Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
3 AAA AAA
4 AAA BBB JABBALPUR, KATHMANDU,
5 AAA SOCIETY A AA AAAAAAAAAAAAAA
6 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
7 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
8 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
9 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
10 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
11 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
12 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
13 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
14 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
15 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
16 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
17 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
18 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
19 AARAV MEDISHINE PRIVATE LIMITED 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.- DURG (C.G.)
20 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
21 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
22 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
23 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
24 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
25 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
26 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
27 AARTHI A1 TRADERS 9D/14, 50 FEET ROAD, RAMAKRISHNAPURAM, KARUR
28 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
29 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
30 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
31 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
32 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
33 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
34 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
35 AASTHA EDUCATION AND WELFARE SOCIETY C/O ABAHYKUMAR DANDAGE F-5 SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
36 AASTHA EDUCATION AND WELFARE SOCIETY C/O, ABHAYKUMAR DANDAGE, SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
37 AASTHA EDUCATION AND WELFARE SOCIETY C/O,ABHAYKUMAR DANDAGE, F-5,SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
38 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO.1, SUMSUL AARIFFA NAGAR, PERIYAR SALAI ROAD, KEELAVASAL, THANJAVUR
39 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
40 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
41 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
42 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
43 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
44 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
45 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
46 ABC KALARA BURDWAN
47 ABC BHOPAL
48 ABC JHSDJHDFKLJDFKJHJKGD
49 ABC JKLJLJK
50 ABCD ABCDEFGHIJKLMNOP
51 ABCD ABCD
52 ABC FIRM LTD PATNA
53 ABC PVT LTD PUNE
54 ABC TRUST LKCNSDKAJD
55 ABDIN EDUCATINAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
56 ABDIN EDUCATIONAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
57 ABD PVT LTD XYZ
58 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
59 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
60 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
61 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
62 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
63 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
64 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
65 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
66 ABHINAYTOSH MAHILA BAL VIKAS SAMITI SEVA HOSPITAL PREMISES, PADMAKAR NAGAR, MAKRONIA, SAGAR, MADHYA PRADESH
67 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
68 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
69 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
70 ABHYUDAY VEDANT SOCIETY VANDE MATARAM BHAVAN, CHURCH ROAD KUNKURI, DIST. - JASHPUR
71 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
72 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
73 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
74 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
75 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
76 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
77 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
78 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
79 ACAT EDUCATION PRIVATE LIMITED ACAT EDUCATION PRIVATE LIMITED,1ST FLOOR,RAJ COMPLEX,SANICHARA ASTHAN,DR. P.GUPTA ROAD,NEAR VIJAYA BANK,WARD-20,CHATTI,RATANPUR,BEGUSARAI (BIHAR,PIN-851101
80 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
81 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
82 ACCESS SOLAR LTD PLOT NO.104, PRASHANTHI NAGAR, I.E.KUKATPALLY HYDERABAD – 500 072 TELANGANA, INDIA
83 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
84 ACCURATE EDUCATION AND RESEARCH SOCIETY C-187,SURYANAGAR, GHAZIABAD, UP
85 ACE CONSULTING PRIVATE LIMITED NO.309 2ND FLOOR DEEP PLAZA OPPOSITE GURGAON COURT SOHNA ROAD GURGAON HARYANA 122001
86 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
87 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
88 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
89 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
90 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
91 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
92 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
93 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
94 ACTION FOR ADVANCEMENT OF SOCIETY A-30, MADHAV RAO SAPARE NAGAR, BIRGAON, RAIPUR, CHHATTISGARH
95 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
96 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
97 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
98 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
99 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
100 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
101 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
102 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
103 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
104 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
105 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
106 ADARSH FOODS CITY STATION ROAD KHURJA
107 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
108 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
109 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
110 ADARSH VIDHYA SAMITI 87 UTTAMGIRI COLONY,NEAR DOUBLE CROSSING, SHASTRIPURAM AGRA
111 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
112 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
113 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
114 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
115 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
116 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
117 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
118 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
119 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
120 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
121 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
122 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
123 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
124 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
125 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
126 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
127 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
128 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
129 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
130 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
131 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
132 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
133 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
134 ADVANCED LIFE CARE MULTIDESCIPLINARY HOSPITAL PRIVATE LIMITED 26-KASIA ROAD CANTT CROSSING DAUDPUR GORAKHPUR U.P
135 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
136 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
137 ADVANCE INFORMATION AND MULTIMEDIA EDUCATION SOCIETY 53 A, MAIN ROAD KARRAHI, BARRA, KANPUR
138 ADVENT CHEMBIO PRIVATE LIMITED 21, QUEEN VIEWS, JUHU ROAD, MUMBAI
139 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
140 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
141 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
142 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
143 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
144 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
145 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
146 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
147 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
148 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
149 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
150 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
151 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
152 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
153 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
154 AIFA INFOTECH PVT LTD 572/2, AADRSH NAGAR, NEW RAILWAY ROAD, OPP. AUTO STAND, GURUGRAM HR
155 AIFA INFOTECH PVT LTD 572/2D, ADRSH NAGAR, NEW RAILWAY ROAD, OPP, AUTO STAND, GURUGRAM, HARYANA-122001
156 AIFA INFOTECH PVT LTD 572/2,ADARSH NAFAR, NEW RAILWAY ROAD, OPP. AUTO STAND,GURUGRAM HARYANA-122001
157 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
158 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
159 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
160 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
161 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
162 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
163 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
164 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
165 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
166 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
167 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
168 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
169 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
170 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
171 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
172 A K SAMANTARAY AND COMPANY PRIVATE LIMITED PLOT NO. 309/1801, SUB PLOT NO.1, SBI CAMPUS, SAILASHREE VIHAR, BHUBANESWAR
173 AKSARA SOCIAL SERVICE SOCIETY H.NO-9-82 PARKAL WARANGAL DISTRICT
174 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
175 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
176 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
177 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
178 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
179 ALBAN COMMUNICATIONS INDIA PRIVATE LIMITED 502, AGH CHAMBERS, 379-381 NARSHI NATHA STREET, MASJID BUNDER(WEST) MUMBAI-400009, MAHARASHTRA
180 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
181 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
182 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
183 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
184 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
185 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
186 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
187 ALHUDA PUBLIC SHIKSHA SEWA SAMITI VILL BANKATWA MAKOLIYA P/O TURHANI RAJJAB DISTT BAHARAICH UP 271802
188 ALIGN SKILLS EDUTECH W.NO. 6, NEAR CHUNA FATAK, HANUMANGARH
189 AL KARIM BAHUUDDESHIYA SEVABHAVI SANSTHA AT POST PALI
190 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
191 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
192 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
193 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
194 ALL INDIA COUNCIL OF TECHNICAL EDUCATION AND TECHNOLOGY UTTRA KOWGACHI, VIVEKANANDA LANE, NEAR – SHAKTI SANGHA CLUB, P.O. - SHYAMNAGAR, P.S.- JAGATDDAL
195 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
196 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
197 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
198 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
199 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
200 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
201 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
202 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
203 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
204 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
205 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
206 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
207 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
208 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
209 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
210 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
211 ALMIGHTY INTERNATIONAL SOCIETY OUTSIDE MANNA PHATAK, MALERKOTLA
212 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
213 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
214 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
215 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
216 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
217 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
218 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
219 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
220 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
221 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
222 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
223 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
224 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
225 AMECH BUSINESS SOLUTION PRIVATE LIMITED A 22,2ND FLOOR, SECTOR-3 NOIDA
226 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
227 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
228 AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-686/K/15, 4TH FLOOR, BANJARA HILLS, ROAD NO12,HYDERABAD.
229 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
230 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
231 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
232 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
233 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
234 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
235 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
236 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
237 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
238 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
239 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
240 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
241 AMRUTHA FOUNDATION NO.306, D.B. ROAD, R.S..PURAM, COIMBATORE - 641002 TAMILNADU - INDIA
242 AMRUTHA FOUNDATION NO.306, D.B.ROAD, R.S.PURAM, COIMBATOR E- 641 002
243 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
244 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
245 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
246 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
247 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
248 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
249 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
250 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
251 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
252 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
253 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
254 ANDHRA CARDIOLOGY ASSOCIATES PRIVATE LIMITED 6-3-248/1/1A, CARE HOSPITAL, ROAD NO.1, BANJARA HILLS, HYDERABAD-500034
255 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
256 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
257 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
258 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM
259 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
260 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
261 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
262 ANFAR FOUNDATION 2ND FLOOR, ANFAR SHOPPING CENTRE, J.K. KEDIA ROAD, HOJAI, P.O. HOJAI, P.S. HOJAI, DISTRICT- NAGAON, ASSAM, INDIA
263 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
264 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
265 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
266 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
267 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
268 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
269 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
270 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE, DHARAMPETH
271 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE
272 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
273 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
274 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
275 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
276 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
277 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
278 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
279 ANKUSH SHIKSHAN SANSTHA ANKUSH SHIKSHAN SANSTHA, CRPF GATE, DIGDOH HILLS, HINGNA MIDC, NAGPUR, 440016
280 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO.3, DIGDOH HILLS,HINGNA MIDC, NAGPUR
281 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO 3,DIGDOH HILLS ,HINGNA MIDC,NAGPUR
282 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
283 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
284 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
285 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
286 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
287 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
288 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
289 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
290 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
291 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
292 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
293 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
294 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
295 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
296 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
297 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
298 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
299 ANNAMALAI ASDJFKL ADF ASDF AS F
300 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
301 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
302 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
303 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
304 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
305 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
306 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
307 ANTOYODAYA SAI KRIPA SEWA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA DISTT SAGAR
308 ANTYODAYA SAI KRIPA SEVA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA
309 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
310 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
311 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
312 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
313 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
314 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
315 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
316 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
317 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
318 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
319 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
320 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
321 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
322 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
323 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
324 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
325 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
326 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
327 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
328 APLOMB ABHILASHA BHAWAN MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA
329 APNA TELE LINK PRIVATE LIMITED SCO 1-12, 4TH FLOOR, PPR MALL, MITHAPUR ROAD JALANDHAR CITY
330 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
331 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
332 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
333 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
334 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
335 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
336 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
337 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
338 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
339 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
340 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
341 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
342 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
343 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
344 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
345 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
346 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
347 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
348 ARCENCIEL FOUNDATION H. NO. 85B, KHRIYA POKHARA BASHARATPUR, MEDICAL ROAD GORAKHPUR GORAKHPUR UP 273004 IN
349 ARCEUS INFOTECH PVT LTD 508, 5TH FLOOR, THE SUMMIT BUSINESS BAY (OMKAR), ANDHERI-KURLA ROAD, ANDHERI (EAST), MUMBAI - 400093
350 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
351 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
352 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR SHREE RAM BHAWAN PICNIC SPOT ROAD KHURAM NAGAR LUCKNOW
353 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
354 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
355 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
356 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
357 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
358 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
359 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
360 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
361 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
362 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
363 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
364 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
365 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
366 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
367 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
368 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
369 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
370 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
371 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
372 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
373 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
374 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
375 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
376 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
377 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
378 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
379 ARUNACHAL UNIVERSITY OF STUDIES NH-52, NAMSAI DISTRICT NAMSAI
380 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
381 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
382 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
383 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
384 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
385 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
386 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
387 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
388 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
389 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
390 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
391 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
392 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
393 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
394 ASFSDA ASDF
395 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
396 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
397 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
398 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
399 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
400 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
401 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
402 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
403 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
404 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
405 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
406 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
407 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
408 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
409 ASHTA UTKARSH SEVA SANSTHAN SAMITI 445, WARD NO 16, SEMNARI ROAD ASHTA
410 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
411 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
412 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
413 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
414 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
415 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
416 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
417 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
418 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
419 ASIAN INFOTECH EDUCATIONAL DEVELOPMENT SOCIETY ASIAN INFOTECH ZOOROAD TINIALI APURBA SINHA PATH BY LANE-05
420 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
421 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
422 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
423 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
424 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
425 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
426 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
427 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
428 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
429 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
430 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
431 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
432 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
433 ASSIST G. T. ROAD CHILAKALURIPET GUNTUR DISTRICT ANDHRA PRADESH
434 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
435 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
436 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
437 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
438 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
439 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
440 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
441 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
442 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
443 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
444 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
445 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
446 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
447 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
448 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
449 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
450 ATHMA DIVINE TRUST NO 80-A KONDASAMY ROAD RAMNAGAR COIMBATORE
451 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
452 ATMIY MANAGEMENT LLP AT,GADHADA MOHANNAGAR SOCIETY OPP.NEW BUSSTATION DIST.BOTAD TALUKO - GADHADA
453 ATMIY MANAGEMENT LLP AT GADHADA MOHANNAGAR SOCIETY OPP NEW BUS STATION DIST BOTAD
454 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
455 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
456 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
457 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
458 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
459 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
460 AVJ INFOTECH PVT LTD AMIYO NIKETAN NAITY ROAD,BAGAN PARA,2ND FLOOR,P.O-NABAGRAM, PIN: 712246
461 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
462 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
463 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
464 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
465 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
466 AVTAR WELFARE SOCIETY 538/5-C BANKER COLONY, JHANSI
467 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
468 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, JHANSI UP 284001
469 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, BEHIND KISAN BAZAR, JHANSI
470 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY
471 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
472 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
473 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
474 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
475 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
476 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
477 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
478 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
479 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN
480 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN DISTT MOGA PUNJAB
481 BABA JAKJDAS JHAKJB KNKDCKDN KJBSKBDSKN BSKBDKCB
482 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
483 BABA SAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE , PLOT NO 59/471 , P.S - SECTOR 12. BOKARO (JHARKHAND)
484 BABASAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE 59/471. PO + PS SECTOR 12. BOKARO
485 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
486 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
487 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
488 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
489 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
490 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
491 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
492 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
493 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
494 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
495 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
496 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
497 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
498 BAJRANGBALI SHAIKSHNIK EVAM SAMAJIK SEVA SANSTHAN POSTAL PARK NAVRATAN PUR MANDIR,P.O-GPO.P.S.-KANKARBAGH
499 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
500 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
501 BALAGH EDUCATION AND WELFARE SOCIETY 3RD FLOOR KHALID APARTMENT BADI OMTI JABALPUR M.P.
502 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
503 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
504 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
505 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
506 BALAJ TRUST CO LTD DGHDGGHDGDGGD
507 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
508 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
509 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
510 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
511 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
512 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
513 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
514 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
515 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
516 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
517 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
518 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
519 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
520 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
521 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
522 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
523 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
524 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
525 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
526 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
527 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
528 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
529 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
530 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
531 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
532 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
533 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
534 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
535 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
536 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
537 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
538 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
539 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
540 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
541 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
542 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
543 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
544 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80, SITE-5, UDYOG KUNJ, PANKI, KANPUR-208022,PH. NO.0512-2212083
545 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
546 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
547 BELA ROZGAR AND HEALTH CONSCIONS COMPANY IST FLOOR, SANT PLAZA, ABOVE CORPORATION BANK SHRIKANT VERMA MARG, NEAR RAMA MAGNETO MALL, BILASPUR, CHHATTISGARH
548 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
549 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
550 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
551 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
552 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
553 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
554 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
555 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
556 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
557 BFHJFF BDHD
558 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
559 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
560 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
561 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
562 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
563 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
564 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
565 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
566 BHANSALI TRUST BHANSALI TRUST AND HOSPITAL, HIGHWAY CROSS ROAD, NEAR GAYATRI TEMPLE
567 BHANSALI TRUST BHANSALI TRUST RADHANPUR HIGHWAY CROSS ROAD NEAR GAYATRI TEMPLE AT PO RADHANPUR
568 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
569 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
570 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
571 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
572 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
573 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
574 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
575 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
576 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
577 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
578 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
579 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
580 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
581 BHARATHIYA SEVA SAMSTHE NO.363, 7TH MAIN, BHUVANESHWARI NAGAR, T DASARAHALLI, BANGALORE
582 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
583 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
584 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
585 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
586 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
587 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
588 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
589 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
590 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
591 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
592 BHARAT VEERANGNA AWANTIBAI EDUCATIONAL SANTHAN D-16 SECTOR-9 VIJAY NAGAR GHAZIABAD
593 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
594 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
595 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
596 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
597 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
598 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
599 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
600 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
601 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
602 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
603 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
604 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
605 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NEW RAIPUR
606 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NAYA RAIPUR
607 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
608 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
609 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
610 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
611 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
612 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
613 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
614 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
615 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
616 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
617 BHUPINDRA SOCIETY REGISTERED OFFICE : SCF-34, DUKHNIWARAN SAHIB GURUDWARA MARKET, PATIALA, PUNJAB- 147001 CORPORATE OFFICE : SCO-19, 2ND FLOOR, SECTOR 26, MADHYA MARG, CHANDIGARH , 160019
618 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
619 BILASPUR FULE STATION VILLAGE-PARSADA DISTRICT-BILASPUR RAIPUR ROAD BILASPUR
620 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
621 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
622 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
623 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
624 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
625 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
626 BISWAAS BAHARANA.NIALI,CUTTACK
627 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
628 BIYANI SHIKSHAN SAMITI SECTOR. NO 3, VIDHYADHAR NAGAR, JAIPUR, RAJASTHAN
629 BIYANI SHIKSHAN SAMITI BIYANI SHIKSHAN SAMITI, R-4, SECTOR 3, VIDYADHAR NAGAR, JAIPUR
630 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
631 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
632 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
633 BLUEBLOOD VENTURES LIMITED ROOM NO. 101, P-27, MALVIYA NAGAR, NEW DELHI
634 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED NO.18 SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR BANGALORE - 560043
635 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED #18, SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR, BANGALORE 560043
636 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
637 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
638 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
639 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
640 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
641 BORAL NUTANHAT YOUTH COMPUTER TRAINING CENTRE C/6 RAJNARAYAN PARK,RANGKAL MORE, BORAL MAIN ROAD , P.O. BORAL,P.S. SONARPUR ,PIN -700154 REGISTERED OFFICE 58/3 MADHYAPARA , ROYNAGAR, P.O.& P.S. BANSDRONI,KOLKATA-700070
642 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
643 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR
644 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
645 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
646 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED D-17,THACKER INDUSTRIAL ESTATE,N.M JOSHI MARG,CHINCHPOKALI MUMBAI - 400011
647 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
648 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
649 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
650 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
651 BRIGHT FUTURE ACADEMY SHYAM JI MARG ,KETKA ROAD SURAJPUR(CG)
652 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
653 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
654 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
655 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
656 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
657 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
658 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
659 BRIGHT STAR MUSLIM ASSOCIATION 42, INDIRA NAGAR, B.N.P. ROAD, DEWAS
660 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
661 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
662 BRIJ KISHORE JAGRITI SEWA SAMITI VILL AND POST BARGAWAN, TEHSIL MISHRIKH DISTRICT SITAPUR, UTTAR PRADESH
663 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
664 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
665 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
666 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
667 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
668 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
669 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
670 BROADLINE COMPUTER SYSTEMS NO. 7, 2ND FLOOR, KHADER NAWAZ KHAN ROAD, NUNGAMBAKKAM CHENNAI
671 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
672 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
673 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
674 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
675 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
676 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
677 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
678 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
679 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
680 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
681 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
682 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
683 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
684 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
685 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
686 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
687 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
688 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
689 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
690 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
691 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
692 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
693 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
694 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
695 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
696 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
697 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
698 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
699 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
700 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
701 CALLHEALTH SERVICES PRIVATE LIMITED 1-66/1/RI/08/8, 10TH & 11TH FLOOR, RAMKY GRANDIOSE, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD - 500032, TELANGANA
702 CAMBRIDGE PUBLIC EDUCATIONAL AND WELFARE TRUST VILL SAIDPUR PO SORMAR BAGHALA PS MORO DISTT DARBHANGA
703 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA; DISTRICT CENTRE, JASOLA, NEW DELHI-110025
704 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA DISTRICT CENTRE, JASOLA, NEW DELHI-110025
705 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
706 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
707 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
708 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
709 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
710 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
711 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
712 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
713 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
714 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
715 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
716 CAREER DEVELOPMENT OPPORTUNITY AND TRAINING C DOT NO 7 ,ST MARYS BUILDING ,R.S.L GOLDEN APARTMENT ROAD (NEAR SELVARAJ TEXTILES) VILLANGUDI,MADURAI
717 CAREER EDUCOM ACADEMY 70, JALVIHAR COLONY, RAIPUR, CG, 492001
718 CAREER EDUCOM ACADEMY 70, JALVIAHAR COLONY, RAIPUR
719 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
720 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
721 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
722 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
723 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
724 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR CHHATTISGARH
725 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
726 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
727 CARE WORLD BAGHI MEHTAB NEAR BYPASS BRIDGE
728 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
729 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
730 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
731 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
732 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
733 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
734 CDHU EEHDG
735 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMADI HOUSE, MOHAMADALI ROAD, P.O. BOX, 13097, MASJID BUNDER (WEST), MUMBAI
736 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMMEDI HOUSE MOHAMMED ALI ROAD MOHARASHTRA MUMBAI
737 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
738 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
739 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
740 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
741 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
742 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
743 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
744 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
745 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
746 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
747 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
748 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
749 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
750 CENTRAL FOOTWEAR TRAINING INSTITUTE CFTI AGRA C-41 & 42, SITE-C, INDUSTRIAL AREA, SIKANDRA, AGRA
751 CENTRAL INSTITUTE OF DESIGN CENTRAL INSTITUTE OF TOOL DESIGN (A GOVERNMENT OF INDIA SOCIETY MINISTRY OF MSME) BALANAGAR, HYDERABAD
752 CENTRAL INSTITUTE OF TOOL DESIGN CENTRAL INSTITUTE OF TOOL DESIGN, NARASPUR CROSS ROADS, BALANAGAR, HYDERABAD
753 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
754 CENTRAL TOOL ROOM AND TRAINING CENTRE KOLKATA CENTRAL TOOL ROOM AND TRAINING CENTRE (CTTC) BONHOOGHLY INDUSTRIAL AREA KOLKATA-700108, WEST BENGAL
755 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
756 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
757 CENTRE FOR COMMUNITY SERVICE AND ALTRUISM NO.14,NEW STREET MANALIESTATE, PUDUPALAYAM MAIN ROAD, CUDDALORE.
758 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
759 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
760 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
761 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
762 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
763 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1,INDUSTRIAL AREA, P.O:MUIDDINPUR,JALESHER ROAD FIROZABAD
764 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A1/1, INDUSTRIAL AREA, P.O-MUIDDINPUR JALESHER ROAD FIROZABAD
765 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1 INDUSTRIAL AREA P.O - MUIDDINPUR JALESHAR ROAD FIROZABAD
766 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
767 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A
768 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH SAS NAGAR PUNJAB YUVA BHAWAN SECTOR 42A
769 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
770 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
771 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
772 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
773 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
774 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
775 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
776 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
777 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
778 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
779 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
780 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
781 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
782 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
783 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
784 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
785 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
786 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
787 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
788 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
789 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
790 CH CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1N-3 MIA, ALWAR
791 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
792 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
793 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
794 CHETNA ALLAHABAD ROAD KARWI
795 CHETNA ALLAHABAD ROAD, KARWI
796 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
797 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTISGARH CHANDRANAHU SIKHAN SAMITI ,NEAR BY SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
798 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI BAGBAHARA ROAD SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
799 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
800 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
801 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
802 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
803 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
804 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
805 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
806 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
807 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
808 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
809 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
810 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
811 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
812 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
813 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
814 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
815 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
816 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
817 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
818 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
819 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
820 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
821 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
822 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
823 CHOUHAN HOUSING PRIVATE LIMITED CHOUHAN RESIDENCY, RAJEEV NAGAR, MUKTIDHAM ROAD, AZAD CHOWK, SUPELA, BHILAI-490023, CHHATTISGARH
824 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
825 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
826 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
827 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
828 CITY MAKERS PRIVATE LIMITED CITY MAKERS PVT.LTD G-1,VASUDEO CITY,OPP-RAJHANSH GUEST HOUSE, BENIBABU BAGICHA, RAJENDRA PATH,PATNA.
