR, DISTT MANDI (HP)
3946 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY LEHRAGAGA-148031 DISTT. SANGRUR (PB.)
3947 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
3948 OPTIMA ELECTRICAL SYSTEMS PVT LTD S L TOWER, UR 43, UPPALAM ROAD, STATUE TRIVANDRUM 695001
3949 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
3950 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
3951 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
3952 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3953 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3954 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3955 ORBIT DETECTIVE AND SECURITY SERVICES PVT LTD 102, MEGHDOOT TOWER, VIJAYNAGAR, INDORE
3956 ORBIT SKILL FOUNDATION NEAR AYYAPA TEMPLE VRINDAWAN COLONY JAGDALPUR PINCODE -494001
3957 ORBIT SKILL FOUNDATION NEAR AYYAPPA TEMPLE, VRINDAVAN COLONY, JAGDALPUR
3958 ORBIT SKILL FOUNDATION SOCIETY ORBIT SKILL FOUNDATION NEAR AYYAPA TEMPLE VRINDAWAN COLONY JAGDALPUR PINCODE -494001
3959 OREMUS CORPORATE SERVICES PRIVATE LIMITED 6-3-249/3,3RD FLOOR, ABHINANDAN TOWERS, ABOVE AXIS BANK, ROAD NO.1, BANJARA HILLS, HYDERABAD-500034.
3960 ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3961 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3962 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3963 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
3964 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3965 ORIGIN CADD INFOTECH NO:49 THIYAGI KUMARAN STREET THANEERPANDAL, PEELAMENU COIMBATORE TAMILNADU
3966 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3967 ORION TRUST SAGOLBAND THINGOM LEIKAI
3968 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
3969 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3970 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
3971 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3972 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
3973 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3974 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3975 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3976 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
3977 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3978 ORRISIS ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3979 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
3980 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3981 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3982 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
3983 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
3984 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
3985 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
3986 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
3987 OVER AIR TECHNOLOGIES PRIVATE LIMITED #2385, SECTOR-22C, CHANDIGARH
3988 OVER AIR TECHNOLOGIES PRIVATE LIMITED S.C.O-84/1, SECTOR-58, SHAHI MAJRA MOHALI
3989 OXFORD SHIKHHA PRASAR SANSTHAN TIWARIYAN CHHIBRAMAU, KANNAUJ U.P.
3990 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI U.P. IN CODE-262701
3991 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3992 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3993 OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI
3994 OXYGEN INSTITUTE ASE OXYGEN INSTITUTE ASE SETH COLONY ARJUNPURWA
3995 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
3996 PABAN JYOTI BHUYAN GHY
3997 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
3998 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
3999 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
4000 PACE WELFARE AND SKILL DEVELOPMENT SOCIETY 84 WARD NO.8, GALI NO.1 NAVANKUR GALI, GANJ BASODA DISTRICT VIDISHA MP-464221
4001 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
4002 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
4003 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
4004 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
4005 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
4006 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
4007 PADMAJA WELFARE SOCIETY HOUSE OF SHRI GAGAN, FLA NO.- 101/B, RAGHVENDRA LOK, PUNAICHAK, BAILEY ROAD, PATNA, BIHAR
4008 PADMANABHAN EDUCATIONAL TRUST SANNATHI STREET SRIMUSHNAM CUDDALORE DIST
4009 PADMANABHAN EDUCATIONAL TRUST SANNATHI STREET SRIMUSHNAM
4010 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
4011 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
4012 PAL FACILITY MANAGEMENT SERVICES PRIVATE LIMITED E-568 KH NO-113-3 GALI NO 79 MAHAVIR ENCL-3 NEAR MOTHER DAIRYNEW DELHI - 110059
4013 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
4014 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
4015 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
4016 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
4017 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
4018 PANAH FOUNDATION 5,KAILASH NAGAR, NEAR GAYATRY SOCIETY. B/H- RAJIV GHANDHI BHAVAN SAIJPUR BHOGHA,NARODA ROAD
4019 PANAH FOUNDATION 5 KAILASH NAGAR , B/H RAJIV GANDHI BHAVAN, SAIJPUR BOGHA,
4020 PANAH FOUNDATION 5,KAILASH NAGAR, NEAR GAYATRY SOCIETY. B/H- RAJIV GHANDHI BHAVAN SAIJPUR BHOGHA,NARODA ROAD
4021 PANAPUR CONSTRUCTION PRIVATE LIMITED D-29, GROUND FLOOR, GANESH NAGAR, PANDAV NAGAR COMPLEX, NEAR HANUMAN MANDIR, DELHI EAST DELHI 110092 INDIA
4022 PANAPUR CONSTRUCTION PRIVATE LIMITED D-29, GROUND FLOOR, GANESH NAGAR, PANDAV NAGAR COMPLEX, NEAR HANUMAN MANDIR, DELHI EAST DELHI 110092 INDIA
4023 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
4024 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
4025 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
4026 PANCHSHEEL THINKERS SAMITI MERHWA (BANGANGA ROAD)SHOHRATGARH SIDDHARTHNAGAR 272205 UTTAR PRADESH
4027 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
4028 PANCHSHEEL THINKERS SAMITI MERHWA (BANGANGA ROAD) SHOHRATGARH SIDDHARTHNAGAR 272205
4029 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
4030 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
4031 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
4032 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
4033 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
4034 PANDIT DEENDAYAL UPADHYAY EDUCATION SOCIETY 24 KK PURI AWAS VIKAS JHANSI
4035 PANDIT LEKHRAM VEDIC MISSION D-15/1,GF,ARDEE CITY, GURGAON, HARYANA
4036 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
4037 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
4038 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU JAMMU
4039 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
4040 PANSI TECHNOLOGIES 101,PANSI HOUSE,NEAR BY PARYAG SOCIETY BUILDING,LOKDHARA KALYAN (E), TISGAON RD, LOKGRAM, KALYAN, MAHARASHTRA 421306
4041 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17,KURUKSHETRA
4042 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17, KURUKSHETRA
4043 PARADISE RABBIT FARM SCO -91, LIND FLOOR, SECTOR -17, KURUKSHETRA
4044 PARAKRAM ASSOCIATION OF GWALIOR ENGINEERS 78-TANSEN NAGAR GWALIOR
4045 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
4046 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20 NEW ASHOK NAGAR DELHI
4047 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
4048 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
4049 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20, NEW ASHOK NAGAR, DELHI
4050 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
4051 PARAM EDUCATIONS SAMITI SOMANI AADARS VIDYAMANDIR ,NEAR GHANTA GHAR,SIKAR (RAJ.)
4052 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
4053 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
4054 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
4055 PARAMOUNT WELFARE SOCIETY 90/6, SHKTI NAGAR BARI, RAISEN,M.P
4056 PARAMPARA FOUNDATION JF-2/8,BLOCK-2,JANTA FLAT,ARYA KUMAR ROAD,P.O.-RAJENDRA NAGAR,P.S.-KADAMKUAN,PATNA
4057 PARAMPARA FOUNDATION JF-2/8,BLOCK 2 JANTA FLAT,ARYA KUMAR ROAD,RAJENDRA NAGAR,P.O. RAJENDRA NAGAR,P.S.-KADAMKUAN
4058 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
4059 PARAS SPORTS AND EDUCATIONAL SOCIETY J.K BUILDING, OPP KHALSA COLLEGE, AMRITSAR
4060 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
4061 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
4062 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
4063 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
4064 PARIDHI AT NAYATOLA,BHIKHANPUR PO BHAGALPUR BHAGALPUR
4065 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
4066 PARINITA GRAMEEN VIKAS SAMITI WARD NO.14 PAWAR DHARMSHALA NEAR BUS STAND NASRULLAGANJ DIST. SEHORE (M.P.)
4067 PARISHRAM MAHILA MANDAL CHARITABLE TRUST 5, AMRUT SAGAR APARTMENT, PURVI SOCIETY, HIRABAUG, SURAT.
4068 PARISHRAM MAHILA MANDAL CHARITABLE TRUST 5, AMRUT SAGAR APARTMENT, PURVI SOCIETY, HIRABAUG, SURAT.
4069 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
4070 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
4071 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
4072 PARIVARTAN SANDESH FOUNDATION B-1, UPPER GROUND FLOOR, PROPERTY BEARING NO. 134-D/1, SITUATED AT BEGUMPUR, NEW DELHI
4073 PARIVARTAN SANDESH FOUNDATION 134-D/1,FLAT NO. B-1,UGF,BEGUMPUR,NEW DELHI
4074 PARIVARTAN SANDESH FOUNDATION B-1, UGF, PROPERTY BEARING NO.134-D/1, BEGUMPUR, NEW DELHI
4075 PARKSONS DYESTUFF INDUSTRIES PRIVATE LTD 500, PAREKH HOUSE, OPP LENDRA PARK OLD RAMDASPETH
4076 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
4077 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
4078 PARTH THREAD PRIVATE LIMITED VILLAGE MAMREJPUR POST SURAPUR TEHSIL TANDA DISTT AMBEDKAR NAGAR
4079 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
4080 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
4081 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
4082 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
4083 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
4084 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
4085 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
4086 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
4087 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
4088 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
4089 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
4090 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
4091 PAWAN DSDSDS
4092 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
4093 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
4094 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
4095 PCI EDUCATIONAL TRUST W.NO 1 RS PURA JAMMU 181102 H/O SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
4096 PCI EDUCATIONAL TRUST W.NO 1 RS PURA JAMMU H/O SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU
4097 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
4098 PC INFOTECH GROUP PC INFOTECH GROUP, 3RD FLOOR, CENTRAL MARKET, TINKONIA, BURDWAN, WEST BENGAL-713101
4099 PEACE DEVELOPMENT SOCIETY NEAR MAZAR HAFIZ JAMAL SAHAB BAJORI TOLA RAMPUR UP
4100 PEACE RURAL DEVELOPMENT SOCIETY PRDS 87/909, NEAR KMC WATER PLANT TELECOM NAGAR
4101 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, DAALNWALA
4102 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, OPP. GURUDWARA, DEHRADUN
4103 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
4104 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
4105 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
4106 PEDAGOGUES EDUCATION INDIA PVT LTD 810,VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
4107 PEDAGOGUES EDUCATION INDIA PVT LTD 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
4108 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
4109 PENTAGON MARITIME TRAINING AND RESEARCH INSTITUTE PMTRI BUILDING, PENTAGON HOUSE, CIDCO SERVICE I NDUSTRI AL AREA, PLOT NO. 60, SECTOR-1, SHIRVANE, NERUL-E, NAVI MUMBAI