829 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
830 CKAKPARAN KANTAKHALI CHOKHER AALO WELFARE SOCIETY VILL : MOHANPUR, PO : SOUTH MOHANPUR, PS : MAGRAHAT, SUB-DIST : MAGRAHAT - II, DIST : SOUTH 24 PARGANAS, STATE : WEST BENGAL, PIN : 743610
831 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
832 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
833 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
834 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
835 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
836 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
837 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
838 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
839 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
840 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
841 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
842 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
843 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
844 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY, BEHIND PT. RAVI SHANKAR UNIVERSITY, DUMAR TALAB, MOHBA BAZAR, RAIPUR
845 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY BEHIND PT. R. S. UNIVERSITY CAMPUS, DUMAR TALAB (MAHOBA BAZAR), RAIPUR (C.G.)
846 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
847 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
848 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
849 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
850 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
851 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
852 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
853 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
854 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
855 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK
856 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK.
857 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
858 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
859 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
860 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD 2ND FLOOR, KUNDA HOUSE, MG ROAD, AURANGABAD
861 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
862 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
863 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
864 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
865 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
866 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
867 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
868 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
869 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
870 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
871 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
872 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
873 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
874 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
875 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
876 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
877 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
878 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
879 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
880 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
881 COODU TRUST H.83.R M.COLONY DINDIGUL
882 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
883 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
884 COREMAGE ACADEMY 518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD JAMNAGAR
885 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
886 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
887 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
888 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
889 COUNCIL FOR SKILL UTILITY TRAINING ASSOCIATION 5FT FLOOR O2 BUSSINESS CENTER, RING ROAD NO 2, NEAR RELIANCE PETROL PUMP,GONDWARA, RAIPUR C.G.
890 COUNCIL FOR SKILL UTILITY TRANING ASSOCIATION 5 TH FLOOR, O2 BUSINESS CENTER, GONDWARA,RING ROAD NO.-2, RAIPUR, C.G.
891 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
892 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
893 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
894 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
895 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
896 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
897 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
898 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
899 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
900 CRYSTAL NETWORK SOLUTIONS B-30 , KAPIL VASTU COLONY JHALAWAR , RAJASTHAN
901 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
902 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
903 CSI COMPUTECH INDIA PRIVATE LIMITED INNAVIMUMBAI (HO)CSI COMPUTECH (I) PVT. LTD.106, BUILDING 3, SECTOR 3,MILLENNIUM BUSINESS PARK, MAHAPENAVI MUMBAI-400701
904 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
905 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
906 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
907 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
908 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
909 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
910 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
911 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
912 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
913 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
914 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
915 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
916 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
917 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
918 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
919 CYBOTECH EDUSERVE PVT LTD GOLA ROAD, NEAR IMAMBARA, NAWADA, BIHAR
920 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
921 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
922 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
923 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
924 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
925 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
926 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
927 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
928 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
929 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
930 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
931 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
932 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
933 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
934 DALITSANGH H.NO-13 LATA MARG MITRA KUNJ SOHAGPUR DISTT- HOSHANGABAD (MADHYAPRADESH)
935 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
936 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
937 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
938 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
939 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
940 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
941 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
942 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
943 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
944 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
945 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
946 DARYAV ELECTRICAL AND H C E COMAPNY DARYAV MANJIL PHASE 3 INDRAPURI COLOY TIKAMGARH
947 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
948 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
949 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
950 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
951 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
952 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
953 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
954 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
955 DDUGKY MORD C TEST ALJBSDFLQJHF
956 DDUGKY MORD C TEST1 LJHWDF
957 DDUGKY MORD INC TEST2 NEW DELHI
958 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
959 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
960 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
961 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
962 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
963 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
964 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
965 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
966 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
967 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
968 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
969 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
970 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
971 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
972 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
973 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
974 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
975 DEEPSHIKHA MAHILA BAL UTTHAN SAMITI C/O KIRAN ITI COLLEGE,KIRAN NURSING HOME CAMPUS, HATWARA ROAD, 4 NO. DISPENSARY, SODALA, JAIPUR
976 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
977 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
978 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
979 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
980 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
981 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
982 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
983 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
984 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
985 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
986 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
987 DEVELOPMENT INITIATIVE DEVELOPMENT INITIATIVE, SRIRAMCHANDRAPUR, P.O.-SAKHIGOPAL, PURI, ODISHA
988 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
989 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
990 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI WARD NUMBER 12 INDERGARG DATIA
991 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI INDERGARH SEVDA DATIA(M.P.)
992 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI, WARD NO. 12 INDERGARH
993 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
994 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
995 DFHDFHFH KJDVNMDV,M DV
996 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
997 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
998 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
999 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1000 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1001 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1002 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1003 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1004 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
1005 DHANVI CHARITABLE AND EDUCATIONAL TRUST SHOP NO 39 ADITYA COMPLEX NEAR KASAK CIRCLE BHARUCH
1006 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
1007 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
1008 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
1009 DHAYA EDUCATION AND CHARITY FOUNDATION NEWBUSSTAND BUILDING SANTHANAPURAM FIRST STREET PUDUKKOTTAI
1010 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
1011 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
1012 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
1013 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
1014 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
1015 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
1016 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK DISTT RAMPUR UP
1017 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR MILAK RAMPUR UP
1018 DIKSHA SAMAJ SEWA SOCITY MOH NAI BASTI ASDULLAPUR MILAK RAMPUR
1019 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
1020 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
1021 DISHA DISHA LANE, HISAR ROAD, SIRSA
1022 DISHA DISHA SIRSA DISHA LANE, HISAR ROAD, SIRSA- 125055
1023 DISHA DISHA SIRSA ,DISHA LEN, FRINDES COLONY,BIHAIND PREETAM PALECE ,SIRSA PIN NO. 125055
1024 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
1025 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
1026 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
1027 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
1028 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
1029 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
1030 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
1031 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
1032 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
1033 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
1034 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
1035 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
1036 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
1037 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
1038 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
1039 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1040 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
1041 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1042 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
1043 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
1044 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
1045 DIVYSAGAR SOCIETY 108, SR. MIG,NEAR ALLAHABAD BANK, KOTRASULTANABAD,
1046 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
1047 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
1048 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
1049 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
1050 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
1051 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
1052 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
1053 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1054 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
1055 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
1056 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
1057 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
1058 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
1059 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
1060 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
1061 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
1062 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
1063 DR AMBEDKAR MEMORIAL SOCIAL WELFARE AND EDUCATIONAL TRUST AT/PO-JAGDA, ROURKELA, PS-JHIRPANI, DIST-SUNDARGARH
1064 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
1065 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
1066 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
1067 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
1068 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1069 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1070 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
1071 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
1072 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1073 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1074 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
1075 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
1076 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
1077 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
1078 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
1079 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
1080 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1081 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1082 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
1083 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1084 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1085 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1086 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
1087 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1088 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
1089 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
1090 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
1091 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
1092 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
1093 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
1094 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
1095 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
1096 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
1097 DUM DUM PARK UNNAYANI SAMANNAY 172, LAKE TOWN, BLOCK-A, FLAT NO. 2, KOLKATA
1098 DUPATI SRI EDUCATIONAL SOCIETY H NO 87-1345-10-1, ENGINEERS COLONY,KURNOOL,AP
1099 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
1100 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1101 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1102 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1103 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1104 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
1105 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
1106 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA, P.O- PANAGARH BAZER, DIST- BURDWAN
1107 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
1108 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
1109 DURJAN SAL EDUCATIONAL TRUST RAM SINGH COLLEGE OF ENGG.AND TECHNOLOGY,NAGLA SIKANDAR TUNDLA-ETAH ROAD,FIROZABAD
1110 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
1111 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
1112 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
1113 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
1114 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
1115 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
1116 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
1117 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
1118 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
1119 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1120 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1121 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
1122 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
1123 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
1124 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
1125 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
1126 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
1127 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
1128 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
1129 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
1130 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
1131 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
1132 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
1133 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
1134 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
1135 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
1136 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
1137 EDS GADEPAN KOTA
1138 EDUCATIONAL SYSTEM AND WELFARE SOCIETY 61 CIVIL LINES NEAR ISLAMIYA GIRLS INTER COLLEGE BAREILLY 243001
1139 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
1140 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
1141 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
1142 EDU INSTITUTE ADDRESS
1143 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
1144 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
1145 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
1146 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
1147 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
1148 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
1149 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
1150 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
1151 EKLAVYA DEVELOPMENT SOCIETY VILLAGE POST-KANTOLI TEHSIL- MALPURA DISTRICT-TONK RAJASTHAN 304502
1152 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
1153 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
1154 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
1155 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
1156 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
1157 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX.DHAKURIA,KOLKATA-700068
1158 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
1159 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
1160 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
1161 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
1162 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
1163 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
1164 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
1165 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1166 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1167 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
1168 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
1169 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
1170 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
1171 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
1172 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
1173 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
1174 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
1175 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
1176 E PARIVARA SAGARA NIVASA SPM ROAD SAGAR 577401
1177 E PARIVARA SAGAR NIVASA SPM ROAD SAGAR 577401
1178 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
1179 ERAM TECHNOLOGIES PVT LTD III FLOOR, INKEL TOWER, ANGAMALY
1180 ERAM TECHNOLOGIES PVT LTD III FLOOR INKEL TOWER, ANGAMALY SOUTH PO, NEAR TELK ANGAMALY
1181 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1182 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1183 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1184 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1185 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1186 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1187 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1188 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1189 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1190 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1191 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1192 ESTEX TELECOM PRIVATE LIMITED ESTEX HOUSE 38, DLF INDUSTRIAL AREA KIRTI NAGER
1193 ESTEX TELECOM PRIVATE LIMITED ESTEX TELECOM PVT. LTD., ESTEX HOUSE,38, KIRTINAGAR, DLF INDUSTRIAL AREA, NEAR SYNDICATE BANK, NEW DELHI
1194 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1195 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1196 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1197 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1198 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1199 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1200 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1201 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1202 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1203 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1204 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1205 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1206 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1207 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY SHOP 1 NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1208 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1209 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1210 EXPERT SKILL DEVELOPMENT PRIVATE LIMITED 163 C BLOCK NEW MANDI SIRSA ( HARYANA )
1211 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1212 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1213 FAANS CONSULTANTS PVT LTD C#6,LIGHT HOUSE HILL ROAD,OPPOSITE KASTHURBA MEDICAL COLLEGE,HAMPANKATTA
1214 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1215 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1216 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1217 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1218 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1219 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1220 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1221 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1222 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1223 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1224 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1225 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1226 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1227 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1228 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1229 FALKAN PVT LTD COURT ROAD MAGAM, BUDGAM, J&K
1230 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1231 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1232 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1233 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1234 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1235 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1236 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1237 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1238 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1239 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1240 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1241 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1242 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1243 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1244 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1245 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1246 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1247 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1248 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1249 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1250 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1251 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1252 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1253 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1254 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1255 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1256 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1257 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1258 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1259 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1260 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1261 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1262 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1263 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1264 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1265 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1266 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1267 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1268 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1269 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1270 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1271 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1272 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1273 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1274 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1275 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1276 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1277 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1278 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1279 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1280 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1281 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1282 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1283 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1284 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1285 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1286 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1287 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1288 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1289 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1290 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1291 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1292 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1293 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1294 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1295 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1296 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1297 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1298 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1299 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1300 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1301 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1302 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1303 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1304 GARV FOUNDATION AGAR NAGAR RAILWAY ROAD, NABHA
1305 GARV SHIKSHAN SANSTHA PURAI BHILAI
1306 GARV SHIKSHAN SANSTHA MALVIYA NAGAR DURG PURAI, UTAI, BHILAI
1307 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1308 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1309 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1310 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1311 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1312 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1313 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1314 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1315 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1316 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1317 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1318 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1319 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1320 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1321 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1322 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1323 GENUINESOFT ST.HINDUCOLLEGE ROAD
1324 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1325 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1326 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1327 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1328 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1329 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1330 GET SOURCE EDUCATION PRIVATE LIMITED 324-C,MODEL TOWN
1331 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1332 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1333 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1334 GFHDYHDBAH QSDWEFWE
1335 GFHDYHDBAH VSGYCGDHFGSDY
1336 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1337 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1338 GIMIT E SERVICES GIMIT BUILDING H-11 SOUTH EXTENTION PART 1
1339 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1340 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1341 GITANJALI FOUNDATION GITANJALI BUILDING, VILL-BARABAGAN, PO-BARABAGAN, PS-SURI,
1342 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1343 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1344 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1345 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1346 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1347 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1348 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1349 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1350 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1351 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1352 GK FOUNDATION 36/B KALKAJI NEW DELHI
1353 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1354 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1355 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1356 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1357 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1358 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1359 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1360 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1361 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1362 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1363 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1364 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1365 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX,DAKBANGLOW CHOWK,OPP. PUNJAB & SINDH BANK, PATNA - 1
1366 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY PARIJAT COMPKEX, 1ST FLOOR,OPP - PUNJAB & SINDH BANK, DAKBUNGLOW CHOWK, PATNA, BIHAR
1367 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX, DAKBANGLOW CHOWK, OPP.PUNJAB & SINDH BANK, PATNA - 1
1368 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1369 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1370 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1371 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1372 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1373 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1374 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1375 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE, RAMBAGH ROAD, MUZAFFARPUR BO: 2ND FLOOR, MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1376 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1377 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1378 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1379 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1380 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1381 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1382 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1383 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1384 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1385 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101,
1386 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1387 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1388 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1389 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1390 GLOWDOWN SERVICES PRIVATE LIMITED MADHUKUNI, 2 FLOOR, BANK COLONEY, NEAR UNION BANK OF INDIA
1391 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1392 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1393 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1394 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1395 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1396 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1397 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1398 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR,PO+PS-CHANDRAKONA
1399 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
1400 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1401 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1402 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1403 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1404 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1405 GOODWORTH FOREX AND SERVICES PVT LTD A-276, BASEMENT, SHIVALIK, NEW DELHI
1406 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1407 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1408 GOPAL KIRAN SIKSHA AVAM SANSKRITIK SAMITI NIMRAJE SADAN, NEW MOHAN NAGAR, THATIPUR
1409 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1410 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST JONIHA FATEHPUR
1411 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1412 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1413 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1414 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1415 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1416 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1417 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1418 GOYAL CREATION PVT LTD OFFICE A-150(B),AMBAJI INDUSTRIAL AREA.SANTPUR,ABUROAD
1419 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1420 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1421 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1422 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1423 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1424 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1425 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1426 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1427 GRAMDEEP MADHUBANI VILL - GOSAITOL, POST - RAGHOPURBALAT,VIA - RAMPATTI, DIST. - MADHUBANI, BIHAR.
1428 GRAMDEEP MADHUBANI GOSAITOLA, PO - RAGHOPUR BLAT, VIA- RAMPATTI, DIST.- MADHUBANI, BIHAR
1429 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1430 GRAMIN BAL EVAM MANAV VIKAS SAMITI AT JAGIRMAHESHKHUNT GRAM, PO: HALDHARA HAAT, PANCHAYAT: LAXMIPUR, BLOCK: KURSAKANTA, DISTT: ARARIA, PINCODE: 854331 (BIHAR)
1431 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1432 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1433 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1434 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR
1435 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR, GUJARAT-384315
1436 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1437 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1438 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1439 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1440 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1441 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1442 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1443 GRAMIN VIKAS SEVA SANSTHAN VILL POST TARIA LACCHIRAM KUSHINAGAR U.P
1444 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1445 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD NEAR KOTWALI SAHARA INDIA OFFICE 02ND FLOOR, MOHALLA- MURLIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1446 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD, NEAR KOTWALI, SAHARA INDIA 02ND FLOOR, MOHALLA- MULIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1447 GRAMIN VIKAS SEWA SAMITI MOHALLA- SHAKITI NAGAR POST- GANDHI NAGAR DISTRICT- BASTI, UTTAR PRADESH
1448 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1449 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1450 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1451 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1452 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1453 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1454 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1455 GRAM SHIKSHAN EVAM VIKAS SAMITI VILL +POST KAHLA MALIHABAD LUCKNOW
1456 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1457 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1458 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1459 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1460 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1461 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1462 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1463 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1464 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1465 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1466 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1467 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1468 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1469 GREEN INDIA FOUNDATIONAL TRUST 4/66-1 SUMANGALINAGAR, PURATHAUDI, TRICHY.
1470 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1471 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1472 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1473 GREEN VIEW EDUCATIONAL AND SKILLS INDIA PVT LTD PRADHAN COMPLEX THAKUR MARKET MAIN ROAD MAIRWA DHAM MAIRWA SIWAN BIHAR
1474 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1475 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1476 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1477 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1478 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR, PHASE-1, DELHI.
1479 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR PHASE-1, DELHI.
1480 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1481 GROWTH FOUNDATION OF INDIA L-46A, MALVIYA NAGAR NEW DELHI-110017
1482 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1483 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1484 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1485 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1486 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1487 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1488 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1489 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1490 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1491 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1492 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1493 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1494 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1495 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1496 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1497 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1498 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1499 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1500 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1501 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1502 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1503 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1504 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1505 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1506 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1507 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1508 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1509 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1510 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1511 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
1512 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1513 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1514 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1515 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
1516 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1517 GYAN KALP CHARITABLE TRUST INDIC HEIGHTS, AT/PO-MUKTAPUR, KHORDHA
1518 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1519 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1520 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1521 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1522 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1523 HAIR RAISERZ SCO 27, SECTOR 15C, CHANDIGARH
1524 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1525 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
1526 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1527 HANKER SOLUTIONS PVT LTD B610, LOGIX TECHNOVA, SECTOR 132, NOIDA
1528 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1529 HAPPINESS FOR ALL WELFARE AND EDUCATION SOCIETY 1ST FLORE SAMADHAN CAREER ACADEMY TANDON BAGICHA DAMOH 470661
1530 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1531 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1532 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1533 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1534 HARIBALA TRUST 2/173,HARIBALA ILLAM, T PUDUR, SIVAGANGAI TAMILNADU
1535 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1536 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1537 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1538 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1539 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1540 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1541 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1542 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1543 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1544 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1545 HARSH PVT LTD SDFAAFDSSDF
1546 HARYANA ESTATE SOLUTIONS HARYANA ESTATE SOLUTIONS,SHOP NO.-1,GROUND FLOOR,NEAR FOOD HUB SEC 37,MAIN SECTOR ROAD,BASAI ENCLAVE EXTN. ,GURGAON 122001
1547 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1548 HASAN EDUCATIONAL SOCIETY HASAN EDUCATIONAL SOCIETY MAIN ROAD VPO JAULA TEHSIL BUDHANA DIST MUZAFFARNAGAR UTTAR PRADESH PIN 251309
1549 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1550 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1551 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1552 HEAD HELD HIGH FOUNDATION VILLA 21-22, PALM MEADOWS, PHASE-1, RAMAGONDANAHALLI, WHITEFILED ROAD, BANGALORE
1553 HEAD HELD HIGH FOUNDATION 22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1554 HEAD HELD HIGH FOUNDATION NO.22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1555 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
1556 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1557 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1558 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1559 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1560 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1561 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1562 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1563 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
1564 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1565 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414 BLOCK NO 22,23,24,25
1566 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414,BLOCK NO 22/23/24/25 HUMNABAD ,BIDAR
1567 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1568 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1569 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
1570 HELPING HAND WELFARE SOCIETY REG.OFFICE VILL SARSOPAR POST BHUSWAL BU DIST GORAKHPUR 273403 HEAD OFFICE- BHITAHA, KAURIRAM GORAKHPUR-273413
1571 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1572 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1573 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1574 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1575 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1576 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
1577 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
1578 HEWTECH SYSTEM C-2, JAIPRAKASH NAGAR ASHIYANA, PATNA, BIHAR
1579 HGXDNG CBGNCBNMCNFMHXFVM
1580 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1581 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1582 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1583 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1584 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1585 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1586 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1587 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1588 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1589 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1590 HINDUSTANI TANZEEM FROGHE ILMOFUN FLAT NO. 202, KALYANI COMPLEX, LANGERTOLI CHAURAHA, PATNA - 800004
1591 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1592 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
1593 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1594 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1595 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1596 HIREEX CAREER SOLUTIONS SHOP NO 1 AND 2 KAPEESH MALL, M G ROAD MULUND WEST MUMBAI 400080
1597 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1598 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1599 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1600 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1601 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
1602 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1603 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1604 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1605 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1606 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1607 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1608 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1609 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1610 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1611 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1612 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1613 HRDS INDIA HRDS INDIA DOOR NO: XIV/273, NEAR POST OFFICE, CHANDRANAGAR,PALAKKAD,KERALA
1614 HRDS INDIA THE HIGHRANGE RURAL DEVELOPMENT SOCIETY HRDS INDIA, XIV/273, NEAR POST OFFICE, CHANDRANAGAR, PALAKKAD, KERALA, INDIA
1615 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1616 HSADALO FFSE
1617 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1618 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1619 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1620 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1621 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
1622 HUMANITY WELFARE SOCIETY 860/22, LANE NO. 2 AMBA VIHAR MUZAFFARNAGAR
1623 HUMANITY WELFARE SOCIETY 860/22, LANE NO.2, AMBA VIHAR MUZAFFARNAGAR
1624 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1625 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1626 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1627 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1628 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
1629 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1630 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1631 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1632 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1633 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1634 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1635 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1636 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1637 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1638 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1639 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1640 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA, DHAKOLI ZIRAKPUR, MOHALI PUNJAB
1641 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1642 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
1643 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1644 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1645 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
1646 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
1647 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1648 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1649 ICTPMU DDUGKY TEST NEW DELHI
1650 ICTPMU TEST11 NEW DELHI110001
1651 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1652 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1653 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1654 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1655 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1656 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1657 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1658 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1659 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1660 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1661 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1662 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1663 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1664 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1665 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1666 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1667 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1668 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1669 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1670 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1671 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1672 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1673 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1674 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1675 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1676 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1677 IMPULSIVE SOCIAL AWARENESS COMMITTEE WARD NO 02 JAWALAMUKHI MOHLLA SIHORA DIST.JABALPUR M.P.
1678 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1679 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1680 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1681 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1682 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1683 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1684 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1685 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1686 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1687 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1688 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1689 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1690 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1691 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR SHIBPUR BOTANIC GARDEN HOWRAH
1692 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR POST OFFICE BOTANIC GARDEN SHIBPUR HOWRAH WEST BENGAL
1693 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1694 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1695 INDIAN INSTITUTE OF HARDWARE TECHNOLOGY LIMITED #15, SRI LAKSHMI COMPLEX, 4TH FLOOR , ST MARKS ROAD BANGALORE-560001
1696 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1697 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1698 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1699 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1700 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1701 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1702 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1703 INDIAN MEDICAL TRUST NIMS UNIVERSITY DELHI JAIPUR HIGHWAY JAIPUR
1704 INDIAN MEDICAL TRUST 4, GOVIND MARG, NEAR MOTI DUNGRI CIRCLE, JAIPUR
1705 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
1706 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1707 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
1708 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
1709 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PRIVATE LIMITED B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BR 800004 INDIA
1710 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PVT LTD B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BIHAR INDIA
1711 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1712 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1713 INDO AMERICAN FRIENDS GROUP TEHSIL ROAD , SALON , RAEBARELI , UTTERPRADESH
1714 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1715 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1716 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1717 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1718 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5000/ PHASE - 4 GIDC, VATVA, MEHMEDABAD ROAD, AHMEDABAD, GUJARAT
1719 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5003 PHASE-4,GIDC,VATVA MEHMDABAD ROAD,AHMEDABAD-382445 GUJARAT
1720 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1721 INDOSYS WELFARE SOCIETY OPP. UNIVERSITY CAMPUS, TALWANDI SABO
1722 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1723 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1724 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1725 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1726 INDRAKAMAL CHARITABLE TRUST MUKHERRJEE, HATA, ARA, BHOJPUR, BIHAR, INDIA
1727 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1728 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1729 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1730 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1731 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1732 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1733 INDUS FOUNDATION 156-GA, UMAR PUR NIWA, NEAE NEHRU PARK,DHOOMANGANJ, ALLAHABAD,U.P.-211001, INDIA
1734 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1735 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1736 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1737 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1738 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1739 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
1740 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1741 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
1742 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1743 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1744 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1745 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1746 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1747 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1748 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED, 21-1-60, 3RD FLOOR JANDYALA VAARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA, TENALI - 522201, GURNTUR DISTRICT, ANDHRA PRADESH, INDIA
1749 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED 21-1-60,3RD FLOOR JANDYALA VARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA,TENALI
1750 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
1751 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
1752 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR, 21ST. CENTURY PLAZA, SECTOR 8 COMM. CENTRE, ROHINI, DELHI
1753 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR 21ST. CENTURY PLAZA, SECTOR 8 COMM CENTRE, NEAR ICICI BANK ROHINI, DELHI
1754 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1755 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1756 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1757 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1758 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1759 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
1760 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
1761 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1762 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1763 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1764 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1765 INSTITUTE OF ENVIRONMENT AND ECO DEVELOPMENT SHYAM NAGAR COLONY, MAURYAPATH, P.O.- B.V.COLLEGE, KHAJPURA, PATNA(BIHAR)
1766 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA
1767 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1768 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1769 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
1770 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT HO:GI-31,ANUKAMPA-II,KALINDIPURAM PHASE II,ALLAHABAD-211011 48/9,SRK TOWER,ELGIN ROAD,CIVIL LINES ALLAHABAD-211001 U.P.
1771 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT 48/9,SRK TOWER,ELGIN ROAD ,CIVIL LINES,ALLAHABAD-211001 U.P.
1772 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
1773 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
1774 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
1775 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
1776 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
1777 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
1778 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
1779 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
1780 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
1781 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
1782 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
1783 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
1784 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
1785 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
1786 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
1787 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
1788 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
1789 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
1790 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
1791 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
1792 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
1793 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
1794 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET, POLUR TALUK,TIRUVANNAMALAI DISTRICT, TAMILNADU.
1795 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET,POLUR TOWN,TIRUVANNAMALAI DITRICT,TAMILNADU.
1796 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1797 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1798 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
1799 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
1800 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
1801 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
1802 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
1803 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
1804 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
1805 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
1806 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
1807 ISHAN JAN SEVA SANSTHAN K-206,YASHODA NAGAR,KANPUR
1808 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
1809 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
1810 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
1811 ISTI EDUCATION PRIVATE LIMITED E-15, BASEMENT, LAJPAT NAGAR-I, NEW DELHI
1812 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
1813 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
1814 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
1815 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
1816 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
1817 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
1818 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
1819 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
1820 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
1821 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
1822 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE;26GANESH CHANDRA AVENUE KOLKATA MAILING ADDRESS;BUDGE BUDGE INSTITUTE OF TECHNOLOGY BUDGE BUDGE KOLKATA
1823 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE :26,GANESH CHANDRA AVENUE,KOLKATA 700013 MAILING ADDRESS: BUDGE BUDGE INSTITUTE OF TECHNOLOGY, BUDGE BUDGE, KOLKATA
1824 JAGANNATH GUPTA FAMILY TRUST NISCHINTAPUR, BUDGE BUDGE
1825 JAGAN RAJ PROFESSIONAL STUDIES PVT LTD 223,PRATAP NAGAR HOUSING SOCIETY,VASHISHATH MARG,VAISHALI NAGAR,JAIPUR,RAJ.
1826 JAGDAMBA TECHNICAL SOCIAL ORGANISATION AT & PO BHAMBLA TEH SARKAGHAT DISTT MANDI HP
1827 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
1828 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
1829 JAGO GAON VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR
1830 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
1831 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1832 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1833 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
1834 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
1835 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
1836 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
1837 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
1838 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
1839 JAHNAVI TECHNICAL EDUCATIONAL SOCIETY JAHNAVI INSTITUTE OF MULTIMEDIA TECHNOLOGY C/O JAHNAVI DIGITAL STUDIO, BRIDGE ROAD, NEAR 7 ROAD JUNCTION, OPP : SBI ATM, SRIKAKULAM-532001 ANDHRA PRADESH
1840 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
1841 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
1842 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1, GOMTINAGAR
1843 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
1844 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
1845 JAIN COMPUTER ACADEMY SAMITI WARD NO 01 MAHATMA GANDHI WARD BANDA BELAI
1846 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
1847 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
1848 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
1849 JAISHREEHARI JANKALYAN AVAM SHIKSHA PRASAR SMITI NEAR BY ATTA CHAKKI ,H.NO 1,BLOCK-A,SHASTRI NAGAR BHIND ,MADHYAPRADESH
1850 JAI SIKSHAN SAMITY WARD NO. 21 BHALESAR ROAD, MAHASAMUND
1851 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
1852 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
1853 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
1854 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
1855 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
1856 JANASNEHI SOCIAL WELFARE SOCIETY SHIGGAON JANASNEHI SOCIAL WELFARE SOCIETY BVK PLAZA NEAR JMFC COURT COMPLEX, MAIN ROAD HANGAL-581104
1857 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
1858 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
1859 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1860 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1861 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
1862 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1863 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
1864 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1865 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
1866 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
1867 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
1868 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
1869 JAN KALYAN SAMITI JAIN
1870 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
1871 JAN KALYAN SHIKSHA SAMITI A-1413/3
1872 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
1873 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
1874 JANKI DEVI EDUCATIONAL WELFARE SOCIETY 74/35, RAJPUR ROAD, OPP. HOTEL MADHUBAN DEHRAUN
1875 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
1876 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
1877 JAN SAHARA SARAI VILL + PO - SARAI,PS - MANER, DIST- PATNA
1878 JAN SAHARA SARAI VILL + PO- SARAI, PS - MANER, DIST - PATNA
1879 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
1880 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
1881 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
1882 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
1883 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1884 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
1885 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
1886 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
1887 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1888 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
1889 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
1890 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
1891 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
1892 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
1893 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
1894 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
1895 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
1896 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
1897 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
1898 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
1899 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1900 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
1901 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1902 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
1903 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
1904 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
1905 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
1906 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
1907 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
1908 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
1909 JB PLASTOCHEM PRIVATE LIMITED JAIN FOOD COMPOUND, GUT NO. 43/B/2, N. H. NO. 06, SAVKHEDA (BK.)
1910 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
1911 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1912 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
1913 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU, KOZHIKODE.
1914 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
1915 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE,JAMIATH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
1916 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
1917 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
1918 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1919 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1920 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
1921 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
1922 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
1923 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
1924 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
1925 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
1926 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
1927 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
1928 JEEVANTI SEWA SAMITI 9, CIVIL LINES VIDISHA
1929 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
1930 JFJGF 9ODPJ
1931 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
1932 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
1933 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
1934 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
1935 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
1936 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
1937 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
1938 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
1939 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI
1940 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI BANDIPORA JAMMU AND KASHMIR
1941 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
1942 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
1943 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
1944 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1945 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
1946 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1947 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
1948 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD.
1949 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
1950 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1951 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
1952 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1953 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1954 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
1955 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
1956 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
1957 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1958 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1959 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
1960 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
1961 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
1962 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
1963 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
1964 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
1965 JUPITER CRAFTS PLOT NO 55 – A, E.P.I.P., PHASE I, JHARMAJRI,BADDI,DISTT-SOLAN, HIMACHAL PRADESH
1966 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
1967 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
1968 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
1969 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1970 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1971 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1972 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1973 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1974 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1975 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
1976 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
1977 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
1978 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING 3RD FLOOR, ZODIN SQUARE
1979 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
1980 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
1981 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
1982 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
1983 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1984 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1985 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
1986 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1987 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
1988 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
1989 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
1990 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
1991 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
1992 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
1993 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
1994 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
1995 KALPATARU GRAMODYOG SAMITI JUNIOR HIG 9 KEHKASHA APT KOH-E-FIZA BHOPAL
1996 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
1997 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
1998 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
1999 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
2000 KALVI INSTITUTE PRIVATE LIMITED NO.9-1-66, DOUBLE AGRAHARAM STREET, SHOLAVANDAN, MADURAI, TAMIL NADU - 625214
2001 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2002 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2003 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
2004 KALYANSUNDARAM WELFARE AND EDUCATIONAL TRUST G01, VASUDEO CITY,RAJENDRA PATH, BENI BABU KA BAGAICHA,NEAR ASHIYANA HYUNDAI SHOWROOM, PATNA BIHAR
2005 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
2006 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
2007 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
2008 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
2009 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2010 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2011 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
2012 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
2013 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
2014 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
2015 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
2016 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED HOUSE NO-15,PLOT NO-1149,GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA
2017 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
2018 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
2019 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
2020 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
2021 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
2022 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GHALIB GHS, PITAMPURA NEW DELHI
2023 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GROUND FLOOR GHALIB APARTMENT PITAMPURA NEW DELHI
2024 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
2025 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2026 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2027 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2028 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
2029 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
2030 KANPUR SUBHASH SHIKSHA SAMITI 127/470, W-1, SAKET NAGAR, KANPUR
2031 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
2032 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
2033 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
2034 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
2035 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
2036 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
2037 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
2038 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
2039 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2040 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2041 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
2042 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
2043 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
2044 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
2045 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
2046 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
2047 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
2048 KASHA GOUD EDUCATIONAL SOCIETY VINAYAKA NAGAR NIZAMABAD
2049 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
2050 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
2051 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
2052 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
2053 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
2054 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
2055 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
2056 KATYANI ENERGY SOLUTION PRIVATE LIMITED HEAD OFFICE: A-86, 3RD FLOOR, MCD NO. – 944, ARJUN NAGAR, KOTLA MUBARAKPUR, NEW DELHI
2057 KATYANI ENERGY SOLUTION PVT LTD WZ 490/A BRITANNIA CHOW SRI NAGAR NEW DELHI
2058 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2059 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2060 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2061 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
2062 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
2063 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
2064 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
2065 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
2066 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
2067 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
2068 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
2069 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
2070 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
2071 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
2072 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
2073 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2074 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2075 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2076 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2077 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2078 KAYZEY SOCIETY MAWNGAP MAWSMAI
2079 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
2080 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
2081 KENDRIYA BHANDER B-1 SHYAMALI HOUSING ESTATE, SALT LAKE CITY, KOLKTA
2082 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
2083 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
2084 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
2085 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
2086 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
2087 KGVK NEORI VIKAS RUKKA RANCHI
2088 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
2089 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
2090 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
2091 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
2092 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
2093 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
2094 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
2095 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
2096 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
2097 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2098 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2099 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
2100 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
2101 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
2102 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2103 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2104 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
2105 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
2106 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
2107 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
2108 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
2109 KISAN SEWA SANSTHAN MAHESH BHAWAN, AWAS VIKAS COLONY, KATRA, BASTI U.P.-272001
2110 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
2111 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
2112 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
2113 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
2114 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
2115 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
2116 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
2117 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
2118 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
2119 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
2120 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
2121 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
2122 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
2123 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2124 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2125 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
2126 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
2127 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
2128 KOMAL CONSTRACTION COMPANY MAIN BAZAR ROAD, DANTA, TEHSIL DANTARAMGARH,DIST. SIKAR RAJSTHAN PIN 332701
2129 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
2130 KORAZON TECHNOLOGIES PRIVATE LIMITED KORAZON TECHNOLOGIES PVT. LTD. IMRAN COMPLEX 1ST FLOOR OPPOSITE WOODLAND RESTAURANT,ULUBARI ,G.S ROAD GWAHATI.
2131 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
2132 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
2133 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
2134 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
2135 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
2136 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
2137 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2138 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2139 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
2140 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
2141 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
2142 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
2143 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
2144 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
2145 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
2146 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
2147 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
2148 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
2149 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
2150 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
2151 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
2152 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
2153 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
2154 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
2155 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
2156 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
2157 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
2158 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
2159 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
2160 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
2161 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A1/28 JANAK PURI, MAIN NAJAFGARH ROAD, OPPOSITE METRO PILLAR NO. - 626, NEW DELHI - 110058
2162 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
2163 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
2164 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2165 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2166 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
2167 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
2168 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD ,PARGANA, DISTT SHIVPURI,
2169 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS IIT BOMBAY POWAI
2170 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS POWAI
2171 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2172 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2173 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
2174 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
2175 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
2176 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
2177 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
2178 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
2179 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
2180 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
2181 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
2182 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
2183 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
2184 LAL BAHADUR SHIKSHA SAMITI KATKAR TEHSIL HINDAUN, DIST. KARAULI, RAJSTHAN PINCODE 322234
2185 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
2186 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
2187 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UP, INDIA
2188 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UTTAR PRADESH
2189 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
2190 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
2191 LATE LALA BARU MAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA
2192 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2193 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2194 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
2195 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
2196 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
2197 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2198 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2199 LBS LNS HBJHCDJNSJBSBCANM
2200 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
2201 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
2202 LC EDUCATION SOCIETY 9-A, GALI NO 12, JAWAHAR NAGAR, HISAR - HARYANA
2203 LC EDUCATION SOCIETY 9-A, GALI NO.12, JAWAHAR NAGAR, HISAR
2204 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
2205 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
2206 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
2207 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
2208 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
2209 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
2210 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
2211 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
2212 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
2213 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
2214 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
2215 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
2216 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
2217 LIFE CIRCLE HEALTH SERVICES PRIVATE LIMITED T HUB, IIIT HYDERABAD CAMPUS, GACHIBOWLI
2218 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
2219 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
2220 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
2221 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
2222 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD.
2223 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
2224 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
2225 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
2226 LIGHTNING INDIA FOUNDATION FOR EXCELLENCE GIRDHARI NAGAR, JAROTHI ROAD NEAR BHARAT GAS GODOWN HAPUR UTTAR PRADESH
2227 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
2228 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2229 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2230 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
2231 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
2232 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2233 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2234 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
2235 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
2236 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
2237 LITCHITREE SKILLS AND SOLUTIONS PVT LTD MIG(S)-1,PRAGATI ENCLAVE,NEAR ST.XAVIAR HIGH SCHOOL,BHUBANESWAR
2238 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
2239 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
2240 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
2241 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
2242 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
2243 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA.
2244 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA
2245 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
2246 LOK SEVA KENDRA VILL - KARPI, KARPI SHERPUR MAIN ROAD, PO.- KARPI, DIST.- ARWAL, BIHAR
2247 LOK SEVA KENDRA VILL KARPI, SHERPUR ROAD,DIST.- ARWAL, BIHAR
2248 LOK SEVA KENDRA VILL - KARPI SHERPUR MAIN ROAD, ARWAL, BIHAR.
2249 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
2250 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
2251 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
2252 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
2253 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
2254 LOYAL ENVIRONMENTAL AWARENESS AND PROTECTION SOCIETY 115,116,PUDUCHERRY IT PARK, PEC CAMPUS,PILLAICHAVADY,ECR ROAD, PUDUCHERRY -605014
2255 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
2256 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
2257 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
2258 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
2259 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
2260 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
2261 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
2262 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
2263 LUIT VALLEY ENGINEERING PRIVATE LIMITED H. NO. 51 & 52, M. E. ROAD, BYE LANE 01, PALTAN BAZAR, GUWAHATI 781008 ASSAM, INDIA
2264 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN MAHARANA PRATAP NAGAR GUMNAWARA PICHHOR ROAD JHANSI
2265 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2266 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2267 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2268 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
2269 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
2270 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2271 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
2272 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2273 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
2274 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
2275 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
2276 MAA PURNAGIRI JAN KALYAN SAMITI H.NO.-3 VANGOAN NITHOLI ROAD (NEAR OM SWEET BHANDHAR) ETAH U.P
2277 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
2278 MAA SARADA KRISHI VIGYAN MANDIR NAZARGANJ,NEAR-3 NO PUMP HOUSE PO-MIDNAPORE
2279 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
2280 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
2281 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
2282 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2283 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2284 MAA UMA ELECTRONIC TRAINING INSTITUTE HIG-102,PUSHPUM APPARTMENT, NEAR BHARAT TALKIES BHOPAL M.P.
2285 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
2286 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
2287 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
2288 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
2289 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
2290 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST, CUDDALORE.
2291 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST CUDDALORE
2292 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
2293 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
2294 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2295 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2296 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
2297 MAGNUM SUPER DISTRIBUTORS INDIA PRIVATE LIMITED KALANIKETAN - I, VAISHALI NAGAR, KOTRA SULTANABAD, BHOPAL
2298 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
2299 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
2300 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
2301 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2302 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2303 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
2304 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2305 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2306 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
2307 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
2308 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
2309 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
2310 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
2311 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
2312 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
2313 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
2314 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
2315 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
2316 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
2317 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2318 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2319 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2320 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
2321 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
2322 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
2323 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
2324 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
2325 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
2326 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
2327 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2328 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2329 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
2330 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
2331 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2332 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2333 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
2334 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
2335 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
2336 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2337 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
2338 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2339 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2340 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
2341 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
2342 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
2343 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
2344 MAHIMA FIBRES PVT LTD 406, CORPORATE HOUSE, 4TH FLOOR 169 R.N.T. MARG INDORE MP
2345 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
2346 MAHISHADAL RAJ COLLEGE NAAC ACCREDITED GRADE A COLLEGE MAHISHADAL RAJ COLLEGE, POST OFFICE: MAHISHADAL, DISTRICT: PURBAMEDINIPUR, PIN: 721628, WEST BENGAL.
2347 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
2348 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
2349 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
2350 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
2351 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
2352 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
2353 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
2354 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2355 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2356 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
2357 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2358 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2359 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
2360 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
2361 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
2362 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2363 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2364 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
2365 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
2366 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
2367 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
2368 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2369 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2370 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
2371 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
2372 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
2373 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
2374 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
2375 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
2376 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
2377 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
2378 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
2379 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V-EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2380 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V - EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2381 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
2382 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
2383 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
2384 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
2385 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
2386 MANUMATA BAHUUDDESHIYA SANSTHA JALGAON 10, SAMARTH COLONY, ABOVE UNION BANK ATM, MJ COLLEGE ROAD, JALGAON DIST. JALGAON - 425001
2387 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
2388 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
2389 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
2390 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
2391 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
2392 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2393 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2394 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
2395 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
2396 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
2397 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
2398 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
2399 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
2400 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
2401 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
2402 MAS CALLNET INDIA PRIVATE LIMITED A-94/10 SECTOR-58 NOIDA
2403 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
2404 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
2405 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
2406 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
2407 MATA KITAB KAUR MEMORIAL WELFARE SOCIETY OPPOSITE ITI,SURATGHAR ROAD, HANUMANGHAR JN. RAJSTHAN
2408 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
2409 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
2410 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITI SUNHERA ROAD SABALGARH MORENA M.P.
2411 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
2412 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
2413 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
2414 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
2415 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
2416 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
2417 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2418 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2419 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
2420 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
2421 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
2422 MAYOCARE HEALTH PRIVATE LIMITED 538, IST FLOOR, TRANSPORT NAGAR, NEAR DHARMVEER MURTI,IN FRONT OF MUNDERA MANDI, ALLAHABAD
2423 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
2424 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
2425 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
2426 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
2427 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
2428 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
2429 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2430 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2431 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
2432 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET
2433 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
2434 MEDIWORLD EDUCATIONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEW DELHI
2435 MEDIWORLD EDUCATIOONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEAR FATHER AGNEL SCHOOL
2436 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
2437 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
2438 MEERA INSTITUTE OF TECHNOLOGY AND MANAGEMENT PRIVATE LIMITED 538/5-C, BANKERS COLONY JHANSI
2439 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
2440 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
2441 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
2442 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
2443 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
2444 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
2445 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2446 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2447 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
2448 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
2449 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
2450 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
2451 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
2452 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
2453 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
2454 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
2455 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
2456 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
2457 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
2458 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
2459 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2460 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2461 METORES ISPAT PRIVATE LIMITED METORES ISPAT PRIVATE LIMITED, O-12, CIVIL TOWNSHIP, ROURKELA ORISSIA
2462 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
2463 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI,BEHIND HOTEL MAAN,GULAB BAGH ROAD, UDAIPUR
2464 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI BEHIND HOTEL MAAN , GULAB BAGH ROAD, UDAIPUR
2465 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2466 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2467 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
2468 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
2469 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
2470 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
2471 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
2472 MIDNAPUR UNIQUE EDUCARE EDUCATIION WELFARE SOCIETY VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
2473 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
2474 MIGS EDUCTECH PRIVATE LIMITED A-86, DDA SHED, OKHLA INDUSTRIAL AREA, PHASE-2, NEW DELHI
2475 MILE MULTIMURPOSE FOUNDATION WARDHA
2476 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
2477 MILKY FASHION CLOTHES PRIVATE LIMITED B-68, CHANAKYA PLACE, JANAKPURI, DELHI
2478 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
2479 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
2480 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
2481 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
2482 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
2483 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
2484 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
2485 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
2486 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
2487 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
2488 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
2489 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
2490 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
2491 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
2492 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2493 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2494 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2495 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2496 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
2497 MITR PROMOTERS PRIVATE LIMITED 139,NOBEL ENCLAVE,SECTOR-22,BEHIND ROTARY PUBLIC SCHOOL,GURGAON,HARYANA-122001.
2498 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
2499 MMCC SKILL FOUNDAION S.C.O-192,195 SECTOR-16
2500 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
2501 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
2502 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
2503 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
2504 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2505 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2506 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2507 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
2508 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2509 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
2510 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
2511 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
2512 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
2513 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
2514 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
2515 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
2516 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
2517 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
2518 MOHAMMADIA EDUCATIONAL AND WELFARE SOCIETY CHAND COLONY, POST PHULWARI SHARIF, DIST PATNA BIHAR 801505
2519 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
2520 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
2521 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
2522 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
2523 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
2524 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
2525 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
2526 MORD TEST ND
2527 MORD TEST1 SBJFLJ
2528 MORD TEST2 ADVCDS
2529 MORD TEST NEW DELHI ND
2530 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
2531 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
2532 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
2533 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
2534 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2535 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2536 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
2537 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
2538 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
2539 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
2540 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
2541 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
2542 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
2543 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
2544 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
2545 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
2546 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2547 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2548 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
2549 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
2550 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2551 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
2552 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
2553 MS POPULAR AGENCIES 60 B/69B, HEWETT ROAD, ALLAHABAD
2554 MS RAJ ASSOCIATES B1/181, VINEET KHAND, GOMTINAGAR, LUCKNOW (U.P.)
2555 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R K COMPLEX , OPP ARRS SLIKS , HOSUR KRISHNAGIRI , TAMIL NADU 635109. CELL : 9442372741.