4110 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
4111 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
4112 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
4113 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
4114 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
4115 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
4116 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL HARYANA
4117 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL ,HARYANA
4118 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
4119 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
4120 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
4121 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
4122 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
4123 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
4124 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
4125 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
4126 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
4127 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
4128 PHILADELPHIA RURAL DEVELOPMENT SOCIETY PHILADELPHIA COMPOUND TAHSILPARA WARD NO-13 BIJAPUR DISTRICT BIJAPUR
4129 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
4130 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
4131 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
4132 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
4133 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
4134 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
4135 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
4136 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
4137 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
4138 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
4139 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
4140 PITAMBER SHARMA RAGHUNATH TEMPLE,MAIN MARKET WARD NO.-6
4141 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
4142 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
4143 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
4144 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
4145 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
4146 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
4147 PLAN TO EMPOWER F 13/17 B, TF JOGA BAI EXTEN. JAMIA NAGAR OKHLA, NED DELHI
4148 PLAN TO EMPOWER F 13/17B TF, JOGABAI EXTENSION, JAMIA NAGAR, OKHLA, NEW DELHI
4149 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
4150 PLEASE DELETE TEST APPLICATION TEST IN TEST
4151 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
4152 P L S AUTO SHELL INDUSTRIES PRIVATE LIMITED 377 DHOLPURAAGRA ROAD FIROZABAD UTTAR PRADESH UP 283203
4153 PLS AUTO SHELL INDUSTRIES PRIVATE LIMITED 377 DHOLPURAAGRA ROAD FIROZABAD UTTAR PRADESH UP 283203 IN
4154 PLUS91 SECURITY SOLUTIONS 2/400, GROUND FLOOR, SUBHASH NAGAR, NEW DELHI
4155 PLUS91 SECURITY SOLUTIONS 510, ANSAL TOWER, NEHRU PLACE, NEW DELHI
4156 PLUSTRUST FLAT NO 101, SRI SABARI RESIDENCY, 11-3-397, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD
4157 PLUSTRUST 101, SRI SABARI RESIDENCY, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD.
4158 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
4159 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
4160 POLYVALENT CONSULTING PVT LTD KAKADEO,PLOT NO.-117/L/248, NAVEEN NAGAR, KANPUR
4161 PONNI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE,PATTUKONAMPATTI POST,PAPPIREDDIPATTI TALUK,DHARMAPURI DT,PINCOAD :636905.
4162 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
4163 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
4164 PORNICA EDUCATIONAL TRAINING INSTITUTE OLD SUBRAMANI KOVIL STREET, PAUPPARAPATTI PO, PENNAGARAM TALUK, DHARMAPURI DISTRICT
4165 POSITIVE WOMEN NETWORK OF RAJASTHAN SOCIETY PLOT NUMBER49 50 63 GANDHIGRAM JAISINGHPURA NEWATA TEHSIL SANGANAR DISTRICT JAIPUR STATE RAJASTHAN
4166 POWER OF MIND 336, LAJPAT NAGAR, BEHIND PN BANK, CANAL ROAD, JAMMU.
4167 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
4168 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
4169 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
4170 PRABHAT PUBLIC SIKSHA PRASAR SAMITI MOHLLA RAJEEV NAGAR PRABHAT PUBLIC JUNIOR HIGH SCHOOL NH. 24 PILIBHIT ROAD RITHORA BAREILLY
4171 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
4172 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
4173 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
4174 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
4175 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
4176 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
4177 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
4178 PRAGATHI SEVA SAMITHI ​H.NO. 2 - 6 - 45/2, SRI SHANTHI NAGAR COLONY, ROAD NO.2, CIRCUIT HOUSE ROAD, HANAMKONDA, WARANGAL URBAN
4179 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
4180 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
4181 PRAGATI EDUCATION AND CHARITABLE TRUST RAJKOT SHOP NO-302 3ED FLOUR DECORA SQUARE SADHUVASVANI ROAD RAJKOT
4182 PRAGATI FOUNDATION ABOVE LAKSHMI SUPAR MARKET NEEM CHOURAHA BODA BAG REWA M P
4183 PRAGATI FOUNDATION NEAR PANDEN BUILDING NEEM CHOURAHA BODA BAAG REWA M P
4184 PRAGATI UNIVERSAL TRUST PLOT NO – 9, KHASRA NO – 173, BLOCK –A, GALI NO – 6, MAHARANA VIHAR, DISTRICT GHAZIABAD, GHAZIABAD UTTAR PRADESH – 201009
4185 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
4186 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
4187 PRAKALPGRAST KALYANKARI SAMITEE GONDIAS JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA-441601 (MS)
4188 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
4189 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
4190 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
4191 PRAKASH DEEP SEWA SANSTHAN PDSS SCHOOL OF SKILL DEVELOPMENT H.N. 60, NARAYAN NAGAR WARD, GORA BAZAR, RAEBARELI (U.P.) MOBILE: 9616542695
4192 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
4193 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
4194 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
4195 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
4196 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
4197 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
4198 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
4199 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
4200 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
4201 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
4202 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
4203 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
4204 PRATAP SEWA SAMITI GOMATI NAGAR PANCHO PEERAN SULTANPUR
4205 PRATHAM HEERA SALES PRIVATE LIMITED KRIDA BHAVAN BUILDING, BEHIND MUNICIPAL COUNCIL, NANDURBAR
4206 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
4207 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
4208 PRATHYAK SERVICES PRIVATE LIMITED F-16, RING ROAD, ADIL NAGAR LUCKNOW
4209 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
4210 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
4211 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
4212 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
4213 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
4214 PRATISHTHA C-67 JEEWAN PARK PANKHA ROAD UTTAM NAGAR DELHI-110059
4215 PRAWAH 303, RAMJEET APARTMENT, ARA GARDEN ROAD, JAGDEO PATH, PATNA
4216 PRAWAH SRIRAM TOWER ASHIANA DIGHA ROAD, OPPOSITE IMERIAL GARDEN BEDDING HALL, PATNA
4217 PRAWAH SRI RAM TOWER, ASHIANA DIGHA ROAD, PATNA
4218 PRECAMA HEALTHCARE PRIVATE LIMITED FLAT NO. G/A, MAYUR APARTMENTS 3A, DR. U. N. BRAHMACHARI STREET (OLD LOUDON ST) KOLKATA
4219 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
4220 PREM KUNJ CONSTRUCTION AND ENGG PVT LTD 2 KATEWA NAGAR EXT.,GUJAR KI THARI , NEW SANGANER ROAD JAIPUR
4221 PREMLILA VITHALDAS POLYTECHNIC SNDT WOMENS UNIVERSITY MUMBAI PREMLILA VITHALDAS POLYTECHNIC SIR VITHALDAS VIDYAVIHAR, JUHU ROAD, SANTACRUZ (WEST), MUMBAI-400 049. TELEPHONE: 26608676, 26608493, 26608462, 26606648 EXTN. 253 EMAIL: PVP@PVPSNDT.ORG, PRINCIPAL@PVPSNDT.ORG
4222 PRERANA RUGUDIPARA BALANGIR
4223 PRERANA RUGUDIPARA BALANGIR ODISHA
4224 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
4225 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
4226 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
4227 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
4228 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
4229 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
4230 PRIME EDUCATIONAL TRUST NO 20 PERUMAL NORTH STREET
4231 PRIME EDUCATIONAL TRUST 20, PERUMAL NORTH STREET, NAGAPATITNAM
4232 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
4233 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
4234 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
4235 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY, ANANTAPUR(V) ANANTAPUR(M) ANANTAPUR (D) ANHRAPRADESH
4236 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY ANANTAPUR (V&M) ANANTAPUR(D) A.P
4237 PRINCIPAL GOVERNMENT INDUSTRIAL TRAINING INSTITUTE ROPAR NANGAL ROAD, ROPAR
4238 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10 HUDA PARK,NEAR NEW BUS STAND KURUKSHETRA
4239 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
4240 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
4241 PRIX AUTOMATION BASEMENT, SEHRAWAT BHAWAN, OPP. SARASWATI MAHILA COLLEGE, PALWAL, HARYANA
4242 PRIYADARSHANI MAGASWARGIYA VIKAS MAHILA MANDAL NANDED B-5 VISHNU COMPLEX,NEAR TAJ PATIL HOTEL,ITI CORNER NANDED
4243 PRIYADARSHINI EDUCATIONAL SOCIETY MUTTAMSETTY TOWERS, SLATE SCHOOL RD, SWATHI AVENUE, AMEERPET
4244 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING, DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR
4245 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING., DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR, DIST-AHMEDNAGAR
4246 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
4247 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
4248 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
4249 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
4250 PRIYA GRIH UDYOG VIKAS AVAM SHIKSHA PRASAR SAMITEE N7/48 R-11 PATEL NAGAR CHHOTIBHIKHARIPUR D.L.W VARANASI
4251 PRIYANKA URBAN AND RURAL DEVELOPMENT ORGANIZATION NO.8 6TH MAIN ROAD NEAR GANGAMMA TEMPLE GANGANAGAR R T NAGAR POST BANGALORE
4252 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
4253 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
4254 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
4255 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
4256 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
4257 PROFESSIONAL FASHION AND MANAGEMENT PRIVATE LIMITED D-116, OKHLA INDUSTRIAL AREA, PHASE 1, OKHLA, NEW DELHI
4258 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
4259 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
4260 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS DOOR NO 30/348 BALAJINAGAR DHARMAVARAM ANANTAPUR (D) ANDHRAPRADESH (S)
4261 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
4262 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
4263 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
4264 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, M.J.D. GOVERNMENT P.G. COLLEGE KE PASS, TARANAGAR, DIST.- CHURU
4265 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, NEAR M.J.D. GOVT P.G. COLLEGE, TARANAGAR
4266 PROPERTY SOLUTONS INDIA PVT LTD UNIT NO 73, 7TH FLOOR, KALPATARU SQUARE, OFF ANDHERI KURLA ROAD, KONDIVITA LANE, ANDHERI EAST, MUMBA400059
4267 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
4268 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
4269 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
4270 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
4271 PROWINS AGRI SYSTEM PROWINS AGRI SYSTEM, NEAR OLD BRIDGE, MARUTHAMKUZHY, KANJIRAMPARA P O THIRUVANANTHAPURAM 695030 KERALA