2556 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
2557 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
2558 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
2559 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
2560 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
2561 MUKTAI SHIKSHAN PRASARAK MANDAL PULUJWADI TAL-PANDHARPUR DIST-SOLAPUR
2562 MUKTI INDIA FOUNDATION A-105,FIRST FLOOR, ABOVE BANK OF INDIA , OPP. PILLOR NO 749, UTTAM NAGAR
2563 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
2564 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
2565 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
2566 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
2567 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
2568 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
2569 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
2570 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
2571 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
2572 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
2573 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
2574 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
2575 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
2576 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
2577 NALANDA BAHU UDDESHIYA SHIKSHAN SANSTHA GEWARDHA AT POST GEWARDHA TAH KURKHEDA DISTRICT GADCHIROLI
2578 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
2579 NALANDA EDUCATION AND RESEARCH CHARITABLE TRUST C/O - SG INSTITUTE OF SYSTEMATIC EDUCATION VILLAGE + P.O. - MURGAWAN,
2580 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
2581 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
2582 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
2583 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR. MHOW, TEHSIL MHOW DISTT. - INDORE
2584 NANAK SINGH RAWAT SHIKSHA SAMITI C-2252, JAWAHAR NAGAR MHOW, TEHSIL MHOW DISTT. INDURE (M.P.)
2585 NANAK SINGH RAWAT SHIKSHA SAMITI C-252,JAWAHAR NAGAR,MHOW,TEHSIL-MHOW,DISTT. INDORE
2586 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
2587 NANAK SINGH RAWAT SHIKSHA SAMITI C-232, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
2588 NANDI SHIKSHA AWAM SAMAJIK SANSTHAN BRAHMPURI COLONY,DEOBAND SAHARANPUR
2589 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
2590 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
2591 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
2592 NARAYAN EDUCATIONAL SOCEITY FIRST FLOOR DESIGN COMPLEX, IN FRONT OF BDA COMPLEX,PILIBHIT ROAD BAREILLY, UP INDIA-243001
2593 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2594 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2595 NARAYAN TRAINING SERVICES NO 546 OPP RUCHI GARDENS ,B H ROAD PRASHANTHNAGAR,NAGAPPA BLOCK , GOWRIBIDANUR,CHIKKABALAPUR DISTRICT , KARNATAKA
2596 NARAYAN TRAINING SERVICES NO 546,OPP RUCHI GARDENS, BH ROAD , PRASHANTHNAGAR, NAGAPPA BLOCK , GOWRIBIDANUR , CHIKKABALLAPUR DISTRICT ,KARNATAKA - 561208
2597 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
2598 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
2599 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
2600 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
2601 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
2602 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
2603 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
2604 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
2605 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
2606 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
2607 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
2608 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2609 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2610 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION C/O MART INFOTECH COLLEGE ANANTNAG NEAR BUS STAND ANANTNAG
2611 NATIONAL EDUCATION AND WALFARE SOCIETY DEGLOOR NEAR BSNL TOWER,TEACHER COLONY,UDGIR ROAD,DEGLOOR DIST.NANDED
2612 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
2613 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
2614 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
2615 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
2616 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
2617 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
2618 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
2619 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
2620 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
2621 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
2622 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
2623 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
2624 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
2625 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
2626 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
2627 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
2628 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
2629 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
2630 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
2631 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
2632 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
2633 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2634 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
2635 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2636 NATIONAL WOMEN DEVELOPMENT TRUST 53 GRAMMASAVADI STREET CUMBUM
2637 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
2638 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
2639 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
2640 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
2641 NATURAL AGROTECH RESEARCH AND PROCESSING SERVICE BLOCK 5 DIC/LBI OPP TUIBONG POST OFFICE
2642 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO,66 B SENGALUNEARODAI STREET, KANCHIPURAM - 631502, TAMIL NADU
2643 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
2644 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
2645 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2646 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2647 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
2648 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
2649 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
2650 NAVACHETHANA MALLAPPALLY INSTITUTE
2651 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
2652 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
2653 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2654 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2655 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2656 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
2657 NAVIGATION EDUCATIONAL AND WELFARE SOCIETY WARD 4 BARTHARA ROAD KHOJAWARE WALA KUWAN KE PASS GOHAD DISTT- BHIND MP
2658 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
2659 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
2660 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
2661 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
2662 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
2663 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
2664 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
2665 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
2666 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
2667 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2668 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2669 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
2670 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
2671 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
2672 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
2673 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
2674 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2675 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
2676 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
2677 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
2678 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
2679 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
2680 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
2681 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
2682 NDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -30203
2683 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
2684 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
2685 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
2686 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
2687 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
2688 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
2689 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
2690 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
2691 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
2692 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
2693 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
2694 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
2695 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
2696 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
2697 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
2698 NEST NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
2699 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
2700 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
2701 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
2702 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
2703 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
2704 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
2705 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
2706 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
2707 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
2708 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
2709 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
2710 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
2711 NEW ERA EDUCATION DEVELOPMENT SOCIETY CO TARA INFOTECH NEAR PS BANK MALL GODOWN ROAD RAMPURA PHUL
2712 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
2713 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
2714 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
2715 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
2716 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
2717 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
2718 NEW LBS SANSTHAN PRATAPGARH ZERO MILE CHOURAHA , PRATAPGARH , RAJASTHAN
2719 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
2720 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
2721 NEW SIMBOL TAKNIKI PRASHIKSHAN SANSTHAN CIVIL LINE KATNI
2722 NEW SWIFT EDUCATION AND EMPLOYMENT CONSULTANCY PRIVATE LIMITED 29/238 KHALSHA CHAMBERS BEAWAR RAOD AJMER
2723 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2724 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
2725 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2726 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
2727 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
2728 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
2729 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
2730 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2731 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
2732 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
2733 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
2734 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
2735 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2736 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2737 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
2738 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
2739 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
2740 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2741 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
2742 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
2743 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
2744 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
2745 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
2746 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
2747 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
2748 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
2749 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
2750 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
2751 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
2752 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
2753 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2754 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2755 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
2756 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
2757 NILANCHAL CHEMICAL AND FERTILIZERS LIMITED C/O RAM RADHIKA MAHAVIDHYALAY GRAM : - CHATIYA POST :- MEHRUNA LAR , SALEMPUR
2758 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
2759 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
2760 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
2761 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
2762 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
2763 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
2764 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
2765 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
2766 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
2767 NIRMALA MAHILA SHILP KALA KENDRA ADARSH NAGAR SECT-1 LAKHIMPUR PUR ROAD SITAPUR
2768 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA, AHMEDABAD-
2769 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
2770 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
2771 NISHKAM SEWA SANSTHAN NEAR 101 NO. RAILWAY GETA, MERTA ROAD TAHSIL MERTA CITY DISTRICT NAGAUR
2772 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, PO - SOUTH SINTHEE, PS - SINTHI,
2773 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, P.S.- SINTHI, P.O.- SOUTH SINTHEE, KOLKATA
2774 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
2775 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
2776 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
2777 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2778 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
2779 NITEOIT SOLUTIONS PVT LTD HYDERABAD: PLOT NO 6, H NO 1-66/4/6, KAVURI HILLS, MADHAPUR, HYDERABAD BANGALORE: NITEOIT, #118, 2ND FLOOR, HORAMAVU CROSS, BANASWADI RING ROAD, BANGALORE – 560043
2780 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
2781 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
2782 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
2783 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2784 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
2785 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
2786 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
2787 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
2788 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 2O/1 SITALA MATA LANE GROUND FLOOR FLAT NO AS6
2789 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SHITALA MATA LANE GROUND FLOOR, FLAT NO- AS 6
2790 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
2791 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
2792 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
2793 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
2794 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
2795 NO EDUCATION RAVINDRA NAGAR RAIPUR
2796 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
2797 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
2798 NORTH EAST INSTITUTE FASHION TECHNOLOGY NEIFT,SECOND FLOOR,(NEXT TO SBI EVENING BRANCH) G.N.B. ROAD,GUWAHATI
2799 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
2800 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
2801 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
2802 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
2803 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
2804 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
2805 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
2806 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
2807 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
2808 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
2809 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
2810 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
2811 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
2812 NRLM SKILLS SAMRAT,CHANKYAPURI
2813 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
2814 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
2815 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
2816 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2817 NST ACADEMY REGD OFFICE : NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2818 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
2819 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
2820 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2821 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2822 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
2823 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
2824 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2825 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
2826 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
2827 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2828 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
2829 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
2830 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
2831 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
2832 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
2833 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
2834 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
2835 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
2836 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
2837 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
2838 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
2839 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
2840 ODISA TECHNICAL AND MANAGEMENT EDUCATIONAL SOCIETY SHREE LAXMI NIVAS , LAXMINAGAR , BABUA BAGICH , COX COLONY , PO INDUSTRIAL ESTATE , JHARSUGUDA DIST JHARSUGUDA ORRISA
2841 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2842 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
2843 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2844 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
2845 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
2846 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
2847 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
2848 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
2849 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
2850 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
2851 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
2852 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
2853 OM SAI CONTRUCTION OM SAI CONSTRUCTION 61/2 MAHAVEER CHOWK NARAYANPUR CHHATTISGARH
2854 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
2855 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH SANGEWAR COPMLEX MAIN ROAD LOHA TQ LOHA DIST NANDED
2856 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH BUS STAND OPPOSITE MAIN ROAD LOHA TQ LOHA DIST NANDED
2857 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
2858 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
2859 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
2860 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
2861 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
2862 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
2863 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
2864 ONEWAY SKILL MANAGEMENT AND TECHNOLOGY PRIVATE LIMITED FLAT NO. 1645-A DHANAS CHANDIGARH
2865 ONFIELDIN PRIVATE LIMITED #16, ANJANAVILAS, S.R. LAYOUT, SRIRAMPURA - II STAGE, MYSORE - 570023
2866 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
2867 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY LEHRAGAGA-148031 DISTT. SANGRUR (PB.)
2868 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY PUNGH, SUNDERNAGAR, DISTT MANDI (HP)
2869 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
2870 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
2871 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
2872 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
2873 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2874 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2875 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
2876 ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
2877 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2878 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
2879 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
2880 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
2881 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
2882 ORION TRUST SAGOLBAND THINGOM LEIKAI
2883 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
2884 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
2885 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2886 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2887 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
2888 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2889 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2890 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2891 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2892 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
2893 ORRISIS ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
2894 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
2895 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
2896 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
2897 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
2898 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
2899 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
2900 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
2901 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
2902 OVER AIR TECHNOLOGIES PRIVATE LIMITED #2385, SECTOR-22C, CHANDIGARH
2903 OVER AIR TECHNOLOGIES PRIVATE LIMITED S.C.O-84/1, SECTOR-58, SHAHI MAJRA MOHALI
2904 OXFORD SHIKHHA PRASAR SANSTHAN TIWARIYAN CHHIBRAMAU, KANNAUJ U.P.
2905 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI U.P. IN CODE-262701
2906 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
2907 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
2908 OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI
2909 OXYGEN INSTITUTE ASE OXYGEN INSTITUTE ASE SETH COLONY ARJUNPURWA
2910 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
2911 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
2912 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
2913 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
2914 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
2915 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2916 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
2917 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2918 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
2919 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
2920 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
2921 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
2922 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
2923 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
2924 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
2925 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
2926 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
2927 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2928 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2929 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
2930 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
2931 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
2932 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
2933 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
2934 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
2935 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
2936 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
2937 PANSI TECHNOLOGIES 101,PANSI HOUSE,NEAR BY PARYAG SOCIETY BUILDING,LOKDHARA KALYAN (E), TISGAON RD, LOKGRAM, KALYAN, MAHARASHTRA 421306
2938 PARAKRAM ASSOCIATION OF GWALIOR ENGINEERS 78-TANSEN NAGAR GWALIOR
2939 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
2940 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
2941 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2942 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2943 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
2944 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
2945 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
2946 PARAMOUNT WELFARE SOCIETY 90/6, SHKTI NAGAR BARI, RAISEN,M.P
2947 PARAMPARA FOUNDATION JF-2/8,BLOCK 2 JANTA FLAT,ARYA KUMAR ROAD,RAJENDRA NAGAR,P.O. RAJENDRA NAGAR,P.S.-KADAMKUAN
2948 PARAMPARA FOUNDATION JF-2/8,BLOCK-2,JANTA FLAT,ARYA KUMAR ROAD,P.O.-RAJENDRA NAGAR,P.S.-KADAMKUAN,PATNA
2949 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
2950 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2951 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2952 PARAS SPORTS AND EDUCATIONAL SOCIETY J.K BUILDING, OPP KHALSA COLLEGE, AMRITSAR
2953 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
2954 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
2955 PARIDHI AT NAYATOLA,BHIKHANPUR PO BHAGALPUR BHAGALPUR
2956 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
2957 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
2958 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
2959 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
2960 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
2961 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
2962 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
2963 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
2964 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
2965 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
2966 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
2967 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
2968 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
2969 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
2970 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
2971 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
2972 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
2973 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
2974 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
2975 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
2976 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
2977 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
2978 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, DAALNWALA
2979 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, OPP. GURUDWARA, DEHRADUN
2980 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
2981 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
2982 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
2983 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
2984 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
2985 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
2986 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
2987 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
2988 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
2989 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
2990 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
2991 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
2992 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
2993 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
2994 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
2995 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
2996 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
2997 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
2998 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
2999 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
3000 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
3001 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
3002 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
3003 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
3004 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
3005 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
3006 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
3007 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
3008 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
3009 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
3010 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
3011 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
3012 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
3013 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
3014 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
3015 PLAN TO EMPOWER F 13/17 B, TF JOGA BAI EXTEN. JAMIA NAGAR OKHLA, NED DELHI
3016 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
3017 PLEASE DELETE TEST APPLICATION TEST IN TEST
3018 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
3019 PLUSTRUST FLAT NO 101, SRI SABARI RESIDENCY, 11-3-397, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD
3020 PLUSTRUST 101, SRI SABARI RESIDENCY, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD.
3021 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
3022 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
3023 POLYVALENT CONSULTING PVT LTD KAKADEO,PLOT NO.-117/L/248, NAVEEN NAGAR, KANPUR
3024 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
3025 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
3026 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
3027 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
3028 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
3029 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
3030 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
3031 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
3032 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
3033 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
3034 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3035 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
3036 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
3037 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
3038 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
3039 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
3040 PRAKALPGRAST KALYANKARI SAMITEE GONDIAS JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA-441601 (MS)
3041 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
3042 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
3043 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
3044 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
3045 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3046 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3047 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3048 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
3049 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
3050 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3051 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3052 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3053 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
3054 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
3055 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
3056 PRATAP SEWA SAMITI GOMATI NAGAR PANCHO PEERAN SULTANPUR
3057 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
3058 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
3059 PRATHYAK SERVICES PRIVATE LIMITED F-16, RING ROAD, ADIL NAGAR LUCKNOW
3060 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
3061 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
3062 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
3063 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
3064 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
3065 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
3066 PREM KUNJ CONSTRUCTION AND ENGG PVT LTD 2 KATEWA NAGAR EXT.,GUJAR KI THARI , NEW SANGANER ROAD JAIPUR
3067 PREMLILA VITHALDAS POLYTECHNIC SNDT WOMENS UNIVERSITY MUMBAI PREMLILA VITHALDAS POLYTECHNIC SIR VITHALDAS VIDYAVIHAR, JUHU ROAD, SANTACRUZ (WEST), MUMBAI-400 049. TELEPHONE: 26608676, 26608493, 26608462, 26606648 EXTN. 253 EMAIL: PVP@PVPSNDT.ORG, PRINCIPAL@PVPSNDT.ORG
3068 PRERANA RUGUDIPARA BALANGIR
3069 PRERANA RUGUDIPARA BALANGIR ODISHA
3070 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
3071 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
3072 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3073 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3074 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3075 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3076 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3077 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3078 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3079 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY, ANANTAPUR(V) ANANTAPUR(M) ANANTAPUR (D) ANHRAPRADESH
3080 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY ANANTAPUR (V&M) ANANTAPUR(D) A.P
3081 PRINCIPAL GOVERNMENT INDUSTRIAL TRAINING INSTITUTE ROPAR NANGAL ROAD, ROPAR
3082 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10 HUDA PARK,NEAR NEW BUS STAND KURUKSHETRA
3083 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
3084 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
3085 PRIX AUTOMATION BASEMENT, SEHRAWAT BHAWAN, OPP. SARASWATI MAHILA COLLEGE, PALWAL, HARYANA
3086 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING., DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR, DIST-AHMEDNAGAR
3087 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
3088 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING, DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR
3089 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
3090 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
3091 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
3092 PRIYA GRIH UDYOG VIKAS AVAM SHIKSHA PRASAR SAMITEE N7/48 R-11 PATEL NAGAR CHHOTIBHIKHARIPUR D.L.W VARANASI
3093 PRIYANKA URBAN AND RURAL DEVELOPMENT ORGANIZATION NO.8 6TH MAIN ROAD NEAR GANGAMMA TEMPLE GANGANAGAR R T NAGAR POST BANGALORE
3094 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
3095 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
3096 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
3097 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3098 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3099 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
3100 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS DOOR NO 30/348 BALAJINAGAR DHARMAVARAM ANANTAPUR (D) ANDHRAPRADESH (S)
3101 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
3102 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
3103 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
3104 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
3105 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, M.J.D. GOVERNMENT P.G. COLLEGE KE PASS, TARANAGAR, DIST.- CHURU
3106 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, NEAR M.J.D. GOVT P.G. COLLEGE, TARANAGAR
3107 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
3108 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
3109 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3110 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3111 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
3112 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
3113 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
3114 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
3115 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
3116 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
3117 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
3118 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
3119 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
3120 PSLMM DG
3121 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
3122 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3123 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
3124 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
3125 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
3126 PUB BARPETA SOCIAL WELFARE SOCIETY VILL- MAZDIA , P.O- PACHIM MAZDIA, P.S- SARTHEBARI, DIST- BARPETA, ASSAM.
3127 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
3128 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
3129 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
3130 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3131 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
3132 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3133 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3134 PUNE CONSULTANCY SERVICES PRIVATE LIMITED REGISTERED ADDRESS : A2-803,GANGA OSIAN MEADOWS,NEAR ADITYA BIRLA HOSPITAL,THERGAON,PUNE PLANT & TRAINING MANAGEMENT ADDRESS : PLOT NO: 116, SURVEY NO: 31/14, KIRTI CLASSIQUE, NEAR KPIT CUMMINS, RAJIV GANDHI INFOTECH PART,PHASE-1, HINJEWADI MARUNJI ROAD.PUNE 411057
3135 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
3136 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
3137 PUNYSHLOK AHILYADEVI MAHILA BAHUUDESHIYA SANSTHA NEAR J.V MEHTA NAVAYUG VIDHYALAY BEHIND AMBIKA KRIDA MANDAL RAILWAY STATION KHAMGAON
3138 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
3139 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3140 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3141 PUTHIYAPATHAIFOUNDATION 2/54A TRICHY ROAD RANGANATHAPURAM SULUR COIMBATORE
3142 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
3143 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
3144 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
3145 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3146 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3147 QUANTUM GLOBAL INFRATECH LTD N1 / 150, IRC VILLAGE, NAYAPALLI, BHUBANESHWAR, ODISHA
3148 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
3149 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
3150 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
3151 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
3152 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
3153 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
3154 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
3155 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
3156 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
3157 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
3158 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3159 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3160 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
3161 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3162 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3163 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
3164 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
3165 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
3166 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
3167 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
3168 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
3169 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3170 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
3171 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
3172 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
3173 RAJA BARIAR EDUCATIONAL WELFARE TRUST VILL-P.O - DOMA VIA KHUSRUPUR DIST-PATNA BIHAR
3174 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3175 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3176 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3177 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
3178 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
3179 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
3180 RAJASTHAN SHIKSHAN PARSHIKSHAN SANSTHAN 77 VIDHYA VIHAR, BEHIND CHETALI ENCLAVE, 5 E CHHOTI
3181 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
3182 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
3183 RAJDHANI EDUTECH ENTERPRISES EW-07,INDRAPRASTH RDA COLONY,RAIPURA,RAIPUR,CHHATISGARH
3184 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
3185 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P)
3186 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P) - 226001
3187 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHIITWAPUR ROAD, LALKUAN, HUSSAINGANJ, LUCKNOW (U.P) - 226001
3188 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
3189 RAJEEV INDUSTRIAL TRAINING AND RESEARCH INSTITUTE 22(A), STATION ROAD OPPOSITE VIKAS DEEP BUILDING,HUSAIN GANJ LUCKNOW
3190 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
3191 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
3192 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
3193 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
3194 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
3195 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
3196 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
3197 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
3198 RAJ SHREE 787
3199 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
3200 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
3201 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
3202 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
3203 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
3204 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
3205 RAM MORADABAD
3206 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
3207 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
3208 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
3209 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
3210 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
3211 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
3212 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
3213 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
3214 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
3215 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
3216 RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN ROAD,SOMAJIGUDA,HYDERABAD,TELANGANA,INDIA
3217 RAMKY ENCLAVE LIMITED RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN RAOD,SOMAJIGUDA,HYDERABAD,TELANGANA
3218 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
3219 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
3220 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
3221 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3222 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3223 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
3224 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
3225 RAM SARAN EDUCATIONAL SOCIETY 161/3A/A PURA FATEH MOHAMMAD ARAIL MORE NAINI ALLAHABAD
3226 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
3227 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
3228 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
3229 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
3230 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
3231 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
3232 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
3233 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
3234 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
3235 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
3236 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.-DURG
3237 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG C.G.
3238 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
3239 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3240 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
3241 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG (C.G.)
3242 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3243 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
3244 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
3245 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
3246 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3247 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3248 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
3249 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
3250 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
3251 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3252 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3253 REAL EDUCATION TRUST 24, 25 VISHRAMNAGAR, OPP AKHAND ANAND SCHOOL, VED ROAD,SURAT.
3254 REAL REVOLUTION MARKETING PRIVATE LIMITED B-32, MAHESH NAGAR, TONK PHATAK, JAIPUR
3255 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
3256 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
3257 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
3258 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
3259 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
3260 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
3261 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
3262 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
3263 REKHA SOCIETY DGGHDGHSH
3264 RELIABLE FIRST ADCON PRIVATE LIMITED 412-422, FOURTH FLOOR, DEVNANDAN MALL, OPP : SANYAS ASHRAM, NR- M. J. LIBRARY, AHMEDABAD
3265 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
3266 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
3267 RELISYS MEDICAL DEVICES LIMITED SURVEY NUMBER 312 MANGALPALLY POCHARAM ROAD IBRAHIMPATNAM RANGAREDDY TELANGANA 501510
3268 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
3269 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
3270 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
3271 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
3272 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
3273 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
3274 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
3275 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
3276 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
3277 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
3278 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
3279 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3280 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
3281 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3282 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
3283 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
3284 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
3285 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
3286 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
3287 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
3288 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
3289 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
3290 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
3291 RISHABHDEV EDUCATION AND RESEARCH INSTITUTE 5, INDRALOK APARTMENT, NEAR MOTIBAG CHOWK, CIVIL LINES, RAIPUR, CHHATISHGARH
3292 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
3293 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
3294 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
3295 RJ RJ
3296 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
3297 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
3298 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
3299 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
3300 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
3301 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
3302 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3303 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
3304 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3305 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
3306 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
3307 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
3308 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
3309 ROHSTOFFE INTERNATIONAL PRIVATE LIMITED 1304, REGENT CHAMBERS, JAMNALAL BAJAJ ROAD, NARIMAN POINT
3310 ROJGAR MARGDARSHAN AVAM SWAROJGAR PRASHIKSHAN SANSTHAN NEAR NEW BUS STAND,SHARDAPURAM,P.O. BANSAGAR COLONY,REWA (M.P.)486001
3311 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
3312 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
3313 ROUNAK ALPASANKHYANK BAHUUDDESHIY SHIKSHAN SANSTHA DREAMS TECHNOLOGY, DR. ZAKIR HUSSAIN WARD, NEAR WATER TANK, BHANDARA
3314 ROYAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY H.NO. - 347 INSAF NAGAR INDIRA NAGAR
3315 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
3316 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
3317 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
3318 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
3319 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
3320 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
3321 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
3322 RSESK SOCIETY MAHENDRU
3323 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
3324 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
3325 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
3326 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
3327 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
3328 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
3329 RUDRA DEVELOPMENT FOUNDATION VILL GAIGHATA
3330 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
3331 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
3332 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3333 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
3334 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
3335 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
3336 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3337 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
3338 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
3339 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
3340 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
3341 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
3342 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3343 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3344 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3345 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3346 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
3347 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
3348 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
3349 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3350 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
3351 RURAL FOUNDATION HEAD OFFICE: DULARI DHAM, NEAR KISAN SEWA ASHRAM, AHROULI MOD, POKHRAYAN,KANPUR DEHAT-209111-UTTAR PRADESH
3352 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
3353 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
3354 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
3355 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
3356 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
3357 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
3358 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
3359 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
3360 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
3361 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR (UK) 247667
3362 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
3363 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
3364 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3365 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3366 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
3367 SADGUNA TECHNOLOGIES NAIMNAGAR
3368 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
3369 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
3370 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
3371 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
3372 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3373 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3374 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
3375 SAFDSF SADFASD
3376 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
3377 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
3378 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
3379 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
3380 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
3381 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
3382 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
3383 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
3384 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
3385 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
3386 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
3387 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
3388 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3389 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3390 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3391 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3392 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3393 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3394 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
3395 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
3396 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
3397 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
3398 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
3399 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
3400 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
3401 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
3402 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
3403 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
3404 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
3405 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
3406 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
3407 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
3408 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
3409 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
3410 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
3411 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
3412 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
3413 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
3414 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
3415 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
3416 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
3417 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
3418 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3419 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3420 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
3421 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
3422 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
3423 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
3424 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
3425 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
3426 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
3427 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
3428 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
3429 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
3430 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
3431 SAJAR HEALTH EDUCATIONAL AND CHARITABLE TRUST 52, VAIGAI STREET, VELMURUGAN NAGAR, BYPASS ROAD, MADURAI
3432 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
3433 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3434 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3435 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3436 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3437 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
3438 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
3439 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
3440 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
3441 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
3442 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
3443 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
3444 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3445 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3446 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3447 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
3448 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3449 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
3450 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
3451 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
3452 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
3453 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
3454 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
3455 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3456 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3457 SAMARTH EDUSKILLS PVT LTD GD-ITL TOWER,706,B09 GDITL TOWER,NETAJI SUBASH PLACE,PITAMPURA,DELHI-110034
3458 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR
3459 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
3460 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
3461 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
3462 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
3463 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
3464 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
3465 SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI, VINAYAK NAGAR DARRASHIVPURI NEAR INFANT PUBLIC SCHOOL SAHARANPUR PIN: 247001
3466 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
3467 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
3468 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
3469 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
3470 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
3471 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
3472 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
3473 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
3474 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
3475 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3476 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
3477 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
3478 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3479 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3480 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
3481 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
3482 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
3483 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
3484 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
3485 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
3486 SANDEEP TEST ASDASDASD
3487 SANDESH MNGO INDIA INDIA 1 INDORE
3488 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
3489 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
3490 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
3491 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
3492 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3493 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
3494 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3495 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
3496 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
3497 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
3498 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
3499 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
3500 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
3501 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
3502 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
3503 SANSKRITI SAMVARDHAN MANDAL SHARDANAGAR SAGROLI DIST. NANDED
3504 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE
3505 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE KHANDWA
3506 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
3507 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
3508 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3509 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3510 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
3511 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
3512 SAP INTEGRATED SECURITY AND IT SERVICES PRIVATE LIMITED B-544. POCKET-11, JASOLA VIHAR, NEW DELHI-110025
3513 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
3514 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
3515 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
3516 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
3517 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
3518 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
3519 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
3520 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
3521 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
3522 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
3523 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
3524 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE - VILLAGE/POST- MADANPURA, TEH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN CORP.OFFICE - SHREE NATH CAMPUS, NEAR GAYATRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRPURA, CHECHAT, TH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN
3525 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE- VILLAGE/POST- MADANPURA, TEH- RAMGANJMANDI, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN. CORP. OFFICE- SHREE NATH CAMPUS, NEAR GAYTRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRAPURA, CHECHAT, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN
3526 SARASWATI INSTITUTIONS OF COMPUTER EDUCATIONAL SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX LAWRENCE ROAD
3527 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
3528 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
3529 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
3530 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
3531 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
3532 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
3533 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
3534 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
3535 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
3536 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
3537 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
3538 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
3539 SAROJ GOPAL EDUCATIONAL SOCIETY VILLAGE - MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI, CHHATTISGARH
3540 SAROJ GOPAL EDUCATIONAL SOCIETY MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI
3541 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
3542 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
3543 SARSWATI EDUCATION AND WALFARE SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX, LAWRENCE ROAD, JALALABAD-WEST
3544 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
3545 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
3546 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
3547 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
3548 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
3549 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
3550 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3551 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
3552 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
3553 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
3554 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
3555 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
3556 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
3557 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
3558 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
3559 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
3560 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3561 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
3562 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
3563 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3564 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3565 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3566 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
3567 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3568 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3569 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3570 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
3571 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
3572 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
3573 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
3574 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
3575 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
3576 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
3577 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
3578 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
3579 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
3580 SATMILE SATISH CLUB O PATHAGAR VILL-CHHAT ELAJAN, P.O.-ELAJANER KUTHI, DIST-COOCHBEHAR
3581 SATNAM KHADI GRAMODYOG SEWA SAMITI VILLAGE HARDASPUR POST DUBIHAN, GHAZIPUR, UTTAR PRADESH-
3582 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
3583 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
3584 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
3585 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO-110 BHUJGAON TALUKA AKRANI DIST NANDURBAR
3586 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
3587 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
3588 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
3589 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
3590 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
3591 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3592 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
3593 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
3594 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
3595 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
3596 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
3597 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3598 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
3599 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3600 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3601 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
3602 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
3603 SATYAM SKILLS CENTER VISHAKAPATNAM
3604 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
3605 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
3606 SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE 319/1 HAMIRPUR RAOD RATH DISTRICT HAMIRPUR U.P. 210431
3607 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
3608 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
3609 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
3610 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
3611 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
3612 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
3613 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
3614 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
3615 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
3616 SBDA AT-GVBBGFHGFBFGB
3617 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
3618 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
3619 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
3620 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
3621 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
3622 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
3623 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3624 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
3625 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
3626 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
3627 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
3628 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
3629 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3630 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3631 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3632 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
3633 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
3634 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
3635 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
3636 SCHOOL OF COMMUNITY SCIENCE AND TECHNOLOGY IIEST SHIBPUR DOWNING HALL WEST WING BOTANICAL GARDEN SHIBPUR HOWRAH
3637 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
3638 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
3639 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
3640 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
3641 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3642 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
3643 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
3644 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
3645 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
3646 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
3647 SEED AND TREE CONSULTANTS PVT LTD T12, DOOR NO 2004, BLURIDGE TOWNSHIP, HINJEWADI,PUNE
3648 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
3649 SEEDS VENTURE SOCIETY 2M-69,MAHATMAGANDHI NAGAR,KANKARBAGH,PATNA
3650 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
3651 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
3652 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
3653 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
3654 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
3655 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
3656 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
3657 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
3658 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
3659 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
3660 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
3661 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
3662 SERAPHIC IT SOLUTIONS A-501 NISHDIN AURA, MAHALAXMI NAGAR, INDORE CONTACT NO. 9644034142
3663 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
3664 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3665 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
3666 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
3667 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
3668 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
3669 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
3670 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
3671 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
3672 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
3673 SEVENTS CONSULTANTS PRIVATE LIMITED ROOM NO:-29, 3RD FLOOR, MARINE DRIVE, GCDA COMPLEX, KOCHI, KERALA
3674 SEVENTS CONSULTANTS PRIVATE LIMITED NO: 19, 3RD FLOOR,GCDA COMMERCIAL COMPLEX, MARINE DRIVE, KOCHI, KERALA
3675 SEVICA 1 SARAI KHAWAJA
3676 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
3677 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
3678 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
3679 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
3680 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
3681 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
3682 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3683 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
3684 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
3685 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
3686 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
3687 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
3688 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3689 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
3690 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
3691 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
3692 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
3693 SHANTI GD ISPAT AND POWER PRIVATE LIMITED HEAD OFFICE: 402 RAJEEV GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR PLANT ADDRESS: VILLAGE AMJHAR DISTRICT CHAMPA JANJGIR
3694 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
3695 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3696 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
3697 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3698 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
3699 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
3700 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
3701 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
3702 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
3703 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
3704 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161 AGGRASAIN INDUSTRIAL AREA AGGRASAIN NAGAR
3705 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161, AGGRASAIN INDUSTRIAL AREA AGGRASAIN
3706 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
3707 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
3708 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
3709 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
3710 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
3711 SHEVOM RUBBER INDUSTRIES PVT LTD 3/338 VISHWAS KHAND GOMTINAGAR, LUCKNOW
3712 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
3713 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
3714 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
3715 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
3716 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
3717 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
3718 SHIKSHA VISTAR SANSTHA HOUSE NO 40, SEC 9/2 , GANDHI NAGAR
3719 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
3720 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3721 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
3722 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
3723 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
3724 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
3725 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
3726 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3727 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
3728 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
3729 SHIVAM DEVANSH FAB PRIVATE LIMITED VILLAGE MOHALA, CHHAPROLA ROAD, SIKRI, BALLABGHGARH, FARIDABAD (HARYANA)
3730 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, OPP. JAFARABAD GRAM PANCHAYAT, GODHRA
3731 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
3732 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, JAFRABAD GODHRA 389001
3733 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
3734 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
3735 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
3736 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
3737 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3738 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3739 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
3740 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
3741 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
3742 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
3743 SHIV EDUCATION SOCIETY NEAR MLN COLLEGE, RADAUR YAMUNA NAGAR,HARYANA
3744 SHIVPRABHU BAHUUDDESHIYA KRIDA SHIKSHAN VA SANSKRUTIK MANDAL BULDANA VISHNUWADI, CIRCULAR ROAD, BULDANA, TQ. DIST. BULDANA- 443001 MAHARASHTRA (INDIA)
3745 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
3746 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
3747 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
3748 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
3749 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
3750 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3751 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
3752 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
3753 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
3754 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
3755 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
3756 SHODH 180/22, ZAKIR NAGAR, OKHLA
3757 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
3758 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
3759 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
3760 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
3761 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3762 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3763 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
3764 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
3765 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
3766 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
3767 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
3768 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3769 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
3770 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
3771 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR HOUSE NO 626 SHIVAJI NAGAR JINTUR TQ JINTUR DIST PARBHANI (MS)
3772 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
3773 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
3774 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
3775 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
3776 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
3777 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
3778 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
3779 SHREE JAINARAYAN GHOSAL SIKHSA SANSTHAN D 44/15, RAMAPURA, VARANASI, UTTAR PRADESH
3780 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
3781 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
3782 SHREE LAXMI COMPUTER CENTER LAXMI COMPUTER CENTER BASAVANA BAGEWADI
3783 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
3784 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
3785 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
3786 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
3787 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
3788 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
3789 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
3790 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
3791 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
3792 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
3793 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
3794 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3795 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
3796 SHREE RAM KRIPA BUILD HOME PRIVATE LIMITED 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
3797 SHREERAM OM REAL ESTATE 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
3798 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
3799 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
3800 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
3801 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
3802 SHREE SHERA EDUCATIONAL TRUST SHREE SHERA EDUCATIONAL TRUST(R),C/O COMMUNITY PLOYTECHNIC BELLARE,SHAHIN MAAL ,IIND FLOOR,OPP KSRTC BUS STAND,BELLARE,BELLARE POST,SULLYA TALLUK,DHAKSHINA KANNADA DIST,KARNATAKA STATE
3803 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
3804 SHREE VIDYA NIKETAN TRUST #353/1901, NEAR NIRUPAMA APPARTMENT, NAYAPALLI, BHUBANESWAR,ODISHA
3805 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
3806 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
3807 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
3808 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3809 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
3810 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
3811 SHRI BALAJI INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED DUBEY COLONY MOWA RAIPUR
3812 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
3813 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI, RAIPUR, CHHATTISGARH
3814 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI,
3815 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
3816 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
3817 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
3818 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
3819 SHRI DIGAMBER PRASHIKSHAN AVAM ANUSANDHAN SANSTHAN A-131, RANJEET NAGAR, BHARATPUR RAJASTHAN
3820 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
3821 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
3822 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
3823 SHRI GOPAL DARBAR LOK KALYAN SAMITI GANDHI NAGAR MAHOBA UP
3824 SHRI GOPAL DARBAR LOK KALYAN SAMITI GHATKOTRA MAURANIPUR
3825 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
3826 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
3827 SHRI GURU HARGOVIND SOCIETY 13, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3828 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
3829 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3830 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3831 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
3832 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST 408, AGGARWAL PRESTIGE MALL, PLOT NO. 02, COMMUNITY CENTRE, PITAMPURA, DELHI
3833 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST STANFORD INTERNATIONAL SCHOOL,MERRUT-SONEPAT ROAD, PALRI, NEAR GLAXO COMPANY, SONEPAT
3834 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
3835 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
3836 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
3837 SHRI JYOTI SERVICES P LTD H-17 IST FLOOR, SOUTH EXTENTION-I DELHI DL 110049 IN
3838 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS MAHESHWAR ROAD SHRINAGAR COLONY MANDLESHWAR
3839 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS SHRINAGAR COLONY MANDLESHWAR
3840 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
3841 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
3842 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
3843 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
3844 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI. TQ.DIST.NANDED. MAHARASHTRA
3845 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED MAHARASHTRA
3846 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED. MAHARASHTRA
3847 SHRI LIXMAN SINGHJI MEMORIAL EDUCATIONAL AND WELFARE SOCIETY MARWAR MUNDWA UNCHI GALI, MARWAD MUNDWA VILLAGE AND TEHSIL MARWAD MUNDWA, DISTRICT NAGAUR
3848 SHRI MAHALAXMI MULTI PURPOSE CO OP SOCIETY LTD TOPINKATTI, TAL: KHANAPUR, DIST: BELGAUM
3849 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
3850 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
3851 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
3852 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
3853 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
3854 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
3855 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
3856 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
3857 SHRI PITAMBRA VIDHYAPEETH NYAS JR MIG 1/1 GEETANJALI COMPLEX KOTRA SULTANABAD BHOPAL
3858 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
3859 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
3860 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
3861 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
3862 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3863 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
3864 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
3865 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITIA KARAHIFATEHPURSIKRIAGRA
3866 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
3867 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
3868 SHRI RAM SIKHAN AWM SEVA SANSTHAN VILL-KUSHMAHA(BHAGWANAPUR),VIA-LAXMIGUNJ,DIST-KUSHINAGER(U.P.)274305
3869 SHRI RAM SKILLS DEVELOPMENT PRIVATE LIMITED MAIN BARWALA ROAD, VIRAT NAGAR,HANSI, DIST HISAR.
3870 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3871 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3872 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3873 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
3874 SHRI SADGURU SAI SAMARTH JEEVAN ADHAR SAMAJIK SANSTHA BRANCH GADHINGLAJ BHADGAON ROAD,DOCTOR COLONY,NEAR SHIVSAGAR HOTEL,GADHINGLAJ
3875 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
3876 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
3877 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
3878 SHRI SHIKSHA PRASAR EVAM JANKALYAN SAMITI 26,BAJARIYA MOHALLA SEONDHA DISTT DATIA MADHYA PRADESH
3879 SHRISHTI HELPING HANDS WELFARE SOCIETY A-602 NEW ASHOKA GARDEN, 80 FEET ROAD,BHOPAL
3880 SHRI SIDDHIVINAYAK EDUCATION SOCIETY CINEMA ROAD WARD NO 6 JUNNARDEO
3881 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
3882 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
3883 SHRI SWAMY RAMA FOUNDATION TRUST THE SWAMI RAM FOUNDATION TRUST, RAM NAGAR, SWAMI RAM MARG, VILLAGE BHUREWALA NARIANGARH134 203, DISTTAMBALA, HARYANA, REWA, HARYANA, INDIA
3884 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
3885 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
3886 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
3887 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
3888 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
3889 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
3890 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
3891 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
3892 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
3893 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
3894 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
3895 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
3896 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
3897 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3898 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
3899 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
3900 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
3901 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT F/S GOVINDPURI EXTENTION NEW DELHI 110019
3902 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
3903 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
3904 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
3905 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
3906 SIKSHYA BHARATI TRUST SIKSHYA BHARATI TRUST COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK STATE-ODISHA
3907 SIKSHYA BHARATI TRUST AT-COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK
3908 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
3909 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
3910 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD- 382481
3911 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
3912 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3913 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3914 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3915 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3916 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3917 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3918 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
3919 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
3920 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
3921 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
3922 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3923 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
3924 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3925 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3926 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
3927 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
3928 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
3929 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
3930 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
3931 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
3932 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
3933 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
3934 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
3935 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
3936 SISHU KALYANA SWADHIKARA KENDRA HEAD OFFICE AT - RUGUDIPARA, SAI MANDIR LANE PO/DIST - BALANGIR, ODISHA
3937 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
3938 SITA INFRA AND SERVICES PVT LTD "SITA INFRA AND SERVICES 301,JUBEAD COMPLEX,EXIBTION ROAD,PATNA"
3939 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
3940 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
3941 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
3942 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
3943 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3944 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
3945 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO-VC-2, MAHALUXMI PLAZA, SEC-3, VAISHALI, GHAZIABAD
3946 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO. V-2, MAHALUXMI PLAZA, SECTOR-3, VAISHALI, GHAZIABAD
3947 SJP HOTELS AND RESORTS PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
3948 SJS SKILLS DEVELOPMENT CENTER A UNIT OF SHRI JYOTI SERVICES P LTD SM KUTEER ,92 CIVIL LINE MEERUT CANTT
3949 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
3950 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
3951 SKILL DEVELOPMENT AND INFORMATION SOCIETY LIG-147 DINDAYAL COLONY, BHILAI
3952 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
3953 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
3954 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
3955 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
3956 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
3957 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
3958 SKILLPRO TECHNOLOGIES PVT LTD 2ND FLOOR, 33 SUBASH ROAD, DEHRADUN UTTARAKHAND
3959 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
3960 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
3961 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
3962 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
3963 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
3964 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
3965 SKILL VISION SOCIAL EDUCATIONAL SOCIETY 81 KOHARAPEER THALIWALAN CHOWK BAREILLY
3966 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
3967 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
3968 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3969 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
3970 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
3971 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
3972 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TECHNICAL INSTITUTE, SHREE AMBALAL UPADHYAY SAHAKAR BHAVAN, NR. SAHAKAR HALL, AMBAWADI
3973 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
3974 SKY ORGANAIZATION HEBBAGODI, HOSUR ROAD BANGALORE. ANEKAL TQ BANGALORE DIST.
3975 SLC EDUCATIONAL SOCIETY 101, 1-11-112/2 CHAKRAVARTHY TOWERS SHYAMLAL BUILDINGS BEGUMPET, HYDERABAD
3976 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
3977 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3978 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3979 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
3980 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
3981 SMARTONE TECHNO SOFT PRIVATE LIMITED NARURANGABAD, COURT ROAD, ETAWAH-206001
3982 SMART SKILL TECH PRIVATE LIMITED PLOT NO 137 SEC 24
3983 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
3984 SMARTTRICKTECH PRIVATE LIMITED GROUND FLOOR SHOP NO 1MOHALLA CHAWAD BY PASS ROAD SASNI
3985 SMART ZONE GUNJABARI
3986 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
3987 SMITA MAHILA SHIKSHAN SANSTHAN 567 ANAND COLONY BALDEOBAG JABALPUR MADHYA PRADESH 482002
3988 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
3989 SMT DEVKI DEVI SEVA SAMITI L.I.G. GOVIND PUR ALLAHABAD
3990 SMT DEVKI DEVI SEVA SAMITI LIG 123 GOVINDPUR ALLAHABAD
3991 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
3992 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
3993 SNAP NEAR MANIPAL HOSPITALS
3994 SNC INFOTECH PRIVATE LIMITED KC-114, KAVI NAGAR , GHAZIABAD
3995 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
3996 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
3997 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
3998 SNS FOUNDATION 508, 3RD FLOOR, JAISWAL COMPLEX, SAKCHI, JAMSHEDPUR EAST SINGHBHUM
3999 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4000 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4001 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
4002 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
4003 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
4004 SOCIAL DEVELOPMENT ORGANISATION H.NO. 50, MASOUD ALI BUILDING, TAAJ LEIRAK, HAFIZ HATTA, IMPHA EAST,MANIUR -7095001
4005 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
4006 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 3 HOUSE NO C 31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR
4007 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 4 HOUSE NO C-31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR NEW DELHI
4008 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
4009 SOCIAL ORGANISATION FOR TRANSFORMATION C/O SHALI BHADRA MUTHA ,255, IN FRONT OF GOPAL MANDIR,MAIN ROAD, SADAR MARKET,RAIPUR,C.G.