4272 PROWINS AGRI SYSTEM SAGARIKA, NEAR OLD BRIDGE, MARUTHANKUZHY, KANJIRAMPARA P.O.,THIRUVANANTHAPURAM 30
4273 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
4274 PROWINS AGRI SYSTEM SAGARIKA, MARUTHAMKUZHY, KANJIRAMPARA P O THIRUVANANTHAPURAM 30 KERALA
4275 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
4276 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
4277 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
4278 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
4279 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
4280 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
4281 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
4282 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
4283 PSLMM DG
4284 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
4285 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
4286 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
4287 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
4288 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
4289 PT HARGOVIND MANAGMENT AND RESEARCH SOCIETY NARAYANPUR POST-TARN
4290 PUB BARPETA SOCIAL WELFARE SOCIETY VILL- MAZDIA , P.O- PACHIM MAZDIA, P.S- SARTHEBARI, DIST- BARPETA, ASSAM.
4291 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
4292 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
4293 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
4294 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
4295 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
4296 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
4297 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
4298 PUNE CONSULTANCY SERVICES PRIVATE LIMITED REGISTERED ADDRESS : A2-803,GANGA OSIAN MEADOWS,NEAR ADITYA BIRLA HOSPITAL,THERGAON,PUNE PLANT & TRAINING MANAGEMENT ADDRESS : PLOT NO: 116, SURVEY NO: 31/14, KIRTI CLASSIQUE, NEAR KPIT CUMMINS, RAJIV GANDHI INFOTECH PART,PHASE-1, HINJEWADI MARUNJI ROAD.PUNE 411057
4299 PUNJ AAB EDUCATION AND WELFARE SOCIETY MOONAK # 96, WARD NO. 1, VPO MOONAK DISTT. SANGRUR (PUNJAB)
4300 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
4301 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
4302 PUNJAB SEVA SAMITEE 36A, WHOLE SALE CLOTH MARKET, GANDHIBAGH, NAGPUR, MAHARASHTRA
4303 PUNYSHLOK AHILYADEVI MAHILA BAHUUDESHIYA SANSTHA NEAR J.V MEHTA NAVAYUG VIDHYALAY BEHIND AMBIKA KRIDA MANDAL RAILWAY STATION KHAMGAON
4304 PURAN MURTI EDUCATIONAL SOCIETY VILLAGE & P.O. - KAMI, DISTT - SONEPAT
4305 PURAN MURTI EDUCATIONAL SOCIETY VILLAGE & P.O. - KAMI, DISTT - SONEPAT
4306 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
4307 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
4308 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
4309 PUTHIYAPATHAIFOUNDATION 2/54A TRICHY ROAD RANGANATHAPURAM SULUR COIMBATORE
4310 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
4311 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
4312 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
4313 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
4314 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
4315 QUANTUM GLOBAL INFRATECH LTD N1 / 150, IRC VILLAGE, NAYAPALLI, BHUBANESHWAR, ODISHA
4316 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
4317 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
4318 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
4319 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
4320 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
4321 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
4322 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
4323 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
4324 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
4325 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
4326 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
4327 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
4328 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
4329 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
4330 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
4331 RAGHAVS FOUNDATION 10-3-444/120A, P.S.NAGAR, VIJAY NAGAR COLONY, HYDERABAD
4332 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
4333 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
4334 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
4335 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
4336 RAHI SHIKSHAN SANSTHA RAHI ESTATE, AHILYA NAGAR JAITALA ROAD, NAGPUR
4337 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
4338 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
4339 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4340 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
4341 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
4342 RAINBOW COMPUTER SHIKSHA SAMITI IIND FLOOR AMAN BUILDING OPP. HDFC BANK , COURT ROAD, SAHARANPUR
4343 RAINBOW COMPUTER SHIKSHA SAMITI IIND FLOOR AMAN BUILDING COURT ROAD OPP. HDFC BANK, SAHARANPUR
4344 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
4345 RAJA BARIAR EDUCATIONAL WELFARE TRUST VILL-P.O - DOMA VIA KHUSRUPUR DIST-PATNA BIHAR
4346 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4347 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4348 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
4349 RAJARAM MEMORIAL EDUCATIONAL WELFARE SOCIETY VILLAGE AND POST DAHGAWAN TEHSIL SAHASWAN DISTRICT BUDAUN
4350 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
4351 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
4352 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
4353 RAJASTHAN SHIKSHAN PARSHIKSHAN SANSTHAN 77 VIDHYA VIHAR, BEHIND CHETALI ENCLAVE, 5 E CHHOTI
4354 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
4355 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
4356 RAJDHANI EDUTECH ENTERPRISES EW-07,INDRAPRASTH RDA COLONY,RAIPURA,RAIPUR,CHHATISGARH
4357 RAJ DURAST SHIKSHA WARD NO-10 CHIDASARA POST-LOSAL TEH-DANTARAMGARH SIKAR RAJASTHAN
4358 RAJ DURAST SHIKSHA WARD NO-10 CHIDASARA POST-LOSAL TEH-DANTARAMGARH DIST.-SIKAT
4359 RAJ DURAST SHIKSHA WARD NO-10 CHIDASARA POST-LOSAL TEH-DANTARAMGARH DIST-SIKAR
4360 RAJ DURAST SHIKSHA NGO WARD NO-10 CHIDASARA BHIMA TEH.-DANTARAMGARH DIST.-SIKAR RAJASTHAN-332025
4361 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
4362 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHIITWAPUR ROAD, LALKUAN, HUSSAINGANJ, LUCKNOW (U.P) - 226001
4363 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P) - 226001
4364 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P)
4365 RAJEEV GANDHI COMPUTER PRASAR MISSION SANSTHAN RAJEEV GANDHI COMPUTER PRASAR MISSION SANSTHAN REGD. OFFICE - WARD NO 29, BATWALO KA MOHALLA, JHUNJHUNU (RAJ.)-333001 HEAD OFFICE-NEAR KHAN STONE COMPANY-MANDRELLA, TEHSIL –CHIRAWA, DISTT. - JHUNJHUNU (RAJ.)-333025
4366 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
4367 RAJEEV INDUSTRIAL TRAINING AND RESEARCH INSTITUTE 22(A), STATION ROAD OPPOSITE VIKAS DEEP BUILDING,HUSAIN GANJ LUCKNOW
4368 RAJEEV RATNA ADIWASI MAHILA EVM PARYAVARAN VIKAS SANSTHAN M G ROAD SHUJALPUR MANDI NEAR RAILWAY STATION SHUJALPUR
4369 RAJEEV RATNA ADIWASI MAHILA EVM PARYAVARAN VIKAS SANSTHAN MG ROAD SITARAM BUILDING SHUJALPUR MANDI
4370 RAJEEV RATNA ADIWASI MAHILA EVM PARYAVARAN VIKAS SANSTHAN MG ROAD SHUJALPUR MANDI DISST SHAJAPUR
4371 RAJE SAMBHAJI PRATISHTHAN SANCHALIT SAMBHAJI RAJE MANAGEMENT SCIENCE COLLEGE SHIRUR KASAR MAIN ROAD SHIRUR KASAR TQ SHIRUR KASAR DIST BEED MAHARASHTRA
4372 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
4373 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
4374 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
4375 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
4376 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
4377 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
4378 RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE BSNL RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTRE,BSNL , GST ROAD MINAMBAKKAM ,CHENNAI
4379 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
4380 RAJKUMAR GANDHI EDUCATION SOCIETY BLOCK B-1 OM PARISAR ARYA NAGAR DURG
4381 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
4382 RAJLAXMI SOLUTIONS PRIVATE LIMITED UNIT NO. 203 TO 207, 2ND FLOOR, VARDHAMAN INDUSTRIAL COMPLEX, GOKUL NAGAR, MUMBAI MUMBAI CITY MH 400601
4383 RAJ SHREE 787
4384 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
4385 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
4386 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
4387 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
4388 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
4389 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, SECTOR-10, DWARKA
4390 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, MANISH PLAZA III, SECTOR-10, DWARKA, NEW DELHI
4391 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
4392 RAM MORADABAD
4393 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
4394 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
4395 RAMAKRISHNA MISSION RAMAKRISHNA MISSION VIDYALAYA INDUSTRIAL TRAINING INSTITUTE, (A BRANCH CENTRE OF RAMAKRISHNA MATH AND RAMAKRISHNA MISSION, BELUR MATH, HOWRAH, WEST BENGAL) SRI RAMAKRISHNA VIDYALAYA POST, PERIYANAICKENPALAYAM, COIMBATORE
4396 RAMAKRISHNA MISSION VIDYALAYA RAMAKRISHNA MISSION VIDYALAYA , (A BRANCH CENTRE OF RAMAKRISHNA MATH AND RAMAKRISHNA MISSION, BELUR MATH, HOWRAH, WEST BENGAL) SRI RAMAKRISHNA VIDYALAYA POST, PERIYANAICKENPALAYAM, COIMBATORE
4397 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
4398 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
4399 RAMAN TRADERS 10D, DEVDHARA COLONY, MURLIPURA JAIPUR
4400 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
4401 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
4402 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
4403 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
4404 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL
4405 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL,
4406 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
4407 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
4408 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT GHAZIPUR
4409 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT SUBHASH NAGAR GHAZIPUR UP 233001
4410 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT GHAZIPUR
4411 RAMKY ENCLAVE LIMITED RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN RAOD,SOMAJIGUDA,HYDERABAD,TELANGANA
4412 RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN ROAD,SOMAJIGUDA,HYDERABAD,TELANGANA,INDIA
4413 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
4414 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
4415 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
4416 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
4417 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
4418 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
4419 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
4420 RAMRAJ SHIKSHA PRASAR SAMITI PAHADI KUTGHAN ROAD SABALGARH DIST. MORENA MP
4421 RAM SARAN EDUCATIONAL SOCIETY 161/3A/A PURA FATEH MOHAMMAD ARAIL MORE NAINI ALLAHABAD
4422 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
4423 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
4424 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
4425 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
4426 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
4427 RANIDIH SEWA SAMITI VILAGE-RANIDIH POST-SARIYA,TECH-SARANGADH DIST-RAIGARH C.G.
4428 RANIDIH SEWA SAMITI VILLAGE-RANIDIH POST-SARIYA BLACK-BARAMKELA TCH-SARANGGARH,DIST-RAIGARH
4429 RANIDIH SEWA SAMITI VILLAGE-RANIDIH POST-SARIYA BLACK-BARAMKELA TCH-SARANGARH DIST-RAIGARH C.G.
4430 RANIDIH SEWA SAMITI VILLAGE-RANIDIH POST-SARIYA TCH-SARANGADH DIST-RAIGARGH
4431 RANKS DIGITAL MEDIA PRIVATE LIMITED G-20, 2ND FLOOR, SECTOR-63, NOIDA
4432 RANKS DIGITAL MEDIA PRIVATE LIMITED RDM CORPORATE OFFICE, 2ND FLOOR, G-20, SECTOR - 63, NOIDA, UP.
4433 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
4434 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
4435 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD VILL-RASULLAPUR,P.O-DEWLI,P.S-CHAKDAHA,DIST-NADIA,PIN-741222
4436 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA
4437 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,CHAKDAHA,NADIA
4438 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA,WEST BENGAL
4439 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
4440 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
4441 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
4442 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.-DURG
4443 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG C.G.
4444 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
4445 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
4446 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
4447 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG (C.G.)