4010 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
4011 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
4012 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
4013 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
4014 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
4015 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
4016 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
4017 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
4018 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT CHITRAGUPTA COLONY, BEHIND GODDA COLLEGE, GODDA
4019 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT SATHEE (SOCIETY FOR ADVANCEMENT IN TRIBES, HEALTH, EDUCATION AND ENVIRONMENT) CHITRAGUPTA COLONY BEHIND GODDA COLLEGE, GODDA-814133 JHARKHAND
4020 SOCIETYFORADVANCEMENTINTRIBESHEALTHEDUCATIONANDENVIRONMENTSATHEE CHITRAGUPTA COLONY,BEHIND GODDA COLLEGE,GODDA
4021 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
4022 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
4023 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
4024 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
4025 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
4026 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
4027 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
4028 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
4029 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
4030 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
4031 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
4032 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
4033 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
4034 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
4035 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
4036 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEVELOPMENT VILLAGE & P.O- KANISHAIL P.S & DISTRICT- KARIMGANJ
4037 SOCIETY FOR EDUCATION AND SOCIAL ACTIVITIES FF-31, SF-30,31,19,VATSALYA STATUS, OPP RAILWAY STATION, KADI
4038 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
4039 SOCIETYFORHEALTHACTIONDEVELOPMENTANDENVIRONMENTALSERVICES PLOT NO-468/3A, SHREE VIHAR, PATIA, CHANDRASEKHARPUR, BHUBANESWAR
4040 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
4041 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
4042 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
4043 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
4044 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
4045 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
4046 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
4047 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
4048 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
4049 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
4050 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
4051 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
4052 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
4053 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
4054 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4055 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4056 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI,NEW DELHI-110075
4057 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4058 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
4059 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
4060 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
4061 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
4062 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
4063 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
4064 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
4065 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
4066 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
4067 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
4068 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
4069 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
4070 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
4071 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
4072 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
4073 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
4074 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
4075 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4076 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4077 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4078 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
4079 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
4080 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
4081 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
4082 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
4083 SONAPUR PALLY UNNAYAN SAMITY SONAPUR PART-I,PO-SONAPUR,DISTRICT-CACHAR
4084 SONARPUR SWAMI VIVEKANANDA MANAS MISSION VILL- GHASIARA, P.O.+P.S.- SONARPUR, DIST-SOUTH 24 PARGANAS, KOLKATA-700150, WEST BENGAL
4085 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
4086 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
4087 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
4088 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4089 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4090 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4091 SONY XPERIA FGFDGFGFD
4092 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
4093 SOS CARE C-88/A, GF, KAUSHIK SADAN, GALI NO.3, JANTA GARDEN, PANDAV NAGAR, DELHI-110091
4094 SOS CARE INDIA C-88/A,GF, GALI NO.3,KAUSHIK SADAN, JANTA GARDEN,PANDAV NAGAR,DELHI-91
4095 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
4096 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
4097 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR (CG)
4098 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR
4099 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
4100 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
4101 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
4102 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
4103 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, PIN - 700031
4104 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
4105 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
4106 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
4107 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
4108 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
4109 SPARSH 310 CHANDRALOK TOWER KAPOORTHALA, LUCKNOW
4110 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
4111 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
4112 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
4113 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
4114 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
4115 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
4116 S P GRAMYA VIKAS AVAM GRAMODYOG SANSTHAN 636/431 TAKROHI POST CHINHAT SECTOR 11 INDIRA NAGAR LUCKNOW UP
4117 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
4118 SR ASIA 4F-CS-25, ANSAL PLAZA, VAISHALI, GHAZIABAD INDIA
4119 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
4120 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
4121 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
4122 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
4123 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
4124 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
4125 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
4126 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
4127 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
4128 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
4129 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
4130 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
4131 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
4132 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
4133 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
4134 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
4135 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
4136 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
4137 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
4138 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
4139 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
4140 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
4141 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
4142 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
4143 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
4144 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
4145 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
4146 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA
4147 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
4148 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
4149 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
4150 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
4151 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
4152 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
4153 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
4154 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
4155 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
4156 SRI GOKULAM TRUST 13,KALIAMMAN KOVIL ST, KOOMAPATTI, SRIVALLIPUTHUR TK, VIRUDHUNAGAR DT
4157 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
4158 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
4159 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
4160 SRI JYOTHI HUMAN RESOURCES WELFARE ASSOCIATION 23-66/A/1/ MADHURA NAGAR SHAMSHABAD,9490324304
4161 SRI KALAI HERBAL BEAUTY PARLOUR MAHILA SANGHA #141 NEW 7 11 MAIN 1ST CROSS K P AGRAHARA BANGALORE
4162 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
4163 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
4164 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
4165 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
4166 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
4167 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4168 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4169 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4170 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
4171 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
4172 SRI KRISHNA EDUCATION TRUST SRI KRISHNA EDUCATION TRUST, SHISHYA BEML PUBLIC SCHOOL, DR. AMBEDKAR ROAD, BEML TOWNSHIP, NEW THIPPANSANDRA, BANGALORE
4173 SRI KUMARAGURU MILL SRI KUMARAGURU MILL, KG HOUSE, 126 ARTS COLLEGE ROAD, COIMBATORE
4174 SRI KUMARAGURU MILL LTD KG HOUSE, 126 - ARTS COLLEGE ROAD, COIMBATORE
4175 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
4176 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
4177 SRI LALDEO MEERA FOUNDATION MEERA BHAWAN,MAIN ROAD KOERIA TOLA,RAXAUL,EAST CHAMPARAN,BIHAR-845305
4178 SRIMAD DAYANAND SWARSWATI SIKHSHA SAMITI VEDPRKASH BRHMADEV VILLAGE-DHORIKUTI POST-RAYA
4179 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
4180 SRI MAHESWARA EDUCATIONAL TRUST SET HOME ADDRESS: 1/154,SILLARAHALLI (VILL & PO),PAPPIREDDIPATTI (TK),DHARMAPURI (DT)-635303. OFFICE ADDRESS:SRI GURU MAHESWARA PARAMEDICAL INSTITUTION,PAPPIREDDIPATTI ( VILL & PO & TK),DHARMAPURI (DT)
4181 SRI MAHESWARA EDUCATIONAL TRUST SET 1/154,SILLARAHALLI VILL & PO,PAPPIREDDIPATTI TK,DHARMAPURI DT,TAMILNADU,INDIA
4182 SRI MALAYAMMAN EDUCATIONAL TRUST SRI MALAYAMMAN EDUCATIONAL TRUST(OLD RAGHAVENDRA SCHOOL) NO 738, DR. RADHAKRISHNAN NAGAR, 4TH CROSS,MADURAPURI, THURAIYUR 621010
4183 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
4184 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
4185 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
4186 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
4187 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4188 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
4189 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
4190 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
4191 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4192 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4193 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
4194 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
4195 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
4196 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
4197 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
4198 SRI RADHA KRISHNA INFOTECH PRIVATE LIMITED B-172, B BLOCK, BHARAT VIHAR KAKROLA, NEW DELHI - 110078, INDIA
4199 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
4200 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4201 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
4202 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4203 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
4204 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4205 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
4206 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: DOOR NO: 75621, FLOT NO.8, JETTI DELUX APARTMENT, PRAKASH NAGAR, RAJAHMUNDRY533103. EAST GODAVAI DISTRICT.
4207 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
4208 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
4209 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4210 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
4211 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
4212 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
4213 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
4214 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
4215 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
4216 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
4217 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
4218 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
4219 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
4220 SRI SATHYA SAI EDUCATIONAL AND CHARITABLE TRUST M/S.DR.M.G.R INSTITUTRE CAMPUS, NO.8,NEDUMARAN NAGAR
4221 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
4222 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
4223 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
4224 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
4225 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
4226 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
4227 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
4228 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
4229 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
4230 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY YASHODAGANASHREE NILAYA 8TH CROSS, SAPTHGIRI EXTN. TUMKUR-
4231 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATRE, M.G.ROAD, TUMKUR
4232 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
4233 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4234 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4235 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4236 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
4237 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
4238 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
4239 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
4240 SRISTI FOUNDATION 8TH FLOOR , RESHMI COMPLEX , P & T COLONY , KIDWAIPURI , PATNA
4241 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
4242 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
4243 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
4244 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
4245 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
4246 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
4247 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
4248 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
4249 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
4250 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
4251 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
4252 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
4253 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
4254 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4255 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4256 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
4257 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
4258 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4259 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI TALUK, THIRUVALLUR DISTRICT
4260 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4261 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
4262 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
4263 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
4264 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
4265 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
4266 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
4267 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
4268 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
4269 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
4270 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
4271 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
4272 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
4273 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
4274 SRM MULTISERVICES PRIVATE LIMITED 78 NEAR WATER TANK MUNSHIGANJ SITAPUR
4275 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
4276 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
4277 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
4278 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
4279 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
4280 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
4281 SSC DDHGH
4282 SS COMPUTERS SS COMPUTER, 2/237, LALIGAM ROAD, NALLAMPALLI.
4283 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
4284 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
4285 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4286 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4287 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
4288 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4289 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
4290 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
4291 SSR SERVICES INDIA LLP #17-83/3, BRUNDHVANAM GARDENS, OPP GOVT HOSPITAL, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRA PRADESH, INDIA
4292 SSR SERVICES INDIA LLP # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4293 SSR SERVICES INDIA LLP 17-89/4, MAIN ROAD, OPP SBI, PENDURTHY, VISAKHAPATNAM-531173, ANDHRAPRADESH
4294 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
4295 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
4296 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4297 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
4298 STARLINE HOLIDAYS PRIVATE LIMITED 234, POCKET-4, ROHINI, NEW DELHI-110085
4299 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4300 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
4301 STAR SCHOOL SAMITI SHIV KUMAR SINGH INSTITUTE OF TECHNOLOGY AND SCIENCE RAU NEAR IIM PITHAMPUR BYPASS ROAD INDORE
4302 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
4303 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
4304 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4305 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4306 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
4307 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4308 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4309 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4310 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
4311 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
4312 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
4313 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
4314 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
4315 STEP AHEAD FOUNDATION 410,4TH FLOOR, SUNDARAM BUILDING, RDC, RAJ NAGAR, GHAZIABAD.
4316 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
4317 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
4318 STEP TO FORWARD SANSTHAN 43, D NEW CIVIL LINES FATEHPUR
4319 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
4320 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
4321 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
4322 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
4323 ST MARYS TAILORING AND CHARITABLE TRUST 4/122,AMBATHKAR STREET,KUDUMIYAMPATTI,ACHALVADI PO,HARUR TK,DHARMAPURI DT,TAMILNADU,INDIA-636903
4324 ST MARYS TAILORING AND CHARITABLE TRUST 4/112,AMBATHKAR STREET,KUDUMIYAMPATTI,ACHALVADI PO,HARUR TK,DHARMAPURI DT-636903
4325 ST MARYS TECHNOLOGICAL FOUNDATION PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
4326 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
4327 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
4328 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4329 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4330 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GURU JAMBESHWAR UNIVERSITY HISAR
4331 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
4332 STYLE N SCISSORS 4/36-J SUNRISE ENCLAVE GROUND FLOOR, CHITRAKOOT SCHEME JAIPUR ,RAJASTHAN
4333 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
4334 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI BLOCK- KACHHAUNA DISTRICT- HARDOI
4335 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI
4336 SUBHASH EDUCATIONAL SOCIETY SUBHASH CHANDRA BOSE INSTITUTE OF HIGHER EDUCATION, PRABANDH NAGAR, MUBARAKPUR,NEAR IIM, LUCKNOW
4337 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
4338 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
4339 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
4340 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
4341 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
4342 SUBHIKSAM CHARITABLE TRUST NO:1, ARUNACHALAESWARER COMPLEX,PONNAI KOOT ROAD,THIRUVALAM,KATPADI TK,VELLORE DT
4343 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
4344 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
4345 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
4346 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
4347 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
4348 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
4349 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
4350 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
4351 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
4352 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
4353 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA TESIL KAILARAS DISST MORENA M.P.
4354 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA
4355 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
4356 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
4357 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
4358 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
4359 SUNRISE EDUCATION AND WELFARE SOCIETY B-1/3716, BHAGWAN PUR KHERA, SHAHDARA, DELHI
4360 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
4361 SUNRISE WELFARE SOCIETY SARDARSHAHAR ROAD, SHRI DUNGARGARH
4362 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH
4363 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH KALAHANDI
4364 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
4365 SUPER COMPUTER COLLEGE GENERAL BUS STAND ANANTNAG
4366 SUPER COMPUTERS GENERAL BUS STAND ANANTNAG
4367 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
4368 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
4369 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
4370 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4371 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4372 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4373 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
4374 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
4375 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
4376 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
4377 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
4378 SURAJ FOUNDATION VILLAGE AND POST JAGIR
4379 SURAKSHA SKILLS AND SOLUTIONS PRIVATE LIMITED 135,RAJGARH ROAD,NEAR BHARALU BRIDGE,GUWAHATI
4380 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
4381 SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED, H NO 2-152,VANI NAGAR, MALKAJGIRI, HYDERABAD, TS
4382 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
4383 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4384 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
4385 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4386 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN,NEAR BUS STAND
4387 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
4388 SUTRA SAMAJ SEVI SANSTHA POLICE KOTWALI NE BACK DURG
4389 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
4390 S V EDUCATION AND INFRASTRUCTURE PRIVATE LIMITED 2-1-5/34 PLR LUXURY HOMES UPPERPALLY HYDERABAD
4391 SVG EXPRESS SERVICES PRIVATE LIMITED C 114 F ROAD NO 8 VKI JAIPUR
4392 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
4393 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
4394 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
4395 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
4396 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
4397 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
4398 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
4399 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
4400 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
4401 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
4402 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
4403 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
4404 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
4405 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
4406 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR, KANPUR
4407 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR KANPUR
4408 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4409 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4410 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4411 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
4412 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
4413 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
4414 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
4415 SWASTHAY SHIKSHA EVAM VYAKTIGAT VIKAS ANUSANDHAN KENDRA B-455, STREAT NO. 30, MAHAVIR ENCLAVE PART-II, NEAR SEC-2, DWARKA NEW DELHI
4416 SWASTIKA MAHILA VIKAS SANSTHAN SWASTIKA MAHILA VIKAS SANSTHAN, GALI NO-3, NEW KAREHRA COLONY, MOHAHNNAGAR, GHAZIABAD, U.P
4417 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
4418 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
4419 SWATHI EDUCATIONAL SOCIETY H.NSAO. 17-1-380/E/9,CENTRAL EXCISE COLONY SAIDABAD, HYDERABAD
4420 SWATHI MEMORIAL EDUCATIONAL SOCIETY H.NO.16-2-754/A/23/1,APAU COLONY,ASMANGADH,DILSUKHNAGAR HYDERABAD
4421 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
4422 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
4423 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
4424 SWIFT SECURITAS PRIVATE LIMITED 2, RAJDHANI ENCLAVE, PITAMPURA, DELHI
4425 SW RAMNATH VERMA EDUCATION AND WELFARE SOCIETY OMGURU SOFTWARE PVT LTD, NEELGAR CHAURAHA, VISHNU MANDIR ROAD.
4426 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
4427 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
4428 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
4429 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
4430 SYMBIOSIS INSTITUTE OF COMPUTER APPLICATIONS FORTE INSTITUTE OF TECHNOLOGY, VILLAGE KASERU BUXER , OPPOSITE VIJAYLOK COLONY, GREEN PARK , MAWANA ROAD , MEERUT
4431 SYNCHRONIZED TECHNOSOFT PRIVATE LIMITED D201, OYSTER GRANDE, SECTOR-102/102 (A), GURGAON, HARYANA-122001
4432 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
4433 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
4434 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
4435 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
4436 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
4437 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
4438 TALISMA TEST TALISMA TEST, TALISMA TEST
4439 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
4440 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
4441 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
4442 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
4443 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
4444 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
4445 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
4446 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
4447 TARUN CREATIONS PRIVATE LIMITED KHASRA NO 115 SHITLAMATA WALI GALI ALIPUR DELHI
4448 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
4449 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
4450 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
4451 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
4452 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
4453 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
4454 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
4455 TECH MECH INTERNATIONAL P LTD 92 CIVIL LINES S M KUTEER MEERUT
4456 TECH MECH INTERNATIONAL P LTD 208 II FLOOR,AGARWAL CHAMBERSIV,VEER SAVARKAR BLOCK,SHAKAPUR,DELHI
4457 TECH MECH INTERNATIONAL PVT LTD "S.M." KUTEER, MANDIR MARG, 92-CIVIL LINES, MEERUT - 250001(UP)
4458 TECHNICAL EDUCATION SOCIETY NAGPUR RAJESH REWADE 122 KACHORE LAY OUT WAED NO 06 BUTI BORI NAGPUR 441108
4459 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKATESH CITY SHIRUL NAGPUR
4460 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKATESH CITY SHIRUL NAGPUR 441108
4461 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
4462 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
4463 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
4464 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
4465 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
4466 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
4467 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, ALIGANJ, NEAR ENGG COLLEGE CROSSING
4468 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
4469 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
4470 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
4471 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
4472 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
4473 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
4474 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
4475 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
4476 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
4477 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
4478 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4479 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4480 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4481 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
4482 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
4483 TELEONE CONSUMERS PVT LTD 180, PITAMPURA VILLAGE, NEAR GOVT. SCHOOL & CHAUPAL, PITAMPURA
4484 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
4485 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
4486 TENNEX CONSULTING PRIVATE LIMITED 2/514A, RIVER ENCLAVE, MANAPAKKAM, CHENNAI
4487 TERNA PUBLIC CHARITABLE TRUST SOLAPUR ROAD, OSMANABAD 413501
4488 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
4489 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
4490 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
4491 TEST TEST
4492 TEST GUWAHATI METRO
4493 TEST123 QLJLFHLJQ
4494 TEST1234TEST TEST
4495 TEST ABCD 5678 TESTABCD5678
4496 TESTDATA TEMP DELHI
4497 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
4498 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
4499 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
4500 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
4501 TEST FOR MAIL JADGSJAS
4502 TESTING TEST
4503 TESTM2 ASDWDDV
4504 TEZ ENGINEERING AND INFRASTRUCTURE PRIVATE LIMITED SHEELAM COLONY GALI NO.-3 OPP. DIHILONG PETROL PUMP
4505 TEZ ENGINEERING AND INFRASTRUCTURE PRIVATE LIMITEO SHEELAM COLONY STREET NO-03, OPPOSITE DIHILLONG PETROL PUMP, PUNJAB
4506 TEZ ENGINEERING AND INFRASTRUCTURES PRIVATE LIMITED SHIVAM COLONY GALI NO-3 OPP DHILLON PETROL PUMP SANGRUR
4507 TEZ ENGINEERING PRIVATE LIMITED SHEELAM COLONY GALI NO.3 OPP DIHILLONG PETROL PUMP
4508 THAKUR KARAM SINGH CHARITABLE TRUST H/O LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
4509 THAKUR KARAM SINGH CHARITABLE TRUST V.P.O. LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
4510 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
4511 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
4512 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET, PODATUR PET PALLIPET TALUK, TIRUVALLUR DISTRICT
4513 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET,PODATUR PET,PALLIPET TALUK,
4514 THANDAVA VENKATESA MUTHALIYAR EDUCATIONAL TRUST 63,EST NAGART,1ST STREET, PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT, TAMILNADU
4515 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
4516 THE ASHOKA HANDLOOM AND HANDICRAFTS SOCIETY BLDG NO- 918,WARD NO-11, PANIPAT,HARIYANA
4517 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
4518 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
4519 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
4520 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
4521 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
4522 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
4523 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
4524 THE ASSOCIATION OF VOLUNTARY AGENCIES FOR RURAL DEVELOPMENT MANIPUR MATA LAMBULANE VILLAGE BPO TOLPHEI PO CHURACHANDPUR CHURACHANDPUR DISTRICT
4525 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
4526 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
4527 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
4528 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
4529 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
4530 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
4531 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
4532 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
4533 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
4534 THENI SOCIAL REHABILITATION AND DEVELOPMENT TRUST 8 3 8 MIDDLE STREET VAYALPATTI VEERAPANDI POST THENI DT TAMILNADU SOUTH INDIA PIN 625534
4535 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
4536 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
4537 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
4538 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
4539 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
4540 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI NEAR DEPUTY COMMISSIONER COMPLEX.THOUBAL
4541 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO/PS THOUBAL, MANIPUR
4542 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI
4543 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
4544 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
4545 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
4546 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
4547 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
4548 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
4549 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
4550 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
4551 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
4552 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
4553 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
4554 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
4555 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
4556 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
4557 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
4558 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
4559 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
4560 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4561 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
4562 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4563 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
4564 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
4565 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
4566 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
4567 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
4568 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
4569 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
4570 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
4571 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
4572 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
4573 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
4574 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
4575 TNR SAINIK ACADEMY SOCIETY SURVEY NO.108, BAHADURPALLY VILLAGE, QUTHBULLAPUR, MEDCHAL
4576 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
4577 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
4578 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
4579 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
4580 TOUCH IN ASSOCIATES PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA, PIN - 752101
4581 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
4582 TRANSKILL TRAINING AND CONSULTANCY SERVICES PVT LTD 2ND FLOOR OFFICE NO. 237, KOHINOOR MAJESTIC THERMAX CHOWK CHINCHWAD, PUNE
4583 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
4584 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
4585 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
4586 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
4587 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
4588 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
4589 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
4590 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR DIST.CHHOTAUDEPUR.GUJARAT
4591 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR
4592 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
4593 TRIMURTI WELDMESH PRIVATE LIMITED B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4594 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4595 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
4596 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
4597 TRIOS DEVELOPMENT SUPPORT PRIVATE LIMITED T-33, MANISH GLOBAL MALL, PLOT NO-2, OPP. MOUNT CARMEL SCHOOL, SECTOR-22
4598 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
4599 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
4600 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
4601 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
4602 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
4603 TRIVEDI AND ASSOCIATE TECKNICAL SERVICE PRIVATE LIMITED 102, SIDCUP TOWER, RACE COURSE, VADODARA
4604 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
4605 TRP HUI NAGAR
4606 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
4607 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
4608 TULJABHAVNI GRAM VIKAS SEVABHAVI SANSTHA C/O TOTE R G AT POST TQ PATODA DIST BEED
4609 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
4610 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
4611 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
4612 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
4613 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
4614 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
4615 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
4616 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
4617 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
4618 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
4619 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
4620 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
4621 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
4622 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
4623 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4624 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4625 UDHAYAM TRUST 187,RAJA MILL ROAD, POLLACHI
4626 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI,COIMBATORE
4627 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
4628 UDYOG VIKAS SANSTHAN N11/106 LANE NO.2 SRI RAM NAGARA COLONY KAKKARMATTA
4629 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
4630 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
4631 ULTIMATUM INFORMATICS PRIVATE LIMITED SUMANGAL APARTMENT, 99 BT. ROAD, IST FLOOR P.O-KHARDAH KOLKATA KOLKATA WB 700117
4632 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
4633 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
4634 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
4635 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
4636 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
4637 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
4638 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
4639 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
4640 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI
4641 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
4642 UNIQUE VIKAS SANSTHAN 2/94-B, VIJAY KHAND, GOMTI NAGAR, LUCKNOW
4643 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
4644 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
4645 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
4646 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
4647 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
4648 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
4649 UNIVERSAL EDUCATIONAL SOCIETY VILLAGE BALLOPUR, P.O- LALRU, DISTT: DERABASSI
4650 UNIVERSAL IDEAL SEWA SAMITI VILL AND POST MAHULI, PS- WYNDHAMGANJ, SONBHADRA (U.P.), 231208
4651 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
4652 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLE, SARADA BABU LANE, LINE TANK ROAD, RANCHI
4653 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
4654 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
4655 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
4656 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
4657 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
4658 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
4659 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
4660 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
4661 UPKAAR DR PASUPULETI NIRMALA HANUMANTHA RAO CHARITABLE TRUST UPKAAR COMPLEX, UPKAAR JUNCTION, OPPOSITE: JBS, SECUNDERABAD
4662 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK BHOTIA PAROW HALDWANI
4663 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
4664 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
4665 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
4666 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
4667 UPPADA SAREES PVT LTD 8-2-574, #103, NAJAF RESIDENCY, LANE BESIDE ADVANCE HAIR STUDIO, ROAD NO.8, BANJARA HILLS, HYDERABAD
4668 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ-33A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
4669 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ 33 A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
4670 URJA GLOBAL LIMITED 487/63, 1ST FLOOR, NATIONAL MARKET, PEERAGARHI, NEW DELHI
4671 URMIDWAR INNOVATIVE ACTION AND RESEARCH FOUNDATION 18,DWARIKAPURAM,NEAR ASHARAM TRUST,CIRCULAR ROAD,BHARATPUR-321001
4672 USHODAYA RURAL AND URBAN DEVELOPMENT VOLUNTARY ORG O V ROAD MRO OFFICE COMPOUND BESIDE E SEVA KANDUKURU 523105 PRAKASAM DT ANDHRA PRADESH
4673 USIT INFOCOM PVT LTD A-152 GALI NO-4 SHAKARPUR DELHI
4674 USIT INFOCOM PVT LTD A-152,GROUND FLOOR,GALI NO-5,ARUNA PARK,SHAKARPUR NEW DELHI
4675 UTKAL BIPANNA SAHAYATA SAMITI PLOT NO-41,SECTOR-A,ZONE-D MANCHESWAR INDUSTRIAL ESTATE CITY-BHUBANESWAR,DIST-KHORDHA STATE-ODISHA
4676 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4677 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
4678 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
4679 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4680 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
4681 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO- COLLEGE SQUARE,CUTTACK
4682 UTL TECHNOLOGIES LIMITED NO 19 6 ASHOKPURAM SCHOOL ROAD INDUSTRIAL SUBURB YESHWANTHPUR BENGALURU
4683 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4684 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4685 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
4686 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUTOLA UTTARKASHI
4687 UVA JAGRITI SANSTHAN IN FRONT OF GRAM PANCHYAT BANSUR ALWAR RAJASTHAN PIN 301402
4688 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR,OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4689 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR, OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
4690 VAG MANAGEMENT SERVICES D-42, GROUND FLOOR, SOUTH EXTENSION PART-1, NEW DELHI
4691 VAIBHAV SOCIAL WELFARE TRUST NO-08 SHIVAPUTRA COMPLEX, VEERABHADREHWAR COLONY NEAR UDNOOR RING ROAD GULBARGA
4692 VAIDYANATH SARVANGIN VIKAS SANSTHA AT BRAHMAWADI, POST -TOKWADI, PARLI-BEED STATE HIGHWAY, PARLI-V., DIST. BEED
4693 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET,TENKASI,TIRUNELVELI
4694 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET TENKASI TIRUNELVELI DIST TAMILNADU
4695 VAISHNAVI COMPUTER AND EDUCATION SOCIETY PATHA THANA ., CHANDANGAON CHHINDWARA
4696 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST YAVATMAL
4697 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4698 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
4699 VALEUR FABTEX PRIVATE LIMITED B-39, TRIVENI NAGAR, NEAR GOPALPURA BYPASS, JAIPUR, RAJASTHAN
4700 VALHALL EXPORTS PRIVATE LIMITED VALHALL EXPORTS PVT LTD,229,DSIDC SHEDS,OKHLA INDUSTRIAL AREA,PHASE-1,NEW DELHI-110020
4701 VALLEY OF TECHNICAL INSTITUTE AND TRUST KALI MANDIR LANE, OPP. RAMVILAS PETROL PUMP, RATU ROAD, P.O.+P.S.- SUKHDEV NAGAR, RANCHI
4702 VALUE ADD KNOWLEDGE SERVICES PRIVATE LIMITED STILTH FLOOR, MAXIMUS 2B, RAHEJA MINDSPACE IT PARK, HITECH CITY,MADHAPUR, RANGAREDDY, TELANGANA-500081
4703 VAMANI OVERSEAS PRIVATE LIMITED 169 SECTOR 24
4704 VANDEMATRAM IDEAL PUBLIC SOCIETY GDA COMPLEX VINAY NAGAR SECTOR - 1 GWALIOR MADHYA PRADESH
4705 VANDEMATRAM IDEAL PUBLIC SOCIETY GWALIOR VILL& POST BARAUA NEW BY PASS HIGHWAY TIRAHA AB ROAD VIPS COLLEGE CAMPUS GWALIOR
4706 VANI SANSTHA 126, MAHAVEER NAGAR Y, 80 FEET ROAD, NEAR ADARSH VIDYA MANDIR, SANGANER , JAIPUR, RAJASTHAN
4707 VANITHA JYOTHI MAHILA SANGAM H.NO: 8-44/2, SRI SAI NAGAR COLONY, SAROOR NAGAR, RANGA REDDY, TELANGANA(STATE)
4708 VANUSRA SOLUTIONS AND ENTERPRISES PVT LIMITED OPC REGISTERED ADDRESS: NEW NO 29/G2, N R FLATS, 6TH STREET, ALAGIRI NAGAR, VADAPALANI, CHENNAI, TAMILNADU. CORPORATE OFFICE: 11/23, 5TH FLOOR, K R BUILDING, L B ROAD, ADYAR, CHENNAI, TAMILNADU
4709 VAP TECHNOLOGY UNDER VIDYA SOCIETY SHRI GURU TEGH BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4710 VARAIYA KRISHI BAGVANI EVAM JAN KALYAN SAMITI AMOLPATHA NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI M.P.