4448 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
4449 RASTRIYA BAL VIKAS SAMITI W-1,127/2,2ND FLOOR, MANGLAM COMPLEX SAKET NAGAR
4450 RASTRIYA MANAV VIKAS SAMITI SHIV KRIPA COMPLEX OPP. PWD OFFICE AGRA ROAD DAUSA(RAJ)
4451 RASTRIYA SAMAJIK UTTHAN SANSTHAN KHAJURI KHAJURI,KUSHAL GARH ROAD TEHSIL THANDLA DISTRICT JHABUA M.P.457777
4452 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
4453 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE, BESIDE JAISWAL PETROL PUMP, RATU ROAD, RANCHI
4454 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE BESIDE JAISWAL PETROL PUMP RATU ROAD RANCHI
4455 RATNADEEP CONSULTANTS PVT LTD SHREE RAMJEE ARCADE BESIDES JAISWAL PETROL PUMP RATU ROAD RANCHI
4456 RATNADEEP COUNSULTANT PVT LTD RATNDEEP CONSULTANTS PVT LTD, ABOVE IDBI BANK, SHREE RAMJEE ARCADE , RATU ROAD, RANCHI
4457 RAVI EDUCATION SOCIETY VPO ATELA KALAN
4458 RAVI EDUCATION SOCIETY VPO ATELA KHURD
4459 RAVI EDUCATION SOCIETY VPO ATELA KALAN
4460 RAVI EDUCATION SOCIETY VPO ATELA KALAN, CH DADRI, HARYANA
4461 RAVI EDUCATION SOCIETY VPO ATELA KHURD
4462 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
4463 RAVINDRA FOUNDATION 702/1, CIVIL LINES, JHANSI
4464 RAVINDRA FOUNDATION 702/1, CIVIL LINES JHANSI
4465 RAVINDRA FOUNDATION 702/1, CIVIL LINES JHANSI
4466 RAVI RISHI EDUCATIONAL SOCIETY G2, SBI COLONY, BAGH AMBERPET, HYDERABAD
4467 RAWABI TOURS AND TRAVEL PRIVATE LIMITED NO. 5/631, G-1, 1ST FLOOR, B & S BUILDING, NEAR PASSPORT OFFICE, BYPASS ROAD, ERANJIPALAM, CALICUT
4468 RAYAPPAN MARIYAPUSHPAM EDUCATIONAL AND PUBLIC CHARITABLE TRUST D-97, 9TH CROSS (WEST), THILLAI NAGAR, TRICHY-620 018
4469 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA ,SATARA KARMAVEER SAMADHI PARISAR NEAR POWAI NAKA SATARA (MAHARASHTRA )
4470 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA, SATARA KARMAVEER SAMADHI PARISAR, NEAR POWAI NAKA, SATARA (MAHARASHTRA)
4471 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
4472 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
4473 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
4474 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
4475 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
4476 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
4477 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4478 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
4479 REAL EDUCATION TRUST 24, 25 VISHRAMNAGAR, OPP AKHAND ANAND SCHOOL, VED ROAD,SURAT.
4480 REAL EDUCATION TRUST 24,25 VISHRAM NAGAR, OPP. AKHAND ANAND SCHOOL, VED ROAD, SURAT.
4481 REAL EDUCATION TRUST 45, VIJAYRAJ RAW HOUSE,SINGANPOR CAUSEWAY ROAD,SURAT
4482 REAL EDUCATION TRUST 45, VIJAYRAJ RAW HOUSE,SINGANPOR CAUSEWAY ROAD,SURAT
4483 REAL REVOLUTION MARKETING PRIVATE LIMITED B-32, MAHESH NAGAR, TONK PHATAK, JAIPUR
4484 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
4485 REBIRTH EDUCATION AND RESEARCH FOUNDATION 3RD FLOOR, MARUTINANDAN COMPLEX, OPP G D HIGH SCHOOL, VISNAGAR
4486 RED CRESCENT FOUNDATION 275,VELLIMALAYAN II STREET, KALAIVANAR NAGAR,OPPOSITE TO CANARA BANK, ALANGANALLUR,MADURAI DIST, TAMILNADU
4487 REFLECTIONS LEATHERS PRIVATE LIMITED 226/1 , SAFIPUR FIRST SUBHASH ROAD ,HARJENDER NAGAR ,KANPUR-208007
4488 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
4489 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
4490 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
4491 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
4492 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
4493 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
4494 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
4495 REKHA SOCIETY DGGHDGHSH
4496 RELIABLE FIRST ADCON PRIVATE LIMITED 412-422, FOURTH FLOOR, DEVNANDAN MALL, OPP : SANYAS ASHRAM, NR- M. J. LIBRARY, AHMEDABAD
4497 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
4498 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
4499 RELISYS MEDICAL DEVICES LIMITED SURVEY NUMBER 312 MANGALPALLY POCHARAM ROAD IBRAHIMPATNAM RANGAREDDY TELANGANA 501510
4500 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
4501 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
4502 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
4503 RESCUE SKILLS PRIVATE LIMITED MUNICIPAL COMPLEX UPSTAIRS, OLD BUS STAND, ULAVAR SANDHAI, KARUR
4504 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
4505 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
4506 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR
4507 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR DIST-CHHATARPUR (M.P.)
4508 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
4509 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
4510 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
4511 RESOURCE MANAGEMENT AND SOCIAL WELFARE TRUST B-5, 101 AMRAPALI TITANIUM PLATINUM CAMPUS
4512 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
4513 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
4514 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
4515 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
4516 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
4517 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
4518 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
4519 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
4520 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
4521 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
4522 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
4523 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
4524 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
4525 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
4526 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
4527 RISHABHDEV EDUCATION AND RESEARCH INSTITUTE 5, INDRALOK APARTMENT, NEAR MOTIBAG CHOWK, CIVIL LINES, RAIPUR, CHHATISHGARH
4528 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
4529 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
4530 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
4531 RIT EDUCATION AND WELFARE SOCIETY KOTA 2 THA 35 VIGYAN NAGAR KOTA RAJASTHAN
4532 RIT EDUCATION AND WELFARE SOCIETY KOTA 2 THA 35, VIGYAN NAGAR , KOTA ( RAJASTHAN )
4533 RIT EDUCATION AND WELFARE SOCIETY KOTA HOUSE NO.2-TH-35,VIGYAN NAGAR, KOTA
4534 RJ RJ
4535 R J EDUCATIONAL TRUST H. NO. 62, BYLANE 4, DISPUR BASISTHA ROAD, BELTOLA,GUWAHATI
4536 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
4537 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
4538 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
4539 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
4540 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
4541 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
4542 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
4543 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
4544 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
4545 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
4546 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
4547 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
4548 R N K EDUCATIONAL SOCIETY TAKSHSHILA GROUP OF INSTITUTIONS SHARDA MANDIR ROAD SHARDA CHOWK MADAN MAHAL JABALPUR
4549 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
4550 ROHSTOFFE INTERNATIONAL PRIVATE LIMITED 1304, REGENT CHAMBERS, JAMNALAL BAJAJ ROAD, NARIMAN POINT
4551 ROJGAR MARGDARSHAN AVAM SWAROJGAR PRASHIKSHAN SANSTHAN NEAR NEW BUS STAND,SHARDAPURAM,P.O. BANSAGAR COLONY,REWA (M.P.)486001
4552 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
4553 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
4554 ROSHNI NATIONAL SEWA GRAMUDYOG SANSTHAN MOH KULHAN SARAIN, POST KHAIRABAD
4555 ROUNAK ALPASANKHYANK BAHUUDDESHIY SHIKSHAN SANSTHA DREAMS TECHNOLOGY, DR. ZAKIR HUSSAIN WARD, NEAR WATER TANK, BHANDARA
4556 ROYAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY H.NO. - 347 INSAF NAGAR INDIRA NAGAR
4557 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
4558 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
4559 ROYAL WINGS AUTO PRIVATE LIMITED NO.73,& 74 THIRUMALI STREET VEERAPANCHATRAM, ERODE
4560 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
4561 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
4562 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
4563 RPEDUCATIONALTRUST PLOT-44,NEAR GANPATI MANDIR,SHASTRI NAGAR,VASAI (W),PALGHAR
4564 R P EDUCATIONAL TRUST PLOT NO. 44, SHASTRI NAGAR, NEAR GANPATI MANDIR, VASAI WEST, DIST PALGHAR
4565 R P EDUCATIONAL TRUST PLOT NO, 44, SHASTRI NAGAR, NEAR GANPATI MANDIR, VASAI (W) DIST PALGHAR
4566 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
4567 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
4568 R S ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR
4569 RS ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR RAJASTHAN
4570 RSESK SOCIETY MAHENDRU
4571 RSM FINSERV LTD B-2/68,MOHAN CO-OPERATIVE INDUSTRIAL AREA,PHASE-2, BADARPUR,NEW DELHI
4572 RS VERMA EDUCATION SOCIETY GANESH BAG SHIVPURI RAYA(MATHURA)
4573 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
4574 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
4575 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
4576 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
4577 RUBBER BOARD P.B.NO:1122,KOTTAYAM-2,KERALA,INDIA
4578 RUBBER TRAINING INSTITUTE RUBBER TRAINING INSTITUTE, RUBBER BOARD P O, KOTTAYAM, KERALA
4579 RUBIX ADVISORY 196, SIRASPUR, DELHI
4580 RUBIX ADVISORY LLP 196, SIRASPUR, DELHI
4581 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
4582 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
4583 RUDRA DEVELOPMENT FOUNDATION VILL GAIGHATA
4584 RUGMARK FOUNDATION C-3A/86-C, JANAKPURI
4585 RUGMARK FOUNDATION C-3A/86-C, JANAKPURI, DELHI
4586 RUNGTA EDUCATIONAL SOCIETY RUNGTA KNOWLEDGE CITY, KOHKA KURUD ROAD, BHILAI
4587 RUNGTA EDUCATIONAL SOCIETY RUNGTA EDUCATIONAL CAMPUS, KOHKA KURUD ROAD, BHILAI
4588 RUNGTA INFOTECH SYSTEMS PRIVATE LIMITED RUNGTA KNOWLEDGE CITY KOHKA KURUD ROAD BHILAI
4589 RUNGTA INFOTECH SYSTEMS PRIVATE LIMITED RUNGTA KNOWLEDGE CITY, KOHKA KURUD ROAD BHILAI
4590 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
4591 RUPSHRI MAHILA VIKAS SANSTHA AT KALDARE POST UCHHIL TAL JUNNAR DIST PUNE 410502
4592 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
4593 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
4594 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
4595 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
4596 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
4597 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
4598 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
4599 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
4600 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
4601 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
4602 RURAL DEVELOPMENT ASSOCIATION RURAL DEVELOPMENT ASSOCIATION 103A/3 AVALURPET ROAD AMBETHKAR SECOND STREET TIRUVANNAMALAI
4603 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
4604 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
4605 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
4606 RURAL EDUCATION AND ACTION FOR CHANGE RURAL EDUCATION AND ACTION FOR CHANGE NUNGOUROK VILLAGE,DISTRICT:CHANDEL, BLOCK:MACHI,P.O.PALLEL MANIPUR 795135
4607 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4608 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
4609 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4610 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
4611 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
4612 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
4613 RURAL EDUCATION DEVELOPMENT SOCIETY NEAR MEGHA HIGHWAY ROAD, VILLAGE - BADELA
4614 RURAL EDUCATION DEVELOPMENT SOCIETY NEAR MEGHA HIGHWAY ROAD, VILLAGE - BADELA
4615 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
4616 RURAL FOUNDATION HEAD OFFICE: DULARI DHAM, NEAR KISAN SEWA ASHRAM, AHROULI MOD, POKHRAYAN,KANPUR DEHAT-209111-UTTAR PRADESH
4617 RURAL FOUNDATION 51 A, UTSAV PART I, MAHANAGAR COLONY BAREILLY, UTTAR PRADESH-243122
4618 RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY REGISTERED OFFICE HOUSE NO. 54-140,WARD NO.-60 SONKARBADI,DAGNIYA DIST RAIPUR- 492001 C.G. ADMINISTRATIVE OFFICE RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY (RICES) OLD SARANGARH BUS STAND BEHIND KANHA HOSPITAL WARD NO. 31 RAIGARH 496001 C.G. FOR ENQUIRY – 07762 - 222569/215448, 9522223698, 9329057958 EMAIL - SUPPORT@RICEEDU.ORG , ADMIN@RICEEDU.ORG WEBSITE:-WWW.RICEEDU.ORG
4619 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
4620 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
4621 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
4622 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
4623 RYFE FUNDAMENTALS OPC PRIVATE LIMITED FL 5, SECT G, SHREENAGARI, AKURDI, PUNE, MAHARASHTRA
4624 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
4625 SAATIVIK KARMA RESEARCH FOUNDATION F-412 VILLAGE & POST OFFICE GHITORINI NEW DELHI
4626 SAATIVIK KARMA RESEARCH FOUNDATION F-412, VILLAGE & POST OFFICE GHITORINI NEW DELHI
4627 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
4628 SABANG CHAK VIVEKANANDA WELFARE SOCIETY AT + P.O. + P.S. - SABANG, DIST - PASCHIM MEDINIPUR
4629 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
4630 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
4631 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
4632 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
4633 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR (UK) 247667
4634 SABZAR SOCIAL WELFARE SOCIETY PARRY SHOPPING COMPLEX NEAR RAZVI STOP MAGAM ( JAMMU & KASHMIR)
4635 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
4636 SACHKHAND SEWA SAMITI DUNGARIYA 280 PATWARI COLONY ALIPUR ASHTA
4637 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
4638 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
4639 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
4640 SADGUNA TECHNOLOGIES NAIMNAGAR
4641 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
4642 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
4643 SADHANA EDUCATIONAL SOCIETY 1-7-885, HUNTER ROAD HANAMKONDA WARANGAL TELANGANA
4644 SADHU SARAN SINGH SKILL TRAINING CENTRE PRIVATE LIMITED C/O RAUSHAN RAJ,WARD NO-11,DUMARI BUZURG,SARAN,BIHAR
4645 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
4646 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
4647 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
4648 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
4649 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
4650 SAFDSF SADFASD
4651 SAFE TOWERS PRIVATE LIMITED GROUND FLOOR, PLOT NO-65, POCKET-1, JASOLA VIHAR, NEW DELHI-110025
4652 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY, INDORE
4653 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY INDORE
4654 SAGE SUSTAINABLE APPROACH FOR GREEN ENVIRONMENT LLP 205, SECOND FLOOR, BHAVANI INDUSTRIAL ESTATE, OPP. IIT BOMBAY MAIN GATE, POWAI, MUMBAI
4655 SAHAJ FOUNDATION 561/31 SINDHU NAGAR, KRISHNA NAGAR, LUCKNOW
4656 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
4657 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
4658 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
4659 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
4660 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
4661 SAHARA COMPUTER EDUCATION H NO 1-5-129 DIAMOND TEXTILE COMPLEX 2ND FLOOR MAIN ROAD OPP BSNL OFFICE ZAHEERABAD DIST SANGAREDDY, TELANGANA 502220
4662 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-125 DIAMOND TEXTILE COMPLEX 2ND FLOOR OPP BSNL OFFICE MAIN ROAD ZAHEERABAD, DIST SANFAREDDY. TELANGANA. 502220
4663 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
4664 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
4665 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
4666 SAHASRA ELECTRONICS PRIVATE LIMITED 129-G, N.S.E.Z, NOIDA
4667 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
4668 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
4669 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
4670 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
4671 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
4672 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4673 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4674 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4675 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
4676 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
4677 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
4678 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
4679 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
4680 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
4681 SAHYADHRI LOGISTICS PRIVATE LIMITED 7, LOHA BHAVAN, P.D MELLO ROAD, CARNAC BUNDER, MUMBAI
4682 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
4683 SAHYADRI SHIKSHAK EDUCATION SANGHA SHIRGAON A/P SHIRGAON, TAL - DEVGAD, DIST - SINDHUDURG, 416610
4684 SAHYADRI SHIKSHK EDUCATION SANGHA SHIRGAON AT POST SHIRGAONTAL DEVGAD DIST SINDHUDURG
4685 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
4686 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
4687 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
4688 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
4689 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
4690 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
4691 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
4692 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
4693 SAIDEEP WELFARE SOCIETY VILL: DAMDAMIA, P.O. LEMBUCHERRA
4694 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
4695 SAI DHAM FOUNDATION 158, JODHPUR GARDEN, KOLKATA
4696 SAI DHAM FOUNDATION 158, JODHPUR GARDEN, KOLKATA 700045
4697 SAI DHAM FOUNDATION DAMINI SOCIETY JUHU MUMBAI, MAHARASHTRA
4698 SAI DHAM FOUNDATION 158, JODHPUR GARDEN, KOLKATA
4699 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
4700 SAIFI HEALING TOUCH RESEARCH BUREAU FOR SOCIAL WELFARE OF INDIA NEAR JAMIA MASJID SURANKOTE POONCH JAMMU AND KASHMIR
4701 SAIFI HEALING TOUCH RESEARCH BUREAU FOR SOCIAL WELFARE OF INDIA NEAR JAMIA MASJID SURANKOTE POONCH
4702 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
4703 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
4704 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
4705 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
4706 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
4707 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
4708 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
4709 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
4710 SAINT MARGARET EDUCATION SOCIETY D - BLOCK PRASHANT VIHAR DELHI
4711 SAINT MARGARET EDUCATION SOCIETY D - BLOCK PRASHANT VIHAR DELHI
4712 SAINT MARGARET EDUCATION SOCIETY D BLOCK PRASHANT VIHAR , DELHI
4713 SAINT MARGARET EDUCTION SOCIETY D-BLOCK , PRASHANT VIHAR, DELHI
4714 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4715 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4716 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
4717 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
4718 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4719 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4720 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
4721 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
4722 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
4723 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
4724 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
4725 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
4726 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
4727 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
4728 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
4729 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
4730 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
4731 SAJAR HEALTH EDUCATIONAL AND CHARITABLE TRUST 52, VAIGAI STREET, VELMURUGAN NAGAR, BYPASS ROAD, MADURAI
4732 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
4733 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
4734 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
4735 SALLY THERMOPLASTICS INDIA LIMITED SECOND FLOOR NO 32 FIRST MAIN ROAD BALAJINAG EKATTU THANGAL TAMILNADU CHENNAI
4736 SALLY THERMOPLASTICS PRIVATE LIMITED SECOND FLOOR NO 32, FIRST MAIN ROAD BALAJI NAGAR EKKATUTHANGAL TAMILNADU CHENNAI-600032
4737 SALLY THERMOPLASTICS PRIVATE LIMITED NO.32,2ND FLOOR, FIRST MAIN ROAD, BALAJI NAGAR, EKATTU THANGAL, CHENNAI
4738 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
4739 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
4740 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
4741 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
4742 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
4743 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
4744 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
4745 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
4746 SAMAGRA SAMAJIK NAITIK VIKAS SANSTHAN 060338 GOUTAM COMPLEX GOUTAM MADHIYA KACHHPURA BRIDGE GARHA JABALPUR MADHYA PRADESH
4747 SAMAJ DIVA INSTITUTE OF FASHION DESIGN OPPOSITE RADHA KARISHAN MANDIR, OLD BUS STAND, PALAMPUR, DISTT KANGRA ( H.P.) 176061
4748 SAMAJ DIVA INSTITUTE OF FASHION DESIGNING, OPPOSITE RADHA KARISHAN MANDIR, OLD BUS STAND , PALAMPUR, DISTT KANGRA (H.P.)
4749 SAMAJ DIVA INSTITUTE OF FASHION DESIGNING, OPPOSITE RADHA KARISHAN MANDIR , OLD BUS STAND, PALAMPUR , DISTT . KANGRA (H.P.)
4750 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
4751 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
4752 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
4753 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
4754 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
4755 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
4756 SAMARITAN HELP MISSION 127 NOOR MD. MUNSHI LANE
4757 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
4758 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
4759 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
4760 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
4761 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
4762 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
4763 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
4764 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
4765 SAMARTH EDUSKILLS PVT LTD GD-ITL TOWER,706,B09 GDITL TOWER,NETAJI SUBASH PLACE,PITAMPURA,DELHI-110034
4766 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR, RAJASTHAN
4767 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR
4768 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
4769 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
4770 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
4771 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
4772 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
4773 SAMBAL SIKHASAN SANSTHAN SHIVSINGHPURA SIKAR
4774 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
4775 SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI, VINAYAK NAGAR DARRASHIVPURI NEAR INFANT PUBLIC SCHOOL SAHARANPUR PIN: 247001
4776 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
4777 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
4778 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
4779 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
4780 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
4781 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
4782 SAMRIDHI SOCIETY 235 SARAI SULTANI ALIGARH
4783 SAMRUDDHI GRAMEENABHIVRUDHI SAMSTHE NO 66, GANESH LAYOUT, GOVERNMENT HOSPITAL PARALLEL ROAD, MAGADI TOWN, MAGADI
4784 SAMRUDDHI GRAMEENABHIVRUDHI SAMSTHE NO.66, GANESH LAYOUT, GOVERNMENTHOSPITAL PARALLEL ROAD, MAGADI TOWN, RAMANAGAR DISTRICT
4785 SAMRUDDHI RURAL DEVELOPMENT SOCIETY NO. 66, GOVERNMENT HOSPITAL PARALLEL ROAD, GANESH LAYOUT, MAGADI TOWN MAGADI RAMANAGARA DISTRICT.