4711 VARAIYA VOCATIONAL TRAINING INSTITUTE NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI
4712 VARDHANA SOCIETY D.NO:22-366/RP, DODDIPALLI ROAD, CHITTOOR
4713 VARDMAN SOCIETY 612, RAMKISHAN MARKET CHANDI ROAD HAPUR
4714 VARHAD VIKAS BAHUUDDES SHIKSHAN PRASARAK MANDAL HIWARKHED VARHAD VIKAS BAHUUDDESHIYVA SHIKSHAN PRASARAK MANDAL HIWARKHED C/O MANISH V BHAMBURKAR AT/PO HIWARKHED (RUPRAO)TQ.TELHARA DST.AKOLA
4715 VASANTHALAKSHMI CHARITABLE TRUST AND RESEARCH CENTRE 16-2-131, KASTURIDEVI NAGAR, POGATHOTA, NELLORE
4716 VASANTHAM EDUCATIONAL AND RURAL DEVELOPED SOCITY 14A,SATHIYANARAYANAN STREET, VENKATASAPURI,
4717 VASAVYA MAHILA MANDALI 40-9/1-16 VASAVYA NAGAR, BENZ CIRCLE VIJAYAWADA
4718 VAS KNOWELDGE GROWTH INITATIVES PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
4719 VAS KNOWLEDGE GROWTH INITIATIVE PVT LTD B-73, NIRALA NAGAR
4720 VAS KNOWLEDGE GROWTH INITIATIVES PVT LTD 320, SYNDICATE HOUSE INDERLOK DELHI
4721 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4722 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
4723 VASUNDHARA NIZARAPAR JAGIROAD
4724 VASUNDHARA NZARAPAR JAGIROAD
4725 VASUNDHARA NGO JAGIROAD MORIGAON ASSAM
4726 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4727 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4728 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4729 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4730 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
4731 VASUNDHARA VIDYAPRASARAK V K S V SANSTHA REG.OFFICE- AT-DWARKADHISH BHAWAN,NIWANE,TAL-KALWAN,DT-NASIK PROJECT OFFICE- PANDURANG NAGAR,MANMAD,DT-NASIK
4732 VATIKA BHAGYA SHASTRA LLP HEAD OFF:- CUG-1, 1 ST FLOOR, JUMBO HOUSE, 15. DR. JHA MARG , OKHLA PHASE-3, SOUTH DELHI DELHI
4733 VATSALYA EDUCATION AND CHARITABLE TRUST 2ND FLOOR KRISHNA SHRUSTI APARTMENT 10JUNCTION PLOT
4734 VAYAM INFO SOLUTIONS PVT LTD B-157, LOWER GROUND FLOOR, CHITRANJAN PARK, NEW DELHI
4735 VAYAM TECHNOLOGIES LIMITED THAPAR HOUSE, 124, JANPATH, NEW DELHI
4736 VBNX CVZ
4737 V DO SKILLS AND MICRONET LLP 21213B, STREET NO. 2B, AJIT ROAD, BATHINDA
4738 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4739 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4740 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4741 VEDA ARC PROFESSIONALS PRIVATE LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
4742 VEDOM ENGINEERING SERVICES PRIVATE LIMITED 893 A/35, NEAR NAMDEV MANDIR, JANTA COLONY, ROHTAK HARYANA
4743 VEDOM ENGINEERING SERVICES PRIVATE LIMITED 893 A/35, NEAR MAHADEV MANDIR, JANTA COLONY, ROHTAK
4744 VEDOM ENGINEERING SERVICES PRIVATE LIMITED 893/A/35, NEAR NAMDEV MANDIR, JANTA COLONY, ROHTAK
4745 V EDUCATIONAL TRUST 49/B,T.K.VIJAYARAM STREET,MADURAI MAIN ROAD
4746 V EDUCATIONAL TRUST 49/B,T.K.VIJAYARAM STREET,MADURAI MAIN ROAD,THENI
4747 VEERA EDUCATIONAL SOCIETY #3-20-1/10, RAM MOHAN RAJA NAGAR, KAKINADA, KAKINADA MANDAL, EAST GODAVARI DISTRICT, AP
4748 VEER INDRA SOCILA GROUP SOCIETY ZILA PARTHMIKSHIK SHAK SHANG SIYARAMNAGAR, BHIHKHANPUR,BHAGALPUR
4749 VEER PAL VILL NARKHERA POST NIPANIYA TEH MILAK RAMPUR
4750 VEER VIJAY EDUCATION SOCIETY VILL & POST-SUNDERPUR, DISTRICT-SAHARANPUR, UP
4751 VEE TECHNOLOGIES PVT LTD NO 71,SONA TOWERS,MILLERS ROAD,7TH FLOOR, BANGALORE
4752 VELLORE ACADEMY NO:508/A, VERSHEN COMPLEX 3RD FLOOR, MUTHURANGAM GOVT ARTS COLLEGE ROAD, OTTERI, VELLORE. TAMILNADU.
4753 VELS UNIVERSITY VELS INSTITUTE OF SCIENCE TECHNOLOGY AND ADVANCED STUDIES (VISTAS) ADDRESS : VELAN NAGAR, P V VAITHIYALINGAM ROAD, PALLAVARAM, CHENNAI - 600 117
4754 VEMULA BHASKAR FOUNDATION ELURU MINI BYPASS ROAD, GREEN CITY, PLOT NO 9.
4755 VENDOR PLUS CONSULTANTS PRIVATE LIMITED SP-49-A, MAIN MARKET PANDAV NAGAR, OPPOSITE MOTHER DAIRY, PATPARGANJ,DELHI-110092 INDIA
4756 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE,JONNALAGADDA,NARASARAOPET,GUNTUR
4757 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE JONNALAGADDA(V), NARASARAOPET, GUNTUR DISTRICT
4758 VENKATESWARA SKILL FOUNDATION 12/13,RAJAYYA VEEDI, GORANTLA, ANANHAPUR, ANANTAPUR, ANDHRA PRADESH, INDIA, 515231
4759 VENUS COMPUTER EDUCATIONAL INSTITUTION 76, ALAGAR KOIL ROAD, GORIPALAYAM BUS STOP, MADURAI
4760 VERSATILE INFOSECURITY PRIVATE LIMITED M-73A, LGF, MALVIYA NAGAR, NEW DELHI
4761 VFX ANIMATION COLLEGE # 28/1 SKT COMPLEX,KAKKALUR ROAD THERADI THIRUVALLUR DIST
4762 VGENUINE SOLUTIONS PRIVATE LIMITED BUILDING 7 SIDCO RANGRETH
4763 VGENUINE SOLUTIONS PRIVATE LIMITED FIRST FLOOR BUILDING 7 SIDCO IE RANGRETH
4764 VHREDUCATIONAL SOCIETY DOOR NO:-10-1064-2-38G ,JAWAHAR NAGAR COLONY,MARKAPUR,PRAKASAM,ANDHRA PRADESH
4765 VIBHA EDUCATIONAL DEVELOPMENT SOCIETY #2-31, VIDYA NAGAR, OPP. JNTU MAIN GAYE, ANANTAPUR, ANDHRA PRADESH.
4766 VIDHARBH RURAL RECONSTRUCTION FOUNDATION KONGHARA AT.KONGHARA POST.PIMPRI TQ.KELAPUR DIST YAVATMAL
4767 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4768 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4769 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NR. MUKHTANAND SOCIETY, NARMADANAGAR, BHARUCH.
4770 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4771 VIDHYADEEP SOCIETY P.O NARMADA NAGAR, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
4772 VIDIAL SOCIAL SERVICE CENTER VIDIAL SOCIAL SERVICE CENTER BAUL COMPLEX (OPP MALAIMALAR OFFICE) MEENAKSHIPURAM NAGARCOIL
4773 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA
4774 VIDISHA SOCIAL WELFARE ORGANISATION RAGHU SADAN RAMDWARA VIDISHA
4775 VIDIYAL MAHALIR MEBATTU SANGAM 29K-RAMNAGAR, DEVAKOTTAI, SIVAGANGAI-DIST
4776 VIDIYAL MAHARIL MEMBATTU SANGAM 29K RAMNAGAR, DEVAKOTTAI SIVAGANGAI-DIST
4777 VIDYA GURU TEG BAHADUR TOWER, NEAR KHALSA SCHOOL, THANDI SADAK, SUBHASH NAGAR
4778 VIDYA SHRI GURU TEG BAHADUR TOWER NEAR KHALSA GIRLS SCHOOL NAINITAL ROAD HALDWANI NAINITAL
4779 VIDYA NR KHALSA SCHOOL SUBASH NAGAR NAINITAL ROAD HALDWANI
4780 VIDYA VAP TECHNOLOGY SHREE GURU TEG BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
4781 VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, COCHIN UNIVERSITY ROAD, CUSAT P.O, COCHIN
4782 VIDYADHIRAJA EDUCATION SOCIETY 27/3, ANAND NAGAR, KHANDELWAL MARG, MUMBAI
4783 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE, PATPARGANJ, EAST DELHI
4784 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI 110096
4785 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI
4786 VIDYA NIKETAN SEVABHAVI SANSTHA DONGARGAON DONGARGAON PO. DONGARPIMPALA TQ. GANGAKHED DIST. PARBHANI
4787 VIDYASAGAR ADEVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4788 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR 482003
4789 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4790 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
4791 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463, KHANKA ROAD, LALLU POKHAR , MUNGER
4792 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463,MISHRA COLONY KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4793 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED MISHRA COLONY, KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
4794 VIJAYA SOCIAL EDUCATIONAL AND CULTURAL TRUST #986, 2ND MAIN,VIDYARANYAPURAM, MYSORE - 570 008
4795 VIJAY GANGA RURAL MEDICAL AND RESEARCH FOUNDATION AT/P – BHALWANI, TAL-PARNER, DIST-AHMEDNAGAR. MAHARASHTRA
4796 VIJAY KUMAR CONTRACTOR HO. NO. - 37, MODERN SAKET COLONY, HISAR.
4797 VIJAY LAXMI TRANSPORT PRIVATE LIMITED AT.GANDHI CHOWK PO- BRAJRAJNAGAR DIST-JHARSUGUDA ODISHA
4798 VIKALP SEWA SAMITI 94, PASCHIMI TARAUS
4799 VIKASH D-2/7, INDUSTRIAL ESTATE RASULGARH, BHUBANESWAR
4800 VIKASH EDUCATION SOCIETY H.NO 1648 URBAN ESTATE JIND
4801 VIKASSHEEL FOUNDATION GRAM PANCHAYAT BHAVAN KE PAS, SHIVTARAI, TAHSIL-KOTA, BILASPUR, CHHATISGARH.
4802 VIKAS VIDYA MANDIR VILL-POST : DARIBA, AMAWAN,RAIBARELY,
4803 VIKRANT EDUCATIONAL AND SOCIAL WELFARE SOCIETY 3-B ASHIRWAAD, HARIOM COLONY, 7 NO CROSSING, MORAR,GWALIOR
4804 VILLAGE DEVELOPEMNT AND ENVIRONMENTAL ORGANISATION THE SECRETARY NEAR TO INDIAN OVERSEAS BANK., KADAYAMPATTY POST, OMALUR TK., SALEM DISTRICT TAMILNADU
4805 VILLAGE DEVELOPMENT TRUST 63/25, KAMARAJ NAGAR, 3RD STREET, CHOOLAIMEDU, CHENNAI. CECIL ROGERS SALES HEAD 9884922452 9677256296
4806 VILLAGE INDIA KALYAN SANSTAHN FRONT ON STATE BANK BINDKI(FATEHPUR)-212635
4807 VILLAGE INDIA KALYAN SANSTAHN KAUSHAL VIKAS PRASHIKSHAN KENDRA
4808 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK OF INDIA BINDKI FATEHPUR
4809 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK OF INDIA BINDKI FATEHPUR (UTTAR-PRADESH)
4810 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI
4811 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI ,FATEHPUR-212635 U.P
4812 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI (FATEHPUR)-212635
4813 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI(212635)-FATEHPUR U.P
4814 VILLAGE MULTIMEDIA PVT LTD NO.4, 1ST FLOOR, SUNRISE BUILDING, OPP KLE COLLEGE ,2ND STAG
4815 VIMALA DEVI SEWA SANSTHAN LOHIYA NAGAR MAHARAJGANJ
4816 VIMALAGIRI VIDYAPEETAM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 686664
4817 VINAYAGAR PERARASAR TRUST VPT 2/71 SABANAYAGAR STREET MA UAIDAYAR POST KATTUMANNARKOIL TALUK
4818 VINDHYA CONSULTANTS AND SERVICES PRIVATE LIMIITED KOTHI GULJAR BAG,OPPOSITE MULTIPURPOSE SCHOOL,BHARATPUR(RAJ.)
4819 VINOD JAIN SMRITI JAN KALYAN SAMITI 201, MAHESHWARI COMPLEX, POWER HOUSE ROAD, WARD NO. 25, RATLAM
4820 VIRAJ GLOBAL SECURITAS PVT LTD B 156 NEW ASHOK NAGAR , NEW DELHI
4821 VIRAT VOLUNTARY ORGANIZATION FOR RURAL AGRICULTUR VILLAGE DEVARGHATA TEH- DABHRA DIST-JANJHGIR CHAMPA C G
4822 VIRAT VOLUNTARY ORG RURAL AGRI AND TECHNOLOGY 47, SUKH SAGAR PHASE 3, PIPLANI BHOPAL
4823 VIRINCHI LIMITED PLOT NO 10, SRK COLONY, WEST MAREDPALLY, SECUNDERABAD
4824 VIRTUAL COMPUTER EDUCATION SHIV NAGAR NH-1A UDHAMPUR (J&K)
4825 VIRTUAL COMPUTER EDUCATIONAL SOCIETY SHIV NAGAR NH-1A
4826 VIRTUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 TILWARA ROAD APPOSITE HP PATROL PUMP SAGRA JABALPUR
4827 VIRTUE INTERNATIONAL PRIVATE LIMITED 63 ESPACE NIRVANA COUNTRY SECTOR - 50
4828 VIRTUE INTERNATIONAL PRIVATE LIMITED 63, ESPACE NIRVANA COUNTRY, SECTOR - 50
4829 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE MANAGING BOARD ROSALPATTI VILLAGE VIRUDHUNAGAR POST 626 001
4830 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE VIRUDHUNAGAR VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE VIRUDHUNAGAR
4831 VISHNU DAYAL SHIKSHA SAMITI 529K/197 SANT KABIR LANE KHURRAM NAGAR LUCKNOW 226022
4832 VISHNU DAYAL SHIKSHA SAMITI 529K/197, SANT KABIR LANE, KHURRAM NAGAR, LUCKNOW
4833 VISHNU VIKLANG SEWA SANSTHAN SAMITI VILLAGE AND POST PATAN
4834 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL, G.T ROAD, GHAZIABAD
4835 VISHVEHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL G.T. ROAD GHAZIABAD
4836 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE, NEAR SAMRAT HOTEL , G.T. ROAD GHAZIABAD
4837 VISHVESHWARYA SCHOOL OF BUSINESS 17, KIRAN ENCLAVE,NEAR SAMRAT HOTEL, G.T. ROAD, GHAZIABAD
4838 VISHVESHWARYA SCHOOL OF BUSINESS 17,KIRAN ENCLAVE NEAR SAMRAT HOTEL, G.T. ROAD GHAZIABAD
4839 VISHWABHARATHI EDUCATIONAL DEVELOPMENT TRUST 117 NIZAMPET ROAD KUKATPALLY BRINDAVAN COLONY HYDERABAD
4840 VISHWA BHARATI EDUCATION AND RURAL DEVELOPMENT SOCIETY SAI BRANDAVAN, POLICE STATION ROAD, HOKARNA
4841 VISHWAGYAN BAHUDDESIA SEVABHAVI SANSTHA OPP. UMER MASJID, GAZIPURA, LATUR
4842 VISHWA HINDU EDUCATION SOCIETY NO 1-111/1 A PDA COLLEGE ROAD AIWAN E SHAHI GULBARGA KARNATAKA
4843 VISHWATMAK JANGLI MAHARAJ ASHRAM TRUST AT MOHILI POST AGHAI TAL SHAHPUR SIDT THANE
4844 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI-75.
4845 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXT., NEAR SECTOR-7, DWARKA, DELHI.
4846 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI
4847 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA
4848 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4849 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
4850 VISION A RURAL DEVELOPMENT SOCIETY 14-8/3 SDPT RAMAYAMPET MEDAK DITRICT TELANGANA
4851 VISIONINDIA SOFTWARE EXPORTS LIMITED SHUBHAMKAR, PLOT NO 14, DHANASHREE COLONY, KARVE NAGAR, PUNE, MAHARASHTRA
4852 VISIONINDIA SOFTWARE EXPORTS LIMITED SHUBHAMKAR, PLOT NO 14, DHANASHREE COLONY, KARVE NAGAR, PUNE, MAHARASHTRA
4853 VISION SHIKSHA SAMITI DEOLI KHASRA NO. 1493/1136, NEAR JAHAZPUR CHUNGI NAKA UNCHA DISTT. BHILWARA
4854 VISION VOICE EDUCARE SOCIETY 111D/1 GARFA MAIN ROAD,JADAVPUR
4855 VISION WORLDTECH PVT LTD A-16 JAI AMBEY NAGAR TONK ROAD JAIPUR
4856 VISRI TECHNOLOGIES AND SOLUTIONS PLOT NO 89, VENKATESHWARA ENCLAVE, OPP:PRIYADARSHINI HOTEL, SUCHITRA X ROADS, SECUNDERABAD.AP
4857 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION ADDRESS:VISVESVARAYA FIRE AND SAFETY PRIVATE ITI TULSI NIKETAN HIRAN MAGRI,SEC 4, MAIN ROAD, CITY , STATE: UDAIPUR (RAJASTHAN) 313001 COUNTRY : INDIA CONTACT NO.: 0294-2460656, 9829242332.