4786 SAMRUDDHI RURAL DEVELOPMENT SOCIETY NO, 66, GANESH LAYOUT, GOVERNMENT HOSPITAL PARALLEL ROAD, MAGADI TOWN, 562120
4787 SAMRUDDHI RURAL DEVELOPMENT SOCIETY NO. 66, GOVERNMENT HOSPITAL PARALLEL ROAD, GANESH LAYOUT, MAGADI TOWN, MAGADI, RAMANAGARA DISTRICT
4788 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
4789 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
4790 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
4791 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9,LALA LAJPAT RAI COLONY,ASHOKA GARDEN,RAISEN ROAD,BHOPAL
4792 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4793 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
4794 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
4795 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
4796 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
4797 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
4798 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
4799 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
4800 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
4801 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
4802 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
4803 SANDEEP TEST ASDASDASD
4804 SANDESH MNGO INDIA INDIA 1 INDORE
4805 SANDIP FOUNDATION POST MAHIRAVANI, TRIMBAK ROAD NASIK MHARASTRA
4806 SANDIP FOUNDATION 2ED FLOOR KOTESHWAR PLAZA JN ROAD MULUND MUMBAI
4807 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
4808 SANGAM EDUCATIONAL AND WELFARE SOCIETY MEHARIAN BAZAR, SABZI MANDI, FAZILKA
4809 SANGAMESHWAR WOMENS GARMENT MANUFACTURERS SOCIETY PATIL PLAZA COMPLEX FIRST FLOOR CCG NO 9-587 OPP SHETTY COMPLEX ALAND ROAD KALBURGI
4810 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
4811 SANGFORD EDUCATIONS PRIVATE LIMITED SANGFORD EDUCATIONS PVT LTD, KANCHIPURAM-VANDAVASI ROAD, 109-ABDULLAPURAM, VEMBAKKAM TALUK, TIRUVANNAMALAI DIST
4812 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
4813 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
4814 SANGMESHWAR EDUCATIONAL TRUST REGD #142, SECTOR 07, URBAN ESTATE, KURUKSHETRA-136118, HARYANA
4815 SANGMESHWAR EDUCATIONAL TRUST REGD HOUSE NUMBER 142 SECTOR 07 URBAN ESTATE KURUKSHETRA HARYANA
4816 SANIDHYA SKILL DEVELOPMENT PRIVATE LIMITED 403, PALTINUM PLAZA, ABOVE ICICI BANK, STATION ROAD, NADIAD
4817 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
4818 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
4819 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
4820 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
4821 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
4822 SANKALP SAMAJIK VIKAS SANSTHAN F-80 AAKRITI ECO CITY, BAWADIAKALAN BHOPAL
4823 SANKALP SAMAJIK VIKAS SANSTHAN F-80 AAKRITI ECO CITY BAWADIAKALAN BHOPAL
4824 SANKALP SEWA SANSTHAN A-389, VIJAY SINGH PATHIK NAGAR BHILWARA, RAJASTHAN.
4825 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
4826 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
4827 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
4828 SANKHLA VINYL PVT LTD 126 7TH MAIN 3RD PHASE PEENYA INDUSTRIAL AREA
4829 SANSAR FOUNDATION SANSAR FOUNDATION, 3RD FLOOR, AMJ BUSINESS PARK, VIJAYA ROAD, NEXT TO CBT, DHARWAD
4830 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
4831 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
4832 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
4833 SANSKRITI SAMVARDHAN MANDAL SHARDANAGAR SAGROLI DIST. NANDED
4834 SANSKRITI SHIKSHA SAMITI JILA SAHAKARI BANK PARISAR CHOUBEY COLONY RAIPUR C.G.
4835 SANSKRITI SHIKSHA SAMITI JILA SAHAKARI BANK PARISAR CHOUBEY COLONY RAIPUR C.G.
4836 SANT ASHWA SHIKSHAN SAMITI 10 RASHMI PATHOLOGY LEB NEAR OF ABHISEK TAKIZ PANDHANA ROAD KHANDWA
4837 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE
4838 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE KHANDWA
4839 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
4840 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
4841 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
4842 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
4843 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
4844 SANT RAVIDAS CHARMKAR KALYAN SAMITI FLAT NO 8L/120 BAHADURPUR HOUSING COLONY NEAR AGAM KUAN THANA PATNA BIHAR
4845 SANT SHIROMANI MANAV SEWA SAMITI NEAR RAILWAY STATION DEVI DAI MOHALLA DAGA VILLAGE DAGA POST DAGA BARGAWAN TEHSIL DEOSAR DISTRICT SINGRAULI MP
4846 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU DIST DHOLPUR RAJASTHAN
4847 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU
4848 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU DISTRICT DHOLPUR RAJASTHAN
4849 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
4850 SAP INTEGRATED SECURITY AND IT SERVICES PRIVATE LIMITED B-544. POCKET-11, JASOLA VIHAR, NEW DELHI-110025
4851 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
4852 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
4853 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
4854 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
4855 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
4856 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
4857 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
4858 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
4859 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
4860 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD, SIWAN BIHAR
4861 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR ,BEHIND TUN TUN BABU PETROL PUMP,BANSEL BUILDING,CHAPRA ROAD,SIWAN ,BIHAR
4862 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR ,NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD,SIWAN
4863 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR, NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD, SIWAN
4864 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,BEHIND UMASHANKAR SINGH PETROL PUMP,NEAR IDBI BANK,CHAPARA ROAD,SIWAN ,BIHAR
4865 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
4866 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
4867 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE- VILLAGE/POST- MADANPURA, TEH- RAMGANJMANDI, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN. CORP. OFFICE- SHREE NATH CAMPUS, NEAR GAYTRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRAPURA, CHECHAT, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN
4868 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE - VILLAGE/POST- MADANPURA, TEH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN CORP.OFFICE - SHREE NATH CAMPUS, NEAR GAYATRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRPURA, CHECHAT, TH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN
4869 SARASWATII GLOBAL PRIVATE LIMITED SARASWATII GLOBAL PVT LTD. 3 GANESH COLONY,BEHIND GOLIMAR GARDEN,AMER ROAD
4870 SARASWATII GLOBAL PRIVATE LIMITED SARASWATII GLOBAL PVT LTD. 3 GANESH COLONY, AMER ROAD, JAIPUR-302002 INDIA
4871 SARASWATII GLOBAL PRIVATE LIMITED 3 GANESH COLONY, BEHIND GOLIMAR GARDEN, AMER ROAD, JAIPUR(RAJ.)
4872 SARASWATI INSTITUTIONS OF COMPUTER EDUCATIONAL SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX LAWRENCE ROAD
4873 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
4874 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
4875 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
4876 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
4877 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
4878 SARA WELFARE TRUST CHAKCHANDAN
4879 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST VILLAGE 13 Q, TEHSIL & DISTRICT SRI GANGANAGAR (RAJ.)
4880 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST P.S. BHATIA COMPLEX, PLOT NO.- 22, NEAR MAIN BUS STAND, SRIKARANPUR
4881 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST VILLAGE 13 Q, TEHSIL & DISTRICT SRI GANGANAGAR (RAJ.)
4882 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST P.S. BHATIA COMPLEX, PLOT NO.- 22, NEAR MAIN BUS STAND, SRIKARANPUR
4883 SARDAR MOHAN SINGH SAINI CHARITABLE TRUST VPO 13 Q TEHSIL & DISTRICT SRIGANGANAGAR RAJASTHAN
4884 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
4885 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
4886 SARGURU SHIRIDII SYSTEMS PRIVATE LIMITED 43/P, KASTHURI NILAYAM, KAMARAJ STREET, GOVINDASALAI, PONDICHERRY
4887 SARISKA SEVA SANSTHAN 119,PARIVHAN NAGAR,SURYA NAGAR LINK ROAD,MANNA KA,ALWAR
4888 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
4889 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
4890 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
4891 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR, ARERA COLONY BHOPAL - 462016 MADHYA PRADESH , INDIA
4892 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR ,, ARERA COLONY, BHOPAL - 462016, MADHYA PRADESH, INDIA
4893 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4894 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGES CAMPUS DATODA KHANDWA ROAD, INDORE
4895 SARODINI SARASWATI SHIKSHA SAMITI SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS, VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4896 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
4897 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
4898 SAROJ GOPAL EDUCATIONAL SOCIETY VILLAGE - MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI, CHHATTISGARH
4899 SAROJ GOPAL EDUCATIONAL SOCIETY MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI
4900 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
4901 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
4902 SARSWATICHANDRA FOUNDATION TRUST SARSWATICHANDRA FOUNDATION TRUST 268C, MAIN ROAD, HMT LAYAUT RT NAGAR, BANGALORE KARNATAKA 560032
4903 SARSWATI EDUCATION AND WALFARE SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX, LAWRENCE ROAD, JALALABAD-WEST
4904 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
4905 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
4906 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
4907 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
4908 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
4909 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
4910 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4911 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4912 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
4913 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
4914 SARTHAK YUVA CHETNA SANGHATHAN 14/5, SCHEME 6, GANDHI NAGAR, JIND
4915 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
4916 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
4917 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
4918 SARVAJANIK JANKALYAN PARMARTHIK NYAS SARVAJANIK JANKALYAN PARMARTHIK NYAS E-3/27-A, ARERA COLONY, BHOPAL MADHYA PRADESH - 462016
4919 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
4920 SARVA SHIKSHA EVAM ROZGAR PARISHAD CHARITABLE TRUST ZIMT BUILDING SCF 26/27 OPP PAPIHA PARK, MODEL TOWN FATEHABAD, HARYANA
4921 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
4922 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
4923 SARVASIDDHANTA CHARITABLE TRUST B-17, MADHUBAN COLONY, TONK PHATAK, JAIPUR
4924 SARVHIT TRUST G-10, KRISHNA PLAZA, GARH ROAD, MEERUT, UTTAR PRADESH-250004
4925 SARVHIT TRUST G-10, KRISHNA PLAZA, GARH ROAD, MEERUT, UTTAR PRADESH-250004
4926 SARVHIT TRUST G-10, KRISHNA PLAZA, GARH ROAD, MEERUT, UTTAR PRADESH-250004
4927 SARVJAN KALYAN KENDRA H.NO. 245 RUDRAPUR , JAGATPURA RUDRAPUR UDHAM SINGH NAGAR U.K
4928 SARV JAN SARV DHARM HITAYE SEWA SAMITI F-164, KAMLA NAGAR, AGRA
4929 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4930 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4931 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
4932 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4933 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4934 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4935 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4936 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4937 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4938 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4939 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4940 SARVODAYA VINDHYA VIKAS SAMITI SARVODAYA VINDHYA VIKAS SAMITI GURH CHAURAHA, REWA MADHYA PRADESH
4941 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
4942 SARVODYA EDUCATIONAL TRUST 290 MAIN ROAD NEW PLOT JAMMU
4943 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
4944 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
4945 SARV SHRI MAA NARMADA SHIKHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALYAN SAGAR MP
4946 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
4947 SARV SHRI MAA NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALAN SAGAR