4858 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION ADDRESS:VISVESVARAYA FIRE AND SAFETY PRIVATE ITI TULSI NIKETAN HIRAN MAGRI,SEC 4, MAIN ROAD, CITY , STATE: UDAIPUR (RAJASTHAN) 313001 COUNTRY : INDIA CONTACT NO.: 0294-2460656, 9829242332.
4859 VISVESVARAYA FOUNDATION VISVESVARAYA FOUNDATION, TULSI NIKETAN, MAIN ROAD, SEC 4, HIRAN MAGRI, UDAIPUR (RAJASTHAN) 313001
4860 VISWA BHARATHI TRUST HYDER NAGAR , KUKAT PALLI, HYD - 85
4861 VISWADEEPTHI EDUCATIONAL SOCIETY 20-151/A, JAILKHAN STREET, MITTOOR CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH
4862 VISWA SAI ADS FLAT NO 502, SIVA RESIDENCY, HINDI NAGAR, PANJAGUTTA, HYDERABAD
4863 VITRUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 OPP HP PERTOL PUMP TILWARA ROAD SAGRA JABALPUR
4864 VIVEKANANDA NAGAR PRAGATI VIVEKANANDA NAGAR, POST OFFICE:BABLA GOBINDAPUR PS: SANTIPUR DIST: NADIA WEST BENGAL 741404
4865 VIVEKANANDARURALANDURBANDEVELOPMENTASSOCIATION HNO 6-3-266,NEAR GEETA VIGNANA HIGH SCHOOL,RAMAGIRI,NALGONDA TELAGANA STATE
4866 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS DISTRICT, WEST BENGAL, PIN 743336
4867 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS , EMAIL :VSSU.IN@GMAIL.COM , WWW.VSSU.IN , PH +91 3174 277451 /9735706439
4868 VIVEKANAND EDUCATIONAL SOCIETY ADJ. SEC-18, HUDA, JAGADHRI
4869 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.BOFFICE, NEAR POWER HOUSE, PINDWARA, DIST-SIROHI(RAJ.)
4870 VIVEKANAND SHIKSHAN SANSTHAN OPP. R.S.E.B. OFFICE, NEAR POWER HOUSE,PINDWARA
4871 VIVEKANAND TT COLLEGE WARD 07 BHADRA
4872 VIVEK JYOTI NEAR MATA KALI MANDIR, NEW RAMNAGAR, ADHARTAL, JABALPUR
4873 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11 MUKAND VIHAR VILLAGE MUKANDPUR
4874 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11, MUKAND VIHAR VILLAGE, MUKANDPUR, DELHI
4875 VIVID FOUNDATION KH NO 283/53/2, GALI NO 11, JANTA VIHAR, MUKUNDPUR, DELHI
4876 VIVID FOUNDATION KH NO 283/53/2 LANE NO 11 MUKAND VIHAR VILLAGE MUKANDPUR DELHI
4877 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD
4878 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD,
4879 VIYAYLAXMI PRIVATE LIMITED GANDHI CHOWK BRAJRAJNAGAR JHARSUGUDA
4880 VJ SECURITY LLP B 156, NEW ASHOK NAGAR, NEW DELHI
4881 VK EDUCATIONAL AND TRAINING CENTER 783 DILDAR NAGAR KHATI BABA JHANSI
4882 VK EDUCATIONAL AND TRAINING CENTER 783 DILDAR NAGAR KHATI BABA JHANSI
4883 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E),NAVI MUMBAI,MAHARASHTRA STATE
4884 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E) NAVI MUMBAI 400614
4885 VLCC HEALTH CARE LIMITED 64, HSIDC, SECTOR-18, MARUTI INDUSTRIAL AREA, GURUGRAM
4886 VMART PLOT NO. 862,UDHYOG VIHAR INDUSTRIAL AREA PHASE V
4887 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED WZ-22, ASALATPUR, JANAKPURI
4888 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED FLAT NO.B, OLD NO. 9, NEW NO.2, LAKSHMI COLONY, (NEAR NORTH CRESCENT ROAD), T-NAGAR, CHENNAI
4889 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NEAR AUCKLAND HOTEL LAKKAR BAZAAR SHIMLA
4890 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NR AUCKLAND HOTEL LAKKAR BAZAR SHIMLA
4891 V M TECHNO SOFT PVT LTD G-3 SECTOR-1 AVANTI VIHAR, RAIPUR (CG)
4892 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO.3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD BHOPAL
4893 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN BHOPAL
4894 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR. BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL.
4895 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4896 VOC INDUSTRIAL TRAINING INSTITUTE VOC NAGAR,PATTALAMMAN KOVIL ST CHINNAMANUR
4897 VOCMAN INDIA PRIVATE LIMITED C 326, VIKAS PURI, NEW DELHI
4898 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4899 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
4900 VRUTTI NO.25, AECS LAYOUT, ASHWATHNAGAR,BANGALORE BANGALORE KARNATAKA 560094
4901 VRUTTI D-45/A EAST OF KAILASH DELHI
4902 VRUTTI VRUTTI, LIVELIHOOD RESOURCE CENTRE, 2ND FLOOR, "SRI RAGHAVENDRA NILAYA", # 25, AECS LAYOUT, ASHWATHNAGAR, SANJAYNAGAR (BEHIND PARATHA PLAZA), BANGALORE - 560094. KARNATAKA. PHONE: +91-80-23419616/23517241
4903 VSOFT TECHNOLOGIES PRIVATE LIMITED MY HOME HUB, BLOCK-I 4TH FLOOR, MADHAPUR HYDERABAD - 500 081
4904 V S SHAH EDUCATION AND SOFTWARE PRIVATE LIMITED 1/14 PARUL APARTMENT, SHANTADEVI ROAD, NAVSARI
4905 V S SHAH EDUCATION AND SOFTWARE PVT LTD 1/14, PARUL APARTMENT SHANTADEVI ROAD NAVSARI. GUJARAT
4906 VVJ CHARITABLE TRUST 93G/6A/2, PALAI MAIN ROAD, OPP TVS SHOWROOM, THOOTHUKUDI-628002
4907 VYAVASAYA JANA CHAITANYA SAMITHI H.NO: 1-9-8/1/11, FLAT NO:303, B BLOCK, GIRISHIKHARA PLAZA, RAM NAGAR, HYDERABAD, TELANGANA
4908 VYUGA CONSULTING # 2905/3 & 4, HOTEL GANESH COMPLEX SRINIVASAM PILLAI ROAD, RAILADY THANJAVUR
4909 WAGONS LEARNING PRIVATE LIMITED A-8, A/7-8, 4TH FLOOR, SRUSHTI, OPPOSITE CORPORATION BANK, BANER ROAD, PUNE
4910 WAKE UP SKILLS PVT LTD VISHNU SOFTECH, 2ND FLOOR, SHRI DINESH COMPLEX, NEHRU CHOWK, AGRA ROAD, DEOPUR, DHULE
4911 WALL COMMUNICATION PRIVATE LIMITED A-31/20, NETAJI GALI NO-1 MAUJPUR,
4912 WATERSHED ORGANISATION TRUST 'PRYAVARAN BUILDING' BEHIND MARKET YARD AHMEDNAGAR
4913 WATERSHED SUPPORT SERVICES AND ACTIVITIES NETWORK 12-13-452, STREET NO.1, TARNAKA, SECUNDRABAD
4914 WATRANA TRACTION COMPANY I-28,UPSIDC INDL.AREA,GREATER NOIDA-201306
4915 WATRANA TRACTION PRIVATE LIMITED G-3, SITE V, UPSIDC INDUSTRIAL AREA, GREATER NOIDA
4916 WBSCSTRDSEWA KULIANA, MALINCHA BELIABERAH
4917 WB SOFTECH 41/B/1 ASUTOSH MUKHERJEE ROAD P.S- BUDGE BUDGE P.O- BUDGE BUDGE BLOCK:- BUDGE BUDGE I KOLKATA, WEST BENGAL
4918 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH ,700103
4919 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH-700103
4920 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR,24 PARGANA SOUTH-700103
4921 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH-700103
4922 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH - 700103
4923 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR, 24 PARGANA SOUTH, 700103.
4924 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4925 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
4926 WE ARE HUMAN FOUNDATION WE ARE HUMAN FOUNDATION WORKSHOP, C-68, MANGE RAM COMPLEX, LOWER GROUND FLOOR, MAHAVIR VIHAR, SECTOR-1, DWARKA, NEW DELHI.
4927 WEBCOM ASSOCIATES PRIVATE LIMITED WEBCOM ASSOCIATES PRIVATE LIMITED, C/O: SUBHAS COLLEGE, 6A, CHANDAKA INDUSTRIAL ESTATE, INFOCITY, BHUBANESWAR
4928 WEBSKITTERS TECHNOLOGY SOLUTIONS PVT LTD 108/32/1 , SOUTH KODALIA , PS – GHOLA , PO- NEW BARRACKPORE , KOLKATA- 700131
4929 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4930 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4931 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
4932 WELCOME P LTD SIVA ST, MADURAI
4933 WELFARE ORGANISATION FOR RURAL LEAGUE DEVELOPMENT VEJENDLA POST ,CHEBROLU M GUNTUR DIST
4934 WELFARE SERVICES ERNAKULAM PONNURUNNI, VYTILA, ERNAKULAM, KERALA, INDIA
4935 WELKIN SOCIETY N-6/66, R-30, PRABHAT NAGAR,INDIRA NAGAR EXT., CHITAIPUR ROAD, SUNDERPUR, VARANASI-221005
4936 WELKIN SOCIETY N-6/66, R-30, PRABHAT NAGAR,INDIRA NAGAR EXT., CHITAIPUR ROAD, SUNDERPUR, VARANASI-221005
4937 WELSPUN INDIA LIMITED WELSPUN CITY, VILLAGE VERSAMEDI, TALUKA ANJAR
4938 WENS LINK ALHAJ COMMERCIAL COMPLEX, 1ST FLOOR, NEAR AGV BANK, NH-15, P.O.- BECHIMARI, DISTRICT.- DARRANG, STATE- ASSAM
4939 WENS LINK AMAN COMPLEX, 1ST & 2ND FLOOR, NH-15, KHARUPETIA
4940 WEST BENGAL SC AND ST RURAL DEVELOPMENT AND SOCIO ECONOMICS WELFARE ASSOCIATION GOPIBALLAVPUR , PASCHIM MEDINIPUR
4941 WE THE PEOPLE ROOM NO. 102, D211, LAXMANSINGH COMPLEX I, MUNIRKA, NEW DELHI 110067
4942 WHIZZY WORLD SURTEING VB COLLEGE ROAD RAINAWARI
4943 WINGSEDUCATIONS I-II 229/7 SANGAM VIHAR NEW DELHI
4944 WINSOME BREWERIES LIMITED VILL. SAREHKHURD, TEHSIL-TIJARA, DISTT.-ALWAR, RAJASTHAN 301001 INDIA
4945 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.195,EMKAY COMPLEX, KANGAYAM ROAD,TIRUPUR
4946 WISDOM EDUCATIONAL AND CHARITABLE TRUST 36 PRABHU NAGAR RAKKIYAPALAYAM PIRIVU KANGAYAM ROAD TIRUPUR 641606
4947 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.36,PRABHU NAGAR,RAKKIYAPALAYAM PIRIVU,TIRUPUR
4948 WITNUT COMPUTING PRIVATE LIMITED G77/2, SF, SHAHEEN BAGH, AF ENCLAVE-II, OKHLA, NEW DELHI
4949 WIZARD TECH COMPUTER ACADEMY PVT LTD SALEMPUR LAH BAZAR NEAR INDRALOK HOTEL CHAPRA
4950 WOMEN AND CHILDREN WELFARE SOCIETY 15/8, BIG STREET CHEYYAR
4951 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4952 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGR, KURINJIPADI, CUDDALORE
4953 WOMEN EMPOWERMENTAND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
4954 WOMEN ENTERPRENEURS OF KARNATAKA ASSOCIATION #6, BESIDE ESHWAR TEMPLE, ESHWAR NAGAR, AMARGOL, OPP.APMC HUBLI
4955 WOMEN ENTREPRENEURSHIP DEVELOPMENT INSTITUTE WEDI CPK COMPLEX, NEAR ARYASAMAJ, RAM MOHAN ROAD, KOZHIKODE
4956 WOMEN INTERNATIONAL NETWORK WIN D-8/8, RIGHT SIDE, PARYAVARAN COMPLEX,SAID-UL-A-JAIB,SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4957 WOMEN INTERNATIONAL NETWORK WIN D-8/8, PARYAVARAN COMPLEX, SAID-UL-A-JAIB, SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
4958 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI, KISHAN PURA, PANIPAT
4959 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI KRISHAN PURA PANIPAT
4960 WOMENS WELFARE SOCIETY 5-9-102/3, 1ST FLOOR, PUBLIC GARDEN ROAD, NAMPALLY, HYDERABAD
4961 WORLD WIDE SECURITY ORGANIZATION B-6, VIDHYA NAGAR HOSHANGABAD ROAD BHOPAL , MADHYA PRADESH
4962 WYATH SERVICES PRIVATE LIMITED GULAB MOHALLA,LOCK GATE SRINAGAR,SRINAGAR JAMMU AND KASHMIR
4963 XEAM VENTURES PRIVATE LIMITED E-202, IND. AREA, PHASE - 8B
4964 XEAM VENTURES PVT LTD XEAM TOWER, E-202, INDUSTRIAL AREA PHASE 8-B, SECTOR 74A, , SAHIBZADA AJIT SINGH NAGAR
4965 XECUTE HR SOLUTIONS PVT LTD #307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON – 122018
4966 XECUTE HR SOLUTIONS PVT LTD 307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON
4967 XINE IT BRAINS PRIVATE LIMITED L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW UTTAR PRADESH INDIA
4968 XINE IT BRAINS PVT LTD L-II/147 SEC-G L.D.A COLONY KANPUR ROAD LUCKNOW
4969 XI TECHNOLOGIES PVT LTD 4TH FLOOR, CHAKMIR, BUDGE BUDGE TRUNK ROAD, MAHESHTALA, KOLKATA – 700 141
4970 XPREZ INFOSOLUTIONS PVT LTD PLOT NO 7 ROOTS TOWER 8TH FLOOR LAXMI NAGAR DISTRICT CENTER DELHI.
4971 XYZ XYZ
4972 XYZ SSIISI SSSSF SDG SDG SG
4973 YACOM FOUNDATION NO 37 MUTHUKARUPPAKKONAR STREET BEHIND ROSE LAND PUDUKKOTTAI DT
4974 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE-411005
4975 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, CTS NO-95 A, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE
4976 YASH BAHU UDDESHIYE SEVA BHAVI SANSTHA TULSAI NIVAS, JALALPUR ROAD, NEAR ARUNODAYA RESIDENCY, PARLI VAIJNATH, DIST : BEED, MAHARASHTRA
4977 YASH EDUCATIONAL SOCIETY III-H/146, NEHRU NAGAR, GHAZIABAD
4978 YASH EDUCATION SOCIETY A/P. NIRA, TAL PURANDAR, DIST : PUNE MAHARASHTRA
4979 YASH EDUCATION SOCIETY AT POST NIRA, NEAR S.T. STAND, WARD NO. 2
4980 YASH EDUCATION SOCIETY A/P. NIRA, WARD NO. 2
4981 YASH EDUCATION SOCIETY AT POST NIRA, WARD NO. 2
4982 YASHODA SHIKSHAN PRASARAK MANDAL SATARA S. NO.242/1, NH-4, WADHE PHATA AT/PO-WADHE TAL & DIST-SATARA
4983 YASHWANT SHIKSHAN SANSTHA A/P - KSHETRA MAHULI, TAL./DIST - SATARA MAHARASHTRA
4984 YASHWANT SHIKSHAN SANSTHA 11, FIRST FLOOR, BACK OF SAMBHAJI NAGAR KAMAN,NEAR SHIVRAJ PETROL PUMP NH- 4 SATARA PIN- 415004.
4985 YATHARTH GURUKRUL COMPUTER SHIKSHAN SAMITI INDORE ROAD DEPALPUR
4986 YELLOW HOME HEALTH CARE PVT LTD 1-63-5-8B, KAVURI HILLS, JUBILEE HILLS POST
4987 YESH BAHUUDDESHIYA SEWABHAVI SANSTHA RAMPURI BK AT.POST.RAMPUTI BK, TQ.MANWAT DIST.PARBHANI HEAD OFFICE RAHUL NAGAR, PARBHANI
4988 YIMKUMMER WELFARE SOCIETY LUKONGMENDANG WARD, TULI TOWN. MOKOKCHUNG
4989 YIMKUMMER WELFARE SOCIETY YIMKUMMER WELFARE SOCIETY LUKONGMENDANG WARD, TULI TOWN. MOKOKCHUNG
4990 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH.
4991 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1, MOTILAL NEHRU NAGAR (EAST) BHILAI
4992 YOUNGSTERS ASSOCIATION YOUNGSTERS ASSOCIATION # 2/489,2ND FLOOR, OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL, NAGARAJPET, KADAPA -516001, CON: 08562-222083, FAX: 08562-222149
4993 YOUNGSTERS ASSOCIATION #2/489,OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL,NAGARAJPET,KADAPA -516001, CON:08562-222083,FAX:08562-222149.
4994 YOUTH ACTION FOR RURAL DEVELOPMENT RANI BHASKAR NILAYAM, 6-3-668/10/20, 1ST FLOOR, NEAR VENKATESHWARA SWAMY TEMPLE, DURGANAGAR COLONY, PANJAGUTTA, HYDERABAD, TELANGANA STATE
4995 YOUTH BASE DEVELOPMENT SOCIETY C- 1087, TIGRI COLONY
4996 YOUTH EDUCATIONAL SOCIETY HARIDWAR BYPASS ROAD, NEAR RISPANA PUL OPP. AKASHWANI BHAWAN DEHRADUN UTTARAKHAND
4997 YOUTH EFFORTS FOR SOCIETY YES TRUST NO 47, 1ST FLOOR KEB COLONY UDAYAGIRI MYSORE
4998 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
4999 YOUTH EMPOWERMENT SOCIETY 44 PRAHALAD COLONY, NEAR BY VISHNU GARDEN , SANGANER THANA , JAIPUR
5000 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
5001 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
5002 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
5003 YOUTH FOR NATION SOCIAL WELFARE AND EDUCATION SOCIETY PLOT NO. 7 AND 8 SHOP NO 1 SETHPHOOL CHAND NAGAR MANDIDEEP
5004 YOUTH FOR NATION SOCIAL WELFARE AND EDUCATION SOCIETY PLOT NO. 7 AND 8 SHOP NO 1 SETHPHOOL CHAND NAGAR MANDIDEEP
5005 YOUTH FOR NATION SOCIAL WELFARE AND EDUCATION SOCIETY PLOT NO. 7 & 8 SETH PHOOL CHAND NAGAR MANDIDEEP
5006 YOUTH INDIA SAKSHARTA MISSION BHITAR KAMTA, GOSANIMARI, DINHATA COOCH BEHAR, WEST BENGAL
5007 YOUTHNET YOUTHNET BILLY GRAHAM ROAD, NEAR KOHIMA COLLEGE, KOHIMA, NAGALAND
5008 YOUTHNET YOUTHNET, BILLY GRAHAM ROAD, OPP. KOHIMA COLLEGE, KOHIMA
5009 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
5010 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
5011 YOUTH UPTURN VOLUNTARY ASSOCIATION 16-3-245, 3RD FLOOR, TRENDSET TOWERS, RAMALINGAPURAM, NELLORE.
5012 YPJ EDUCATIONAL SOCIETY D.NO.1-9-837/2 TOP OF HIND BAKERY, POCHAMMAGALLY, NIZAMABAD DISTRICT, TELANGANA STATE
5013 YPR MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH
5014 YUVADESH SHIKSHA EVAM SAMAJIK KALYAN SAMITI C/O SHOURYA CONSULTANCY,GROUND FLOOR,JYOTI CINEPLEX,M P NAGAR,ZONE I BHOPAL
5015 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
5016 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
5017 YUVA JAGRUTI MANCH B-2/22, WALLFORT ENCLAVE, BEHIND RAMKRISHNA HOSPITAL, PACHPEDI NAKA, RAIPUR
5018 YUVA SANKALP BAHUUDDESHIYA SANSTHA WORD NO. 12, MOHAPA, TAL KALAMESHWAR, DIST NAGPUR
5019 YUVA SANKALP BAHUUDDESHIYA SANSTHA NAGPUR PLOT NO. 28, GOPAL NAGAR, NAGPUR
5020 YUVA SANSKRITI AVOM SAMAHJIK KALYAN SANGATHAN H.NO.- 1082, K.H. NO.- 199, GROUND FLOOR, NEAR MTNL EXCHANGE, KANJHAWALA ROAD, BAWANA
5021 YUVASHAKTI FOUNDATION 8 /4 , LAKSHA , PURNANAGAR ,BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE-411019
5022 YUVASHAKTI FOUNDATION 8/4 , LAKSHYA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
5023 YUVASHAKTI FOUNDATION 8/4 , LAKSHA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
5024 YUVASHAKTI FOUNDATION 8/4 , PURNANAGAR , NEAR RTO , CHINCHWAD , PUNE
5025 YUVA TRAINING AND PLACEMENTS RAMALINGAPURAM, TRENDSET TOWERS,3RD FLOOR,NELLORE-524001
5026 YUVA VIKAS SOCIETY 26,DEENDAYAL UPADHYAY MARG,ITO,NEW DELHI
5027 ZACLON INDIA LIMITED 54,55, 1ST & 2ND FLOOR,VASHISHT PARK, MAIN PANKHA ROAD ,SAGARPUR,NEW DELHI-110046
5028 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR, JAMMU AND KASHMIR
5029 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR JAMMU AND KASHMIR
5030 ZAINUL ABIDEEN TECHINICAL TRAINING CENTRE SHALTENG CROSSING SRINAGAR
5031 ZAINUL ABIDEEN TECHINICAL TRAINING CENTRE SHALTENG
5032 ZAINUL ABIDEEN TECHINICAL TRAINING CENTRE SHALTENG CROSSSING SRINAGAR
5033 ZENITH CAREER WINGS 51-A,NEHRU STREET , RAMNAGAR, COIMBATORE
5034 ZENITH NEEDS MULTMEDIA T.S.NO:3074-3075, GNANA ARUL PLAZA 1ST FLOOR, RAJA RANI COMPLEX, KEELA RAJA VEETHI, PUDUKKOTTAI DISTRICT.
5035 ZENSOFT TECHNOLOGIES PRIVATE LIMTED WRIGHT EDUCATION, NEAR PANJAB NATIONAL BANK, MAIN MARKET KARANPRAYAG, DISTT-CHAMOLI UTTARAKHAND
5036 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL
5037 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL HYDERABAD
http://rural.nic.in    http://aajeevika.gov.in    http://nird.org.in http://www.nabcons.com http://ddugky.gov.in