4948 SARV SHRI NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD, DEORI KALAN SAGAR MADHYA PRADESH
4949 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4950 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4951 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4952 SATBAHINI PUBLIC CHARITABLE TRUST SATBAHINI PUBLIC CHARITABLE TRUST, GOVIND BHAWAN, VEER KUNWAR SINGH PATH, AURANGABAD-824101 BIHAR
4953 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
4954 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
4955 SATHWAY ASSOCIATES LLP K-17, TOPLAND RESIDENCY, SADHU VASVANI ROAD, NEAR PARIJAT RESIDENCY, RAJKOT - 360005
4956 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
4957 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
4958 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
4959 SATMILE SATISH CLUB O PATHAGAR VILL-CHHAT ELAJAN, P.O.-ELAJANER KUTHI, DIST-COOCHBEHAR
4960 SATNAM KHADI GRAMODYOG SEWA SAMITI VILLAGE HARDASPUR POST DUBIHAN, GHAZIPUR, UTTAR PRADESH-
4961 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
4962 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
4963 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
4964 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO-110 BHUJGAON TALUKA AKRANI DIST NANDURBAR
4965 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
4966 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
4967 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
4968 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
4969 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
4970 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4971 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
4972 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4973 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
4974 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
4975 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
4976 SATYAMEV WELFARE FOUNDATION FORD COMPANY, NAVRATAN HATA, NEAR HONDA SHOWROOM, PURNEA- 854301 (BIHAR)
4977 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4978 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4979 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4980 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4981 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
4982 SATYAM GRAMA SANGHAM SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH.P.O CHERTHALA ALAPPUZHA KERALA
4983 SATYAM GRAMA SANGHAM SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH CHETHY.P.O, CHERTHALA
4984 SATYAM GRAMA SANGHAM CHERUVALLISSERIL, MARARIKULAM NORTH.P.O, CHERTHALA ALAPPUZHA KERALA
4985 SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH P O CHERTHALA ALAPPUZHA
4986 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
4987 SATYAM SKILLS CENTER VISHAKAPATNAM
4988 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
4989 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
4990 SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE 319/1 HAMIRPUR RAOD RATH DISTRICT HAMIRPUR U.P. 210431
4991 SAUMYA BEUTY PARLOUR AND TRAINING INSTITUTE MOHAL SAUMYA BEAUTY PARLOUR,POST RATH DISTT HAMIRPUR U.P
4992 SAUNIT GROUP OF STUDIES EDUCATIONAL SOCIETY 24/126, RUHAI MUHAL NEAR SANKAT HARAN MANDIR, AURAIYA
4993 SAUNIT GROUP OF STUDIES EDUCATIONAL SOCIETY 24/126, RUHAI MUHAL, NAR SANKAT HARAN MANDIR, AURAIYA
4994 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
4995 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
4996 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
4997 SAVE HELP AND DEVELOP H.NO- N7-11, DURTLANG ROAD, BAWNGKAWN, AIZAWL
4998 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
4999 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
5000 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
5001 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
5002 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
5003 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
5004 SBDA AT-GVBBGFHGFBFGB
5005 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
5006 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
5007 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
5008 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
5009 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
5010 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
5011 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
5012 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
5013 SBS FORESIGHT PVT LTD RZ 90 STREET NO. 2 VAISHALI COLONY NEAR PALAM-DABRI ROAD
5014 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
5015 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
5016 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45 H.G.B ROAD.
5017 SCHEDULED CASTE AND TRIBES EDUCATION ECONOMIC LIFE TRUST NO:189 SATHAKOIL 2ND STREET,ATHIPATTY, BOOTHIPURAM POST BODINAYAGANUR TALUK, THENI DISTRICT
5018 SCHEDULED CASTE AND TRIBES EDUCATION ECONOMIC LIFE TRUST 6-1-164 SATHAKOIL 2ND STREET,ADHIPATTI, BOOTHIPURAM,BODINAYAKKANUR,THENI
5019 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
5020 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
5021 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
5022 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
5023 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
5024 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
5025 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
5026 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
5027 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
5028 SCHOOL OF COMMUNITY SCIENCE AND TECHNOLOGY IIEST SHIBPUR DOWNING HALL WEST WING BOTANICAL GARDEN SHIBPUR HOWRAH
5029 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
5030 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
5031 SCL GLOBAL LOGISTICS INDIA PRIVATE LIMITED UNIT NO FF-C,ARMENIAN CENTRE.,OLD NO.71,NEW NO.94,ARMENIAN STREET,GEORGE TOWN,CHENNAI-600001
5032 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
5033 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
5034 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS,ETTUPADY ROAD,OPP.KARIMPIN TASTE LAND,NATTAKOM,KOTTAYAM-686012
5035 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPP. KARIMPIN TASTE LAND ,M C ROAD NATTAKOM
5036 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPPOSITE KARIMPIN TASTE LAND, MC ROAD, NATTAKOM
5037 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
5038 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
5039 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
5040 SECOND INNING HOUSE H. NO. 380, J J COLONY, BLOCK – D, DSIDC, BAWANA, NEW DELHI – 110039, INDIA.
5041 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
5042 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
5043 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
5044 SEED AND TREE CONSULTANTS PVT LTD T12, DOOR NO 2004, BLURIDGE TOWNSHIP, HINJEWADI,PUNE
5045 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
5046 SEEDS VENTURE SOCIETY 2M-69,MAHATMAGANDHI NAGAR,KANKARBAGH,PATNA
5047 SEEMANO GLOBAL SERVICES LLP 132, E-BLOCK EXTN., SHYAM VIHAR, PHASE-1, NAJAFGARH
5048 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
5049 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
5050 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
5051 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
5052 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
5053 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
5054 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
5055 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
5056 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
5057 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
5058 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
5059 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
5060 SERAPHIC IT SOLUTIONS A-501 NISHDIN AURA, MAHALAXMI NAGAR, INDORE CONTACT NO. 9644034142
5061 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
5062 SERVICE 2-18, RAJA PETA, MYLAVARAM, KRISHNA DT.
5063 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
5064 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
5065 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
5066 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST, NEAR GOVT. ITI., VENGIKKAL & POST, TIRUVANNAMALAI-606604, TIRUVANNAMALAI TK & DT., OFFICE PH : 04175-233277 MOB : 8610778503
5067 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST NEAR GOVT ITI, VENGIKKAL AND POST TIRUVANNAMALAI - 606604 TIRUVANNAMALAI TK & DIST OFFICE PH : 04175-233277
5068 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
5069 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
5070 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
5071 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
5072 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
5073 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
5074 SEVENTH DIGIT FILM AND ENTERTAINMENT PVT LTD D-64/110-A, MADHOPUR, SIGRA, VARANASI
5075 SEVENTH DIGIT FILM AND ENTERTAINMENT PVT LTD MADHOPUR, SIGRA, VARANASI
5076 SEVENTS CONSULTANTS PRIVATE LIMITED NO: 19, 3RD FLOOR,GCDA COMMERCIAL COMPLEX, MARINE DRIVE, KOCHI, KERALA
5077 SEVENTS CONSULTANTS PRIVATE LIMITED ROOM NO:-29, 3RD FLOOR, MARINE DRIVE, GCDA COMPLEX, KOCHI, KERALA
5078 SEVICA 1 SARAI KHAWAJA
5079 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
5080 SGR EDUCATIONAL SOCIETY #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL, DISTRICT: KARIMNAGAR, TELANGANA.
5081 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
5082 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
5083 SHABHGAI SHIKSHAN KENDRA SAHBHAGI SHIKSHAN KENDRA SAHBHAGI ROAD, CHHATHA MEEL (BEHIND POLICE FIRE STATION), SITAPUR ROAD, LUCKNOW-226201 (U.P.) INDIA, PHONE: 9452293783, 9935302536
5084 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
5085 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
5086 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
5087 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
5088 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
5089 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
5090 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
5091 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
5092 SHAKTI PROTECTION FORCE PVT LTD SHAKTI PROTECTION FORCE,320 ROYAL TRADE CENTRE OPP STAR BAZAAR,PAL HAJIRA , SURAT
5093 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
5094 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
5095 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
5096 SHANKARRAO PATIL CHARITABLE TRUST PUNE- SOLAPUR HIGHWAY, NEAR BY SHIV ELECTRONIC INDAPUR, TAL- INDAPUR, DIST- PUNE
5097 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
5098 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
5099 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
5100 SHANTI GD ISPAT AND POWER PRIVATE LIMITED HEAD OFFICE: 402 RAJEEV GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR PLANT ADDRESS: VILLAGE AMJHAR DISTRICT CHAMPA JANJGIR
5101 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
5102 SHANTI NIKETAN EDUCATION SOCIETY JANTA SR. SEC. SCHOOL VPO- JONDHAN KALAN,
5103 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
5104 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
5105 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
5106 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
5107 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
5108 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSKAR BHARTI PUBLIC SCHOOL, NANGLI BALAHIR, TEH. BEHROR
5109 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
5110 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
5111 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
5112 SHARDA SHIKSHA SAMITI VILLAGE AND POST SIURA DISTRICT SHAHJAHANPUR
5113 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
5114 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
5115 SHARI HARI ADARSH SIKSHAN SANDSTHAN -V.P.O. BORUNDA
5116 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
5117 SHARON INSUL INDIA LIMITED SHARON INSUL INDIA LIMITED SHARON TOWER, SEAPORT-AIRPORT TOAD, KAKKANAD, ERNAKULAM, KERALA
5118 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161 AGGRASAIN INDUSTRIAL AREA AGGRASAIN NAGAR
5119 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161, AGGRASAIN INDUSTRIAL AREA AGGRASAIN
5120 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
5121 SHASHI BHUSHAN SEN PATELWADA,WARD NO.7,SALUMBER,DIST.UDAIPUR(RAJASTHAN) PATELWADA
5122 SHEDULE CASTE AND TRIBES EDUCATION ECONOMIC LIFE TRUST NO:189 SATHAKOIL IIND ST ATHIPATTI BOOTHIPURAM BODI TALUK THENI DISTRICT TAMILNADU
5123 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
5124 SHEETAL JANKALYAAN SAMITI BM 97-98 PALAK COMPLEX IN FRONT OF SAI MANDIR, NEHRU NAGAR, BHOPAL (M.P.)
5125 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
5126 SHETKARI SHIKASHAN PRASARAK MANDAL S.S.P.M EDUCATIONAL COMPLEX,GAURIPADA TALAO,GAURIPADA ROAD,MILIND NAGAR,KALYAN WEST,DISRICT THANE
5127 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
5128 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
5129 SHEVOM RUBBER INDUSTRIES PVT LTD 3/338 VISHWAS KHAND GOMTINAGAR, LUCKNOW
5130 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
5131 SHIKHAR EDUCATIONAL SOCIETY 598/10 MUSKAN RESIDENCY,LALPUR ,RAIPUR,CHHATISGARH
5132 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
5133 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
5134 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
5135 SHIKSHA FOUNDATION GROUND FLOOR, CLIFTON PARK TOWER, NEAR SWAMI NARAYAN COLLEGE, KANKARIA ROAD, SHAH ALAM TOLL NAKA, AHMEDABAD
5136 SHIKSHA FOUNDATION GROUND FLOOR, CLIFTON PARK TOWER, NEAR SWAMINARAYAN COLLEGE, KANKARIA ROAD, SHAH ALAM ROLL NAKA, AHMEDABAD
5137 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
5138 SHIKSHA SADBHAWNA WELFARE JAMIYA SAFIYA LILBANAT SAMITI AHMADI TOLA
5139 SHIKSHAUNNATI SUBHASH PALLY NEAR M.N BUS STAND ALIPURDUAR
5140 SHIKSHAUNNATI CHAPARER PAR ALIPURDUAR
5141 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR 222142 UP
5142 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
5143 SHIKSHA VISTAR SANSTHA HOUSE NO 40, SEC 9/2 , GANDHI NAGAR
5144 SHILPEE EDUCATIONAL TRUST A/12, ALKAPURI, GARDNIBAGH, PATNA, BIHAR
5145 SHILP SHREE MAHILA SEWA SAMITI 1/256 VIKAS NAGAR LUCKNOW
5146 SHINE ACADEMY # 12-4-582, OBULADEVA NAGAR, ANANTAPUR
5147 SHINE ACADEMY # 12-4-582, OBULADEVA NAGAR, ANANTAPUR, ANDHRA PRADESH - INDIA - 515001.
5148 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
5149 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
5150 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
5151 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
5152 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
5153 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
5154 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
5155 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
5156 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
5157 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
5158 SHIVALIK JAN KALYAN SAMITI SIDDHI VINAYAK BHAVAN OPP. ARYANS HOSPITAL KHALGHAT A.B. ROAD DIST. DHAR (MP)
5159 SHIVAM DEVANSH FAB PRIVATE LIMITED VILLAGE MOHALA, CHHAPROLA ROAD, SIKRI, BALLABGHGARH, FARIDABAD (HARYANA)
5160 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
5161 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, JAFRABAD GODHRA 389001
5162 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, OPP. JAFARABAD GRAM PANCHAYAT, GODHRA
5163 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
5164 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
5165 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
5166 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
5167 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
5168 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
5169 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
5170 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
5171 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
5172 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
5173 SHIV EDUCATION SOCIETY NEAR MLN COLLEGE, RADAUR YAMUNA NAGAR,HARYANA
5174 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK,YAMUNANAGAR
5175 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK,YAMUNANAGAR,HARYANA
5176 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK YAMUNANAGAR
5177 SHIV EDUCATION SOCIETY 2ND FLOOR,ABOVE DCB BANK,NEAR FOUNTAIN CHOWNK, YAMUNANAGAR
5178 SHIVPRABHU BAHUUDDESHIYA KRIDA SHIKSHAN VA SANSKRUTIK MANDAL BULDANA VISHNUWADI, CIRCULAR ROAD, BULDANA, TQ. DIST. BULDANA- 443001 MAHARASHTRA (INDIA)
5179 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
5180 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
5181 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
5182 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
5183 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
5184 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
5185 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
5186 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
5187 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
5188 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
5189 SHOBHAWATI FOUNDATION SHOBHAWATI FOUNDATION B-50, SECTOR XU 1, GREATER NOIDA, GAUTAM BUDH NAGAR, UTTAR PRADESH
5190 SHODH 180/22, ZAKIR NAGAR, OKHLA
5191 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
5192 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
5193 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
5194 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
5195 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR RATLAM M.P
5196 SHRAMIKA VIKASA KENDRAM SHRAMIKA VIKASA KENDRAM H.N. 1-9-99 KOLLAPUR
5197 SHRAMIKA VIKASA KENDRAM SHRAMIKA VIKASA KENDRAM H.N. 1-9-99 KOLLAPUR NAGARKURNOOL-DIST TELANGANA
5198 SHRAMJIVI VIKAS SANGH 21,AKASHDEEP SOCIETY,NEAR JAY BHAVANI RAW HOUSE, B/H RLY,EAST KALOL
5199 SHRAMJIVI VIKAS SANGH 21,AAKASHDEEP SOCIETY,NEAR JAY BHAVANI ROW HOUSE,B/H RAILWAY STATION,KALOL EAST.
5200 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
5201 SHRAWASTI GRAMODYOG SEWA SANSTHAN VILLAGE- AURAIYA NIDHAN , POST- KATAHA, GILAUALA SHRAWASTI , PIN- 271835
5202 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
5203 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
5204 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
5205 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
5206 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
5207 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
5208 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
5209 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
5210 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
5211 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
5212 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR HOUSE NO 626 SHIVAJI NAGAR JINTUR TQ JINTUR DIST PARBHANI (MS)
5213 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
5214 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
5215 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
5216 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
5217 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
5218 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
5219 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
5220 SHREE GUTTI BASAVESHWARA SHIKSHANA MATTU GRAMINABHIVRUDDHI SAMSTHE NEAR HEMAREDDY MALLAMMA TEMPLE HUNASAGI ROAD CHOWDRY BUILDING RAGHAVENDRA COLONY KEMBHAVI
5221 SHREE JAGDAMBA BAL VIDYA MANDIR VILL POST SULTANGARH DISTT FATEHPUR U.P.
5222 SHREE JAINARAYAN GHOSAL SIKHSA SANSTHAN D 44/15, RAMAPURA, VARANASI, UTTAR PRADESH
5223 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
5224 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN
5225 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN,MATHURA
5226 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
5227 SHREE LAXMI COMPUTER CENTER LAXMI COMPUTER CENTER BASAVANA BAGEWADI
5228 SHREE MAN MANDIR EDUCATION TRUST KRISHNA COMPLEX, FIRST FLOOR, NR.AJI DUM CHOKDI, RAJKOT.
5229 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
5230 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
5231 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
5232 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
5233 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
5234 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
5235 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
5236 SHREE NARAYAN FOUNDATION RATHORE BHAWAN GANGJALA SAHARSA, BIHAR
5237 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
5238 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
5239 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
5240 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
5241 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
5242 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
5243 SHREE RAM KRIPA BUILD HOME PRIVATE LIMITED 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
5244 SHREERAM OM REAL ESTATE 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
5245 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
5246 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
5247 SHREE SANT GADGEBABAB BAHUDDESHIY SHIKSHAN SANSTHA KIRAN NAGAR NO 1 AMRAVATI 444606 S P GODE HOUSE KIRAN NAGAR NO 1 NEAR SAI MANDIR AMRAVATI
5248 SHREE SAUPARNIKA EXPORTS PVT LTD J-16/17, OPP.BSNL G.I.D.C., UMBERGAON, DIST. VALSAD
5249 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
5250 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
5251 SHREE SHERA EDUCATIONAL TRUST SHREE SHERA EDUCATIONAL TRUST(R),C/O COMMUNITY PLOYTECHNIC BELLARE,SHAHIN MAAL ,IIND FLOOR,OPP KSRTC BUS STAND,BELLARE,BELLARE POST,SULLYA TALLUK,DHAKSHINA KANNADA DIST,KARNATAKA STATE
5252 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
5253 SHREE VIDYA NIKETAN TRUST #353/1901, NEAR NIRUPAMA APPARTMENT, NAYAPALLI, BHUBANESWAR,ODISHA
5254 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
5255 SHRESTH WELFARE TRUST SHRESTH WELFARE TRUST PRAGATI WEB WORLD NEAR DR. SONALI DESHMUKH HOSPITAL RUKHMINI NAGAR AMRAVATI
5256 SHREWD MANPOWER CONSULTANTS PRIVATE LIMITED #306 A, PANCOM BUSINESS CENTER, OPP. CHENNAI SHOPPING MALL, AMEERPET, HYDERABAD
5257 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
5258 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
5259 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
5260 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
5261 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
5262 SHRI BALAJI INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED DUBEY COLONY MOWA RAIPUR
5263 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
5264 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI, RAIPUR, CHHATTISGARH
5265 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI,
5266 SHRI BRAHMANIKRUPA SEVA TRUST B 120 DAMODAR COMPLEX, NEAR DOCTOR HOUSE IDAR DIST: SABARKANTHA, GUJARAT
5267 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
5268 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
5269 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
5270 SHRI DADASAHEB GAWAI CHARITABLE TRUST AMRAVATI CONGRESS NAGAR ROAD SHYAM NAGAR AMRAVATI
5271 SHRI DAMARAM MEMORIAL SHIKSHAN AVM PRESHIKSHAN SANSTHAN NAGAUR NEAR BASNI OVER BRIDGE, SANJAY COLONY, NAGAUR
5272 SHRI DAUJI REWATI INFRABUILD PRIVATE LIMITED H. NO. 31/177-A, PREM NAGAR, RAJPUR CHUNGI AGRA AGRA UTTAR PRADESH 282001
5273 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
5274 SHRI DIGAMBER PRASHIKSHAN AVAM ANUSANDHAN SANSTHAN A-131, RANJEET NAGAR, BHARATPUR RAJASTHAN
5275 SHRI DURGA SANKIRTAN JANTA SABHA DURGA BHAWAN COMPLEX, THE MALL SOLAN
5276 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
5277 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
5278 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
5279 SHRI GHARSHI RAM SHIKSHA SAMITI VILL-DHANI KIRAROD, POST-DHARSON
5280 SHRI GHARSI RAM SHIKSHA SAMITI VILL- DHANI KIRAROD,POST- DHARSOUN
5281 SHRI GOPAL DARBAR LOK KALYAN SAMITI GHATKOTRA MAURANIPUR
5282 SHRI GOPAL DARBAR LOK KALYAN SAMITI VILLAGE POST GHATKOTRA TEH MAURANIPUR DISTT JHANSI UP
5283 SHRI GOPAL DARBAR LOK KALYAN SAMITI GANDHI NAGAR MAHOBA UP
5284 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
5285 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
5286 SHRI GURU HARGOVIND SOCIETY 13, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
5287 SHRI GURU JAMBHESHWAR SHIKSHA SABHA A CHARITABLE TRUST U/S 80G INCOME TAX ACT VPO DHORA MEHRAJ PUR TEHSIL ABOHAR
5288 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA