Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 2COMS CONSULTING PVT LTD 388,BLOCK G.NEW ALIPORE.KOLKATA
3 982 PARKAL WARANGAL DISTRICT ANDHRA PRADESH 9-82 PARKAL WARANGAL DISTRICT ANDHRA PRADESH.
4 A2Z MULTISERVICES AND IT SOLUTIONS PVT LTD H.NO.201/7,DOCTORS COLONY,CIVIL LINES,BAREILLY MOB:9897033301
5 AAA AAA
6 AAA BBB JABBALPUR, KATHMANDU,
7 AAA SOCIETY A AA AAAAAAAAAAAAAA
8 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
9 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 BAIHAR ROAD BESIDE OF DR GANDHI C/O PANCHSHEEL COMPUTER BALAGHAT DIST-BALAGHAT
10 AADARSH BUDHI PANCHSHEEL JAGRATI SAMITI WARD NO 10 NEAR BY DR. VIJAY GANDHI, BAIHAR ROAD C/O PANCHSHEEL COMPUTER BALAGHAT DIST- BALAGHAT
11 AADHAR SECURITY SERVICES SHARMA NIWAS GADDA WALA MOHALLA NAKA CHANDRAVADNI LASHKAR GWALIOR
12 AADIT SYSTEMS 1ST FLOOR, SHRI JI PLAZA, OPP. ZILLA PANCHAYAT, JOHAR ALI ROAD, CIVIL LINES, RAMPUR, U.P.
13 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
14 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
15 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
16 AAITA EDUCATIONAL SOCIETY MOHALLA AHMADPUR RATI, SHAHJAHANPUR UP
17 AAKANKSHA UTPRERAK SAMAJIK SANSTHA AT-NAWAGARH MORE,POST-KHARKHAREE,DIST-DHANBAD,JHARKHAND,PIN-828125
18 AAKASH AGRI SOLUTIONS PRIVATE LIMITED GUT NO 226, AT POST ANVI TQ SILLOD
19 AAKASH AGRI SOLUTIONS PRIVATE LIMITED AT POST SILLOD
20 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
21 AAKASH CONDUCTORS AND WIRES INDIA PRIVATE LIMITED 14-B, NEW INDUSTRIAL ESTATE, RAWABHATA, RAIPUR C.G.
22 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
23 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
24 AARAV MEDISHINE PRIVATE LIMITED 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.- DURG (C.G.)
25 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
26 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
27 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
28 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
29 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
30 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
31 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
32 AARTHI A1 TRADERS 9D/14, 50 FEET ROAD, RAMAKRISHNAPURAM, KARUR
33 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
34 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD
35 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
36 AASHARA FOUNDATION VASTRAPUR, AHMEDABAD GUJARAT
37 AASHARA FOUNDATION AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY VASTRAPUR, AHMEDABAD
38 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
39 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
40 AASTHA EDUCATION AND WELFARE SOCIETY C/O ABAHYKUMAR DANDAGE F-5 SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
41 AASTHA EDUCATION AND WELFARE SOCIETY C/O,ABHAYKUMAR DANDAGE, F-5,SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
42 AASTHA EDUCATION AND WELFARE SOCIETY C/O, ABHAYKUMAR DANDAGE, SAISIDHI APARTMENT PUNDALIKWADI MAHAVEER CHOUK NANDED
43 AASTHA VIKAS TRUST 205 B 21ST CENTURY BUSINESS CENTER RING ROAD SURAT
44 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO. 1, SUMSUL ARIFFA NAGAR, EAST GATE, THANJAVUR TOWN,THANJAVUR DISTRICT, TAMILNADU, INDIA-
45 AATHAR RURAL IMPLEMENT FOR HUMANITY AWARENESS TRUST NO.1, SUMSUL AARIFFA NAGAR, PERIYAR SALAI ROAD, KEELAVASAL, THANJAVUR
46 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
47 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
48 AAYUSHMAN SAMITY 2A- BASANT VIHAR COLONY,MAHAVIR NAGAR, RAIPUR CHHATISGARH
49 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
50 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
51 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
52 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
53 ABBASI EDUCATIONAL AND WELFARE TRUST A2/25B, FIRST FLOOR, HASTSAL ROAD, UTTAM NAGAR, NEW DELHI, NEAR HOLI CHOWK
54 ABC JHSDJHDFKLJDFKJHJKGD
55 ABC JKLJLJK
56 ABC BHOPAL
57 ABC KALARA BURDWAN
58 ABCD ABCD
59 ABCD ABCDEFGHIJKLMNOP
60 ABC FIRM LTD PATNA
61 ABCL EDUCATIONAL PRIVATE LIMITED 52/12 M.M.H. COLLEGE ROAD, MODEL TOWN WEST,GHAZIABAD
62 ABCL EDUCATIONAL PRIVATE LIMITED 52/12, M.M.H. COLLEGE ROAD, MODEL TOWN WEST GHAZIABAD
63 ABC PVT LTD PUNE
64 ABC TRUST LKCNSDKAJD
65 ABDIN EDUCATINAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
66 ABDIN EDUCATIONAL CULTURAL SOCIETY BARAE ILMOFUN FLAT NO 202, KALYANI COMPLEX, LANGERTOLI,PEERBAHORE, BANKIPUR, PATNA
67 ABD PVT LTD XYZ
68 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
69 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
70 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
71 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
72 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
73 ABHAY DATA SEWA SAMITI RAM KUTEER, A-9/9, JAIL GARDEN ROAD,RAEBARELI
74 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
75 ABHINAV MANAVHITWADI SANSTHA SATARA ABHINAV MANAVHITWADI SANSTHA PLOT NO 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR DISTRICT SATARA
76 ABHINAYTOSH MAHILA BAL VIKAS SAMITI SEVA HOSPITAL PREMISES, PADMAKAR NAGAR, MAKRONIA, SAGAR, MADHYA PRADESH
77 ABHISHEK EDUCATIONAL SOCIETY AMIT VIHAR ,KUKRA ,MUZAFFAR NAGAR
78 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
79 ABHYAAS EDU CORP BHANU ESTATES, MIG-68, BEHIND ICICI BANK, OPPOSITE JNTU, KUKATPALLY, HYDERABAD, TELANGANA
80 ABHYUDAY VEDANT SOCIETY VANDE MATARAM BHAVAN, CHURCH ROAD KUNKURI, DIST. - JASHPUR
81 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
82 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
83 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
84 ACADEMICIANS VANDANA PALACE, KHAGUAL-CANTT ROAD, GARIKHANA, KHAGUAL, PATNA
85 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
86 ACADEMY OF SKILL DEVELOPMENT AND EDUCATIONAL TRUST RAMNAGAR ROAD NO 1, OPP YUBA SANGHA CLUB, AGARTALA, WEST TRIPURA
87 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
88 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
89 ACAT EDUCATION PRIVATE LIMITED ACAT EDUCATION PRIVATE LIMITED,1ST FLOOR,RAJ COMPLEX,SANICHARA ASTHAN,DR. P.GUPTA ROAD,NEAR VIJAYA BANK,WARD-20,CHATTI,RATANPUR,BEGUSARAI (BIHAR,PIN-851101
90 ACCEL IT RESOURCES LIMITED NO.37 V FLOOR, CHATEAU D' AMPA BUILDING, NELSON MANICAKAM ROAD, AMINJIKARAI, CHENNAI, TAMILNADU
91 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
92 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
93 ACCESS SOLAR LTD PLOT NO.104, PRASHANTHI NAGAR, I.E.KUKATPALLY HYDERABAD – 500 072 TELANGANA, INDIA
94 ACCILERATOR SMARTGRO MARKETING PRIVATE LIMITED #1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARTHAHALLI
95 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
96 ACCURATE EDUCATION AND RESEARCH SOCIETY C-187,SURYANAGAR, GHAZIABAD, UP
97 ACE CONSULTING PRIVATE LIMITED NO.309 2ND FLOOR DEEP PLAZA OPPOSITE GURGAON COURT SOHNA ROAD GURGAON HARYANA 122001
98 ACE FOUNDATION SHAKTINAGARAPADA,NEAR POLICE STATATION, BHAWANIPATNA
99 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
100 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
101 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
102 A C T EDUCATIONAL AND CHARITABLE TRUST NO.2070, 1ST STREET, VASANTHAM COLONY, ANNA NAGAR, CHENNAI
103 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
104 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
105 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
106 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
107 ACTION FOR ADVANCEMENT OF SOCIETY A-30, MADHAV RAO SAPARE NAGAR, BIRGAON, RAIPUR, CHHATTISGARH
108 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
109 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
110 ADAIKALA MADHA TECHNICAL INSTITUTE TRUST ADAIKALA MADHA TECHNICAL INSTITUTE, THOOTHUR MAIN ROAD, ELAKURICHI VILLAGE & POST, THIRUMANUR - VIA, ARIYALUR - TK & DT, TAMIL NADU STATE, PIN - 621715.
111 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
112 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
113 ADANI FOUNDATION 8TH FLOOR, SHIKHAR, NR. MITHAKHALI CIRCLE NAVRANGPURA
114 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
115 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
116 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
117 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
118 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
119 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
120 ADARSH FOODS CITY STATION ROAD KHURJA
121 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
122 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
123 ADARSH SHIKSHAN PRASARAK MANDHAL ADIMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD MAHARASHTRA
124 ADARSH SHIKSHAN PRASARAK MANDHAL ADMINISTRATIVE BULDING SHRIPATRAO BHOSALE HIGH SCHOOL CAMPUS TAMBARI VIBHAG OSMANABAD
125 ADARSH SHIKSHAN SAMITI KARELI MAHADEV WARD KARELI
126 ADARSH VIDHYA SAMITI 87 UTTAM GIRI COLONY,SHASTRIPURAM, NEAR DOUBLE CROSSING CHUCHAINA NAGLA, AGRA
127 ADARSH VIDHYA SAMITI 87 UTTAMGIRI COLONY,NEAR DOUBLE CROSSING, SHASTRIPURAM AGRA
128 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
129 ADEPT EDUSYS PRIVATE LIMITED HALL NO. 6,11 NO STOP,ARERA COLONY,BHOPAL,(M.P.)
130 ADEPTEDUSYSPVTLTD HALL NO.-6,11 NO. STOP,ARERA COLONY,BHOPAL(M.P.)
131 ADEPT TECHNOLOGY PRIVATE LIMITED NO. 28 FIRST FLOOR, J.K TOWERS BAZULLAH ROAD, T. NAGAR, CHENNAI
132 ADESHWAR SHIKSHAN SAMITI 26 MEDICAL COMPLEX,G.E ROAD, RAIPUR, C.G
133 ADG ONLINE SOLUTIONS PRIVATE LIMITED 103-105,LG-02 CHARMWOOD PLAZA, CHARMWOOD VILLAGE, FARIDABAD
134 ADHARSHA MAHILA MANDALI PULLUR,KURNOOL MANDAL,DIST.AP
135 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS-I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
136 ADHUNIK SHIKSHAN PRASARAK MANDAL 801, JIMMY TOWERS I, SECTOR 8, KOPARKHAIRNE, NAVI MUMBAI, MAHARASHTRA
137 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
138 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
139 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
140 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
141 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
142 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
143 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
144 ADITYA ENTERPRISES C84 KANTIPURAM MATIYARI
145 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
146 ADIVASI CHETNA SHIKSHAN SEVA SAMITI ADIVASI CHETNA SHIKSHAN SEVA SAMITI, NEAR BUS STAND,DILEEP GATE,
147 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
148 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
149 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
150 ADIVASI SOCIETY FOR HELPING ATTITUTE RAMAN PADA, KUTRA
151 ADIVASI SOCIETY FOR HELPING ATTITUTE KUTRA, SUNDARGARDH, ODISHA
152 ADIWASI DEOMOGRA EDUCATION SOCIETY AT POST PATHRAI, TALUKA AND DIST NANDURBAR
153 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
154 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
155 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
156 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
157 ADVANCED LIFE CARE MULTIDESCIPLINARY HOSPITAL PRIVATE LIMITED 26-KASIA ROAD CANTT CROSSING DAUDPUR GORAKHPUR U.P
158 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
159 ADVANCE EDUCATION SOCIAL WELFARE SOCIETY 45, 2ND FLOOR, GIRIRAJ COMPLEX, MP NAGAR ZONE-2, BHOPAL, MP
160 ADVANCE INFORMATION AND MULTIMEDIA EDUCATION SOCIETY 53 A, MAIN ROAD KARRAHI, BARRA, KANPUR
161 ADVENT CHEMBIO PRIVATE LIMITED 21, QUEEN VIEWS, JUHU ROAD, MUMBAI
162 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
163 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
164 ADWIK SECURITY AND HR SOLUTIONS PVT LTD 99/5/8E BALLYGUNGE PLACE
165 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
166 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
167 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
168 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
169 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
170 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
171 AGRI AND SOCIO ECONOMIC DEVELOPMENT TRUST KALIAMMAN KOVIL NEAR, GENGUVARPATTY POST PERIYAKULAM
172 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
173 AGS SKILLS INDIA PRIVATE LIMITED PLOT NO:95, DOOR NO: 19, KUMARAN COLONY, 3RD STREET, VADAPALANAI, CHENNAI -600026
174 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
175 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
176 AHILYABAI HOLKAR GRAMIN VIKAS PRATISTHAN SANSTHA AT-BHAJE , POST-KAMSHET, TAL-MAWAL , DIS-PUNE, MAHARASHTRA.
177 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
178 AIFA INFOTECH PVT LTD 572/2D, ADRSH NAGAR, NEW RAILWAY ROAD, OPP, AUTO STAND, GURUGRAM, HARYANA-122001
179 AIFA INFOTECH PVT LTD 572/2, AADRSH NAGAR, NEW RAILWAY ROAD, OPP. AUTO STAND, GURUGRAM HR
180 AIFA INFOTECH PVT LTD 572/2,ADARSH NAFAR, NEW RAILWAY ROAD, OPP. AUTO STAND,GURUGRAM HARYANA-122001
181 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
182 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
183 AIMS 
#22,8TH MAIN,3RD CROSS,SARASWATHIPURAM, 
MYSORE
184 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
185 AIMTRON ELECTRONICS PVT LTD PLOT NO.1/A, G.I.D.C. ESTATE WAGHODIA
186 AIRWAAVE COMMUNICADO INDIA PRIVATE LIMITED NO.353,SRI DURGA ARCADE, 3RD FLOOR, 2ND MAIN ROAD, 8TH BLOCK JAYANAGAR, BANGALORE KA
187 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
188 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
189 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
190 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
191 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
192 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
193 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
194 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
195 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
196 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
197 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
198 AKRITI SAMAJIK SANSTHAN 3RD FLOOR, STAR GLAXY COMPLEX, NEAR- VERMASELL PETROL PUMP, DAKBUNGLOW ROAD, HAJIPUR, VAISHALI, BIHAR 844101
199 A K SAMANTARAY AND COMPANY PRIVATE LIMITED PLOT NO. 309/1801, SUB PLOT NO.1, SBI CAMPUS, SAILASHREE VIHAR, BHUBANESWAR
200 AKSARA SOCIAL SERVICE SOCIETY H.NO-9-82 PARKAL WARANGAL DISTRICT
201 AKSH EDUCATIONAL WELFARE SOCIETY VILL SADHARANPUR POST KASTAL SHAMSHER NAGAR WEST UP
202 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
203 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
204 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
205 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
206 ALAYAM WELFARE TRUST 117-B, PERIYAR NAGAR, PULIAKULLAM COIMBATORE-641045, TAMILNADU.
207 ALBAN COMMUNICATIONS INDIA PRIVATE LIMITED 502, AGH CHAMBERS, 379-381 NARSHI NATHA STREET, MASJID BUNDER(WEST) MUMBAI-400009, MAHARASHTRA
208 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
209 ALFAA TECH PRIVATE LIMITED H.NO.132/A, NOBAL ENCLAVE, SECTOR-22, GURGAON, HARYANA -122001
210 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
211 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
212 ALFA VISION INFOTECH EDUCATIONAL TECHNICAL AND VOCATIONAL SOCIETY BADABUM, PARESHIPURA, KHANDWA (M.P.)
213 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
214 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
215 ALHUDA PUBLIC SHIKSHA SEWA SAMITI VILL BANKATWA MAKOLIYA P/O TURHANI RAJJAB DISTT BAHARAICH UP 271802
216 ALIGN SKILLS EDUTECH W.NO. 6, NEAR CHUNA FATAK, HANUMANGARH
217 AL KARIM BAHUUDDESHIYA SEVABHAVI SANSTHA AT POST PALI
218 ALLAHABAD SHIKSHAN SHOD SANSTHAN LC-152 ADA COLONY NAINI ALLAHABAD UP-211008
219 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
220 ALLCARGO LOGISTICS LIMITED 6TH FLOOR, AVVASHYA HOUSE, CST ROAD, SANTACRUZ (E), MUMBAI - 400098 INDIA TEL: +91-22-66798100 FAX: +91-22-66798195 MARCOM@ALLCARGOLOGISTICS.COM CHANDRAKANT.PATIL@ALLCARGOLOGISTICS.COM
221 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
222 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
223 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
224 ALL INDIA COUNCIL OF TECHNICAL EDUCATION AND TECHNOLOGY UTTRA KOWGACHI, VIVEKANANDA LANE, NEAR – SHAKTI SANGHA CLUB, P.O. - SHYAMNAGAR, P.S.- JAGATDDAL
225 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
226 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
227 ALL INDIA MINORITY WELFARE ACTION GROUP LUCKNOW 215/6 KHA SUBHASH MARG CHOWK LUCKNOW
228 ALL INDIA SOCIETY FOR MODERN ELECTRONICS AND COMPUTER TECHNOLOGY SADAT GHAZIPUR
229 ALL INDIA TECHNICAL AND MANAGEMENT COUNCIL UNIT NUMBER 236, TOWER B3, SPAZE IT PARK, SECTOR 49, SOHNA ROAD, GURGAON
230 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
231 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
232 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
233 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
234 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
235 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
236 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSABAD, TENGPORA, BYPASS BATMALOO
237 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO 19, FIRDOUSABAD TANGPORA BYPASS SRIANGAR KASHMIR
238 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
239 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
240 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
241 ALMIGHTY INTERNATIONAL SOCIETY OUTSIDE MANNA PHATAK, MALERKOTLA
242 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
243 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
244 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
245 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
246 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
247 AMANDEEP HOTELS PRIVATE LIMITED 5/5, RAJGARH KOTHI A.B. ROAD, INDORE
248 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
249 AMAN GROUP OF INDIA AMAN KI SHAAN , QILA ROAD DHALGAR TOLLA POST SADAR , JAUNPUR
250 AMASS SKILL VENTURES PVT LTD 2ND FLOOR ,SHRI KRISHANA DHARAM KANTA COMPLEX, NAHARPUR RUPA MORE, OPP. ANAJ MANDI N.H.-08,GURGAON-122001
251 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
252 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
253 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
254 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
255 AMECH BUSINESS SOLUTION PRIVATE LIMITED A 22,2ND FLOOR, SECTOR-3 NOIDA
256 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
257 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
258 AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-686/K/15, 4TH FLOOR, BANJARA HILLS, ROAD NO12,HYDERABAD.
259 AMITITEK SOLUTIONS PRIVATE LIMITED M.S.TEJASWI CEO, AMITITEK SOLUTIONS PRIVATE LIMITED 8-2-636/K/15, 4TH FLOOR,OPP:AUDI SHOW ROOM, BANJARAHILLS,ROADNO12,HYDERABAD 500034
260 AMIT KHADI GRAMOUDYOG SANSTHAN KHADI PLANET MEERUT ROAD SHAMLI
261 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
262 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
263 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
264 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
265 AMRAWATI EDUTECH OPC PRIVATE LIMITED 89-P RAMJANKI NAGAR CHOWK BASHARATPUR GORAKHPUR
266 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
267 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
268 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
269 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
270 AMRO WORKFORCE PRIVATE LIMITED 2ND FLOOR, 304, DEVRANI COMPLEX, LALPUR, RANCHI
271 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
272 AMRUTHA FOUNDATION NO.306, D.B.ROAD, R.S.PURAM, COIMBATOR E- 641 002
273 AMRUTHA FOUNDATION NO.306, D.B. ROAD, R.S..PURAM, COIMBATORE - 641002 TAMILNADU - INDIA
274 AMS EDUCATIONAL TRUST 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
275 AMS EDUCATIONAL TRUST : 2E, 91 & 92 MUNICIPALITY MARKET COMPLEX, SECOND FLOOR, STATION ROAD, SODEPUR, KOLKATA-700110
276 AMUDHASURABI NEAR INDIAN OIL BANK THIRUVALUVAR NAGAR, PENNAGARAM (PO) & TALUK, DHARMAPURI (DT), TAMILNADU
277 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
278 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
279 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
280 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
281 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
282 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
283 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
284 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
285 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
286 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
287 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
288 ANDHRA CARDIOLOGY ASSOCIATES PRIVATE LIMITED 6-3-248/1/1A, CARE HOSPITAL, ROAD NO.1, BANJARA HILLS, HYDERABAD-500034
289 ANDHRA MAHILA SABHA ANDHRA MAHILA SABHA DDMS,LITERACY HOUSE, AMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
290 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
291 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM, PERAMBALUR
292 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
293 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
294 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN NAGAR, OLD LIC BUILDING, VEKATESAPURAM
295 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
296 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71,DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
297 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM,PERAMBALUR
298 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR,BUMGUNDESHWAR CIRCLE,BVBCOLLEGE ROAD BIDAR KARNATAKA,INDIA
299 ANEES MEMORIABLE EDUCATIONAL TRUST MUQUEEM PLAZA 1ST FLOOR BUMGUNDESHWAR CIRLCE BVB COLLEGE ROAD BIDAR 585403
300 ANEES MEMORIABLE EDUCATIONAL TRUST AME,MUQUEEM PLAZA 1ST FLOOR ,BUMGUNDESHWAR CIRCLE,BVB COLLEGE ROAD BIDAR,KARNATAKA
301 ANFAR FOUNDATION 2ND FLOOR, ANFAR SHOPPING CENTRE, J.K. KEDIA ROAD, HOJAI, P.O. HOJAI, P.S. HOJAI, DISTRICT- NAGAON, ASSAM, INDIA
302 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
303 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
304 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
305 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 FARIDABAD
306 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERD OFFICE 606 VPO RAVAN URF BARAGOAN KHEKRA BAGHPAT UP CORP 445 BLOCK B SECTOR 7 FARIDABAD HARYNA 121006
307 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
308 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY REGISTERED OFFICE 606 RAVAN URF BARAGOAN KHEKRA BAGHPAT CORPORATE OFFICE - 445 BLOCK B SECTOR 7 FARIDABAD
309 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE, DHARAMPETH
310 ANJANA BAHUDDESHIYA SHIKSHAN SANSTHA PLOT NO 179 A, GOKUL VAIBHAV APARTMENT, FLAT NO 104, BESIDES VENUS BOOK CENTRE
311 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
312 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
313 ANJANEYA CHARITABLE AND EDUCATIONAL TRUST OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT BEHRAMPUR GANJAM
314 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
315 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
316 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
317 ANJENYA WELFARE ORGANISATION 1067, AWASTHI KA BADA, GOLE BAZAR , JABALPUR (M.P.)
318 ANKASH TECHNOLOGIES PRIVATE LIMITED 56-A, G/F, MALVIYA NAGAR, NEW DELHI-110017,
319 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO 3,DIGDOH HILLS ,HINGNA MIDC,NAGPUR
320 ANKUSH SHIKSHAN SANSTHA CRPF GATE NO.3, DIGDOH HILLS,HINGNA MIDC, NAGPUR
321 ANKUSH SHIKSHAN SANSTHA ANKUSH SHIKSHAN SANSTHA, CRPF GATE, DIGDOH HILLS, HINGNA MIDC, NAGPUR, 440016
322 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
323 ANKUSH WELFARE SOCIETY D.NO:- 41-18-27, TIRUMALA RAO STREET, KRISHNALANKA, VIJAYAWADA-520013
324 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
325 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
326 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
327 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
328 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
329 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
330 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
331 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
332 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
333 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
334 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
335 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
336 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
337 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
338 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
339 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
340 ANNAMALAI ASDJFKL ADF ASDF AS F
341 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
342 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
343 ANNAPURNA SEVA SANSTHAN E-3011, RAJAJIPURAM, LUCKNOW
344 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
345 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW MOBILE NO. 7985486626
346 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
347 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
348 Ansar ul masakaeen educational society w/o Syed abdul wahid qadri check no 1(Badri Nath) Badgam Jammu and Kashmir-191113
349 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
350 ANTAKSHARI FOUNDATION ANTAKASHARI FOUNDATION G-02 HOUSE NO-173 WORD NO-3 MEHRAULI, NEW DELHI
351 ANTOYODAYA SAI KRIPA SEWA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA DISTT SAGAR
352 ANTYODAYA SAI KRIPA SEVA SAMITI HOUSING BOARD COLONY MIG 55 RAJIV NAGAR WARD BINA
353 ANTYODAYA SAI KRIPA SEVA SAMITI MIG 55 HOUSING BOARD COLONY RAJEEV NAGAR WARD BINA DISTT SAGAR
354 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI C/O VANSH CONVENT SCHOOL,KALPI BRIDGE COLONY, MORAR
355 ANUBHAV CHAUHAN SAMAJ SEWA EVAM SHIKSHA SAMITI VANSH CONVENT SCHOOL, KALPI BRIDGE COLONY, MORAR, GWALIOR
356 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
357 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
358 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
359 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
360 ANUMEHA HEALTH CARE AND FASHION PVT LTD ANUMEHA VILLA (AHCC) P N BOSE COMPOUND NEAR KC ROY MEMORIAL HOSPITAL BESIDE BANARJEE LODGE LALPUR RANCHI JHARKHAND
361 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
362 ANUNA EDUCATION NETWORK PVT LTD B-13, NIRALA NAGAR,
363 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
364 ANUPURNA FOOD CRAFT INSTITUTE TAPOVAN LUXMAN JHULLA VIA SHIVA NAND NAGER TEHRI GARHWAL
365 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
366 ANURAG WALFARE SOCIETY ANURAG WALFARE SOCIETY VILLAGE + POST - BHAILA KHURD SAHARANPUR
367 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
368 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
369 APAAR C/O DR. M.C. BHATT, 7/12 RAMASHRAM, TAKANA ROAD
370 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
371 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
372 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
373 APEX EDUCATION AND DEVELOPMENT SOCIETY 2ND FLOOR,HOTEL VRUNDAVAN,OPP BUS STAND,DAHOD.GUJ
374 APEX EDUCATION AND DEVELOPMENT SOCIETY NEAR VOHRA MUSAFIR KHANA. STATION ROAD,DAHOD
375 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
376 APEX INDIA EDUCATION AND CHARITABLE TRUST APEX INDIA EDUCATION AND CHARITABLE TRUST, DOOR NO' 11 T337 ' T'K'PET' NEAR NADAR KALYANA MANDAPAM, GUDALUR, GUDALUR BAZAAR POST, NILGIRIS TN- 643212
377 APLOMB ABHILASHA BHAWAN MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA
378 APNA TELE LINK PRIVATE LIMITED SCO 1-12, 4TH FLOOR, PPR MALL, MITHAPUR ROAD JALANDHAR CITY
379 APPAREL AND LEATHER TECHNICS PRIVATE LIMITED KAIKONDRAHALLI, CARMELRAM POST NEAR BELLANDUR GATE, SARJAPUR ROAD, BANGLORE
380 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
381 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
382 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
383 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE, TADEPALL(M),GUNTUR(DIST)
384 AP WOMENS COOPERATIVE FINANCE CORPORATION H.NO.3-550, 2ND ROAD, UNDAVALLI CENTRE,GUNTUR.
385 AQSA ALPSANKHYAK EDUCATION AND WELFARE SOCIETY AMEEN COLONY, DHAR ROAD PARBHANI
386 ARADHANA EDUCATIONAL AND CHARITABLE TRUST ARADHANA EDUCATIONAL CAMPUS, BHAVNAGR ROAD, BOTAD
387 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
388 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
389 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
390 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
391 ARASAN RURAL DEVELOPMENT SOCIETY 129-D, ANASALAI,KALAKAD,TIRUNELVELI DISTRICT, TAMIL NADU
392 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
393 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
394 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMILNADU 614601
395 ARASU EDUCATIONAL AND CHARITABLE TRUST 149, BIG STREET, PRABHA STUDIO UPSTAIRS, PATTUKKOTTAI, THANJAVUR 614601
396 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
397 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
398 ARASU EDUCATIONAL AND CHARITABLE TRUST BIG STREET PATTUKOTTAI TAMIL NADU 614601
399 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
400 ARCENCIEL FOUNDATION H. NO. 85B, KHRIYA POKHARA BASHARATPUR, MEDICAL ROAD GORAKHPUR GORAKHPUR UP 273004 IN
401 ARCEUS INFOTECH PVT LTD C/706,CLASSIQUE BLDG,NEEKHANTH PALMS,GHODBANDER ROAD OPP CINE WONDER MALL THANE
402 ARCEUS INFOTECH PVT LTD 508, 5TH FLOOR, THE SUMMIT BUSINESS BAY (OMKAR), ANDHERI-KURLA ROAD, ANDHERI (EAST), MUMBAI - 400093
403 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
404 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR, PICNIC SPOT ROAD LUCKNOW
405 ARCTEL TECHNOLOGY ENTERPRISES FIRST FLOOR SHREE RAM BHAWAN PICNIC SPOT ROAD KHURAM NAGAR LUCKNOW
406 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
407 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
408 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
409 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
410 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
411 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
412 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
413 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
414 ARKLE CONSULTANCY PRIVATE LIMITED 308-309, 3RD FLOOR, K-48-49, GEETANSH CLASS OF PEARL, INCOME TAX COLONY, NEAR DURGAPURA BUS STAND, JAIPUR -302018, RAJASTHAN, INDIA
415 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
416 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
417 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
418 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
419 ARPAN WELFARE SOCIETY Z 2 CHOICE HOUSE NEAR HDFC BANK ZONE 1 MP NAGAR BHOPAL
420 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
421 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
422 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
423 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
424 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
425 ARSH INSTITUTE OF INFORMATION TECHNOLOGY AND RESEARCH LLP NEAR POST OFFICE VPO THUNAG
426 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
427 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
428 ARTECH INFOSYSTEMS PRIVATE LIMITED INFOSPACE, B-2, TOWER 2, GROUND FLOOR, SECTOR 62, NOIDA
429 ARTEM INSTITUTE OF LOGISTICS AND TRANSPORTS PVT LTD NEW NO.36 OLD NO.73 WEST MADA CHURCH STREET, ROYAPAURAM CHENNAI
430 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
431 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
432 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
433 ARUINODAYA SHIKSHAN SAMIT 121 GEETANJLI SOCIETY SECTOR 3 RAIPUR
434 ARUNACHAL UNIVERSITY OF STUDIES NH-52, NAMSAI DISTRICT NAMSAI
435 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
436 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
437 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
438 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
439 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
440 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
441 ARUNODAYA TRUST H.NO: 1-4-7, RODA NO 2, EX SERVICEMAN COLONY, BALAJI NAGAR, JAWHAR NAGAR GRAM PANCHAYAT, SHAMIRPET MANDAL, RANGAREDDY DISTRICT. PIN: 500087
442 ARUN SURYA SHIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA H.NO 13, GEETANJALI PARK, NEAR MAHARISHI VIDYA MANDIR SCHOOL,MANGLA, BILASPUR (C. G)
443 ARUN SURYA SIKSHAN PRASHIKSHAN AVAM SEVA SANSTHA OM NAGAR, JARHA BHATA , BILASPUR C.G
444 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
445 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
446 ARYAN FOUNDATION VPO KHERI BARKI, TEH BARWALA, DISTT HISAR (HRY)
447 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
448 ASCENT ACADEMY OF TRAINING AND DEVELOPMENT PRIVATE LIMITED PLOT NO. 4, GROUND FLOOR, LANE NO. 2, WEST END MARG, SAIDULLAJAB, NEAR SAKET METRO STATION PARKING, NEW DELHI – 110030, INDIA
449 ASD EDUCATIONAL CHARITABLE TRUST NO 2/141 GANAPATHY COMPLEX,BAZAAR ROAD,KANCHIPURAM,TAMILNADU
450 ASD EDUCATIONALCHARITABLE TRUST 2/141,BAZAAR ROAD
451 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
452 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
453 ASFSDA ASDF
454 ASHA HO. NO. 11 RADHAPURAM COLONY KANCHANPUR MATIYARI CHINHAT LUCKNOW
455 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
456 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
457 ASHASECURITYGUARDSERVICES L-2/482, VINEET KHAND, GOMTI NAGAR, LUCKNOW
458 ASHA SKILL DEVLOPMENT FOUNDATION WARD NO 28, FIRST FLORE KESAR PLAZA COMPLEX HANUMAN CHAUK BALAGHAT
459 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
460 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A- 243 LAL BAGH AZAD PUR DELHI
461 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A-243, LAL BAGH AZAD PUR DELHI - 110033
462 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
463 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
464 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
465 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
466 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
467 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
468 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
469 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
470 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
471 ASHTA UTKARSH SEVA SANSTHAN SAMITI 445, WARD NO 16, SEMNARI ROAD ASHTA
472 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
473 ASHVI DUCATION ACADEMY SANSTHAN KEKRI SAINI COTTAGE KALAYAN COLONY,AJMER ROAD , KEJRI
474 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
475 ASIA GROUP MAHILA MANDAL AZAD CHOWK N-6 CIDCO AURANGABAD-431003. MAHARASHTRA
476 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
477 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
478 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
479 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
480 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
481 ASIAN INFOTECH EDUCATIONAL DEVELOPMENT SOCIETY ASIAN INFOTECH ZOOROAD TINIALI APURBA SINHA PATH BY LANE-05
482 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
483 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
484 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
485 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
486 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
487 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338 , 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJSTHAN
488 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN, 338 3RD STREET , NEAR CHETNA SCHOOL , BIHARI GANJ, AJMER RAJASTHAN
489 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN 338, 3RD STREET , BIHARI GANJ NEAR CHETNA SCHOOL AJMER RAJASTHAN PIN 305001
490 ASPIRANT EDUCATION SANSTHAN ASPIRANT EDUCATION SANSTHAN,, 3RD STREET , BIHARI GANJ , NEAR CHETNA SCHOOL , AJMER , RAJASTHAN , PIN - 305001
491 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
492 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
493 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
494 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
495 ASSET HOMES PRIVATE LIMITED G-129,28/34A,PANAMPILLY NAGAR, KOCHI - 682036 , KERALA
496 ASSIST G. T. ROAD CHILAKALURIPET GUNTUR DISTRICT ANDHRA PRADESH
497 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
498 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
499 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
500 ASSOCIATION FOR PEOPLES ADVANCEMENT AND ACTION RESEARCH 7/12,RAMA ASHRAM TAKNA ROAD
501 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
502 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
503 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
504 ASTHA SEWA SAMITI SECTOR-J, 347-A, AASHIANA, LUCKNOW, UTTAR PRADESH
505 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
506 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
507 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
508 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
509 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
510 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
511 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
512 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
513 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
514 ATHMA DIVINE TRUST NO 80-A KONDASAMY ROAD RAMNAGAR COIMBATORE
515 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
516 ATMIY MANAGEMENT LLP AT GADHADA MOHANNAGAR SOCIETY OPP NEW BUS STATION DIST BOTAD
517 ATMIY MANAGEMENT LLP AT,GADHADA MOHANNAGAR SOCIETY OPP.NEW BUSSTATION DIST.BOTAD TALUKO - GADHADA
518 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
519 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
520 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
521 AURA EDUCATIONAL SOCIETY 60-9-10/4, PINNAMANENI PPLY CLONIC STREET, 7 TH LANE SIDHARTHA NAGAR, VIJAYAWADA
522 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
523 AUTOLITE INDIA LIMITED D 469 ROAD NO 9 A V K I AREA RAJASTHAN JAIPUR
524 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
525 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
526 AVJ INFOTECH PVT LTD AMIYO NIKETAN NAITY ROAD,BAGAN PARA,2ND FLOOR,P.O-NABAGRAM, PIN: 712246
527 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
528 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
529 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
530 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
531 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
532 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY
533 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
534 AVTAR WELFARE SOCIETY 538/5-C BANKER COLONY, JHANSI
535 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, JHANSI UP 284001
536 AVTAR WELFARE SOCIETY 538/5-C, BANKERS COLONY, BEHIND KISAN BAZAR, JHANSI
537 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
538 AWADH SEWA SANSTHAN 11/834 INDIRA NAGAR LUCKNOW
539 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
540 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
541 AWARE HEALTH AND RESEARCH FOUNDATION AWARE HEALTH & RESEARCH FOUNDATION 5-9-24/78, PRAGATHI BHAVAN, ADARSH NAGAR LAKE HILL ROAD, HYDERABAD
542 AYURSUNDRA HEALTH CARE PVT LTD HOUSE NO 15 SHANTI PUR MAIN ROAD GUWHATI
543 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
544 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
545 BABA BAHAL DASS EDUCATION AND VOCATIONAL TRAINING SOCIETY VILLAGE KOREWALA TEHSIL SARDULGARH JHUNIR DIST MANSA
546 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
547 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
548 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN
549 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOTISEKHAN
550 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARAMKOT ROAD KOT-ISE-KHAN
551 BABA ISHER SINGH EDUCATIONAL SOCIETY DHARMKOT ROAD KOT-ISE-KHAN DISTT MOGA PUNJAB
552 BABA JAKJDAS JHAKJB KNKDCKDN KJBSKBDSKN BSKBDKCB
553 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
554 BABA SAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE , PLOT NO 59/471 , P.S - SECTOR 12. BOKARO (JHARKHAND)
555 BABASAHAB WELFARE SOCIETY MANMOHAN CO-OPERATIVE 59/471. PO + PS SECTOR 12. BOKARO
556 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
557 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
558 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
559 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
560 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
561 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
562 BAGARIA EDUCATION TRUST 110, ARVIND NAGAR, JAGATPURA, JAIPUR
563 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
564 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
565 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
566 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
567 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA MOR NEW DELHI
568 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
569 BAJRANGBALI SHAIKSHNIK EVAM SAMAJIK SEVA SANSTHAN POSTAL PARK NAVRATAN PUR MANDIR,P.O-GPO.P.S.-KANKARBAGH
570 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
571 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
572 BALAGH EDUCATION AND WELFARE SOCIETY 3RD FLOOR KHALID APARTMENT BADI OMTI JABALPUR M.P.
573 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
574 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
575 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
576 BALA JI WELFARE SOCIETY KANMAN, BAHRI, BAREILLY
577 BALAJ TRUST CO LTD DGHDGGHDGDGGD
578 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
579 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
580 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
581 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
582 BALIRAJA BAHUUDESHIYE SEWABHAWI SANSTHA BEED AT PADMAVATI GALLI PARLI V TQ PARLI V DIST BEED 431122
583 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
584 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
585 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
586 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
587 BAL VIKAS UTTHAN SAMITI I.T EDUCATION (BAL VIKAS UTTHAN SAMITI) NEAR O.B.C BANK AMBEHTA CHAND SAHARANPUR UTTAR PRADESH
588 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
589 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
590 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
591 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
592 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
593 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
594 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
595 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
596 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
597 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
598 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
599 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
600 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
601 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
602 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
603 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
604 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
605 BASANTI DASH EDUCATIONAL TRUST BASANTI DASH EDUCATIONAL TRUST, A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
606 BASANTI DASH EDUCATIONAL TRUST HEAD OFFICE, HIG/A-14, BARAMUNDA HOUSING BOARD COLONY, BHUBANESWAR
607 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
608 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
609 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
610 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
611 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
612 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
613 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
614 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
615 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
616 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
617 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
618 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
619 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80,SITE V,UDYOG KUNJ, PANKI,KANPUR-208022
620 BEEKAYPRECISIONINDIAPRIVATELIMITED D-80, SITE-5, UDYOG KUNJ, PANKI, KANPUR-208022,PH. NO.0512-2212083
621 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
622 BELA ROZGAR AND HEALTH CONSCIONS COMPANY IST FLOOR, SANT PLAZA, ABOVE CORPORATION BANK SHRIKANT VERMA MARG, NEAR RAMA MAGNETO MALL, BILASPUR, CHHATTISGARH
623 BENO SUPPORT TECHENOLOGIES PVT LTD 706, PLOT NO.7, ROOTS TOWER, DISTRICT CENTRE, LAMINAGAR, NEW DELHI, DELHI-110092
624 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
625 BENTOGREEN SKILL PRIVATE LIMITED 50 L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA.
626 BERHAMPORE NETAJI VIVEKANANDA ADARSHA SEVA SAMITY 74/1, ABDUS SAMAD ROAD, GORABAZAR, P.O. BERHAMPORE, DIST. MURSHIDABAD
627 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
628 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
629 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
630 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
631 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
632 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
633 BFHJFF BDHD
634 BG SOFTWARE SOLUTIONS 6514A 2ND FLOOR KALYANI COMPLEX BUDIKERE ROAD KANAKAPURA
635 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
636 BHAGIRATHI TRANS CORPO PVT LTD # 2, ESSPEE TOWER, RAJENDRA NAGAR, DATTAPADA ROAD, BORIVALI (EAST)
637 BHAGIRATHI TRANSCORPO PVT LTD UNIT.2 , ESSPEE TOWER , RAJENDRA NAGAR , DATTAPADA ROAD , BORIVALI (E)
638 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
639 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
640 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
641 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
642 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
643 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
644 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
645 BHANSALI TRUST BHANSALI TRUST RADHANPUR HIGHWAY CROSS ROAD NEAR GAYATRI TEMPLE AT PO RADHANPUR
646 BHANSALI TRUST BHANSALI TRUST AND HOSPITAL, HIGHWAY CROSS ROAD, NEAR GAYATRI TEMPLE
647 BHANSALI TRUST BHANSALI TRUST, HIGHWAY CROSS ROAD, TO.RADHANPUR, DIST.PATAN
648 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
649 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
650 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
651 BHARAT COMPUTER SYSTEMS A UNIT OF SAHITHYA SOCIAL WELFARE FUND #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP TO SBOA CBSE SCHOOL, ANNA NAGAR, CHENNAI, 600101
652 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST 395, SCHOOL ROAD, ANNA NAGAR EXT, OPP SBOA CBSE SCHOOL, CHENNAI
653 BHARAT COMPUTER SYSTEMS UNIT OF SAHITHYA SOCIAL WELFARE TRUST #395, SCHOOL ROAD, ANNA NAGAR WEST EXT, OPP SBOA CBSE SCHOOL, CHENNAI
654 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
655 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
656 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
657 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
658 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
659 BHARATH FOUNDATION 9-10-232/1 FIRST FLOOR ABOVE CANARA BANK CHITTA ROAD
660 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
661 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
662 BHARATHIYA SEVA SAMSTHE NO.363, 7TH MAIN, BHUVANESHWARI NAGAR, T DASARAHALLI, BANGALORE
663 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
664 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
665 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
666 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
667 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
668 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
669 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
670 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
671 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
672 BHARAT SHAKTI SANGHTHAN 39B/1A, JONDHWAL, TELIYARGANJ, ALLAHABAD
673 BHARAT VEERANGNA AWANTIBAI EDUCATIONAL SANTHAN D-16 SECTOR-9 VIJAY NAGAR GHAZIABAD
674 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
675 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
676 BHARTIYA EDUCATIONAL CHARITABLE TRUST 56 SETH KUMHARTOLI DORANDA
677 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
678 BHARTIYA PRODHUGIKI EVAM UDHYAMI VIKAS SANSTHAN IICR CAMPUS NEAR MANGLA TRADARS SHAKTI CHOWK BIJNOR UP PIN CODE 246701 MOB NO 9412118240 PHONE AND FAX NO 01342-265992
679 BHARTIYA SAMAJIK BAHUUDESHIYA VIKAS SANSTHA C/O. MANGAL KAWDU TELANG,VIKAS NAGAR, NEAR TAKSHAKISHLIYA BUDDHA VIHAR, BABUPETH CHANDRAPUR.
680 BHARTIYA SAMRUDDHI INVESTMENTS AND CONSULTING SERVICES LIMITED 3RD FLOOR, SURBHI ARCADE, BANK STREET, TROOP BAZAR, KOTI, HYDERABAD
681 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
682 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
683 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
684 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
685 BHAWANI MARKETING PRIVATE LIMITED SHIMA PLAZA,3RD FLOOR,BLOCK D, ULUBARI CHARIALI, GUWAHATI
686 BHELSA JAN KALYAN SAMITI PITAL MILL SQUARE, SAGAR ROAD VIDISHA(M.P.)
687 BHELSA JAN KALYAN SAMITI HOUSE NO-22, CHANDRA SHEKHAR ROAD PITTAL MILL VIDISHA (M.P)
688 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
689 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
690 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
691 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
692 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NAYA RAIPUR
693 BHILAI INSTITUTE OF TECHNOLOGY TRUST C/O. BHILAI INSTITUTE OF TECHNOLOGY, NEAR: KENDRI RAILWAY STATION, ABHANPUR ROAD, NEW RAIPUR
694 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
695 BHOJPUR GRAMIN VIKAS PARISHAD AT- SINGH COLONY, JAGDEV NAGAR, NEAR BAZAR SAMITI, PO: ARA, PS: ARA NAWADA, DISTT: BHOJPUR (BIHAR)
696 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
697 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
698 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
699 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
700 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
701 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
702 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
703 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
704 BHRASHTACHAR VIRODHI SANGTHAN NEW CHARTHAWAL BUS STAND, TOWN- THANA BHAWAN, DISTT-SHAMLI, UTTAR PRADESH
705 BHUPINDRA SOCIETY REGISTERED OFFICE : SCF-34, DUKHNIWARAN SAHIB GURUDWARA MARKET, PATIALA, PUNJAB- 147001 CORPORATE OFFICE : SCO-19, 2ND FLOOR, SECTOR 26, MADHYA MARG, CHANDIGARH , 160019
706 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
707 BILASPUR FULE STATION VILLAGE-PARSADA DISTRICT-BILASPUR RAIPUR ROAD BILASPUR
708 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
709 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
710 BINA SOFT EDUCATIONAL AND WELFARE SOCIETY VILL & POST "BILRIAGANJ" DISTRICT "AZAMGARH" STA TE "UTTAR PRADESH"
711 BIOGENE SEED SCIENCES PRIVATE LIMITED BIOGENE SEED SCIENCES PRIVATE LIMITED 1-5-12/2/2, NEW MARUTHINAGAR, KOTHAPET HYDERABAD
712 BIOGENE SEED SCIENCES PVT LTD PLOT NO 28 TO 31, FLAT NO 501, 5TH FLOOR MYTRI SRI VISHNU APPTS, YADAV NAGAR, ALKAPURI HYDERABAD
713 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD DIST. KHARGONE M.P. INDIA MOB. NO. 8717828884
714 BIORE ASSOCIATION BIORE ASSOCIATION 5TH K.M. MILE STONE MANDLESHWER ROAD KASRAWAD M.P. INDIA 451228, DIST KHARGONE, MOB. 8717828884, 9993596700
715 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
716 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
717 BIRLA COTSYN INDIA LIMITED DALAMAL HOUSE 1ST. FLOOR NARIMAN POINT MUMBAI (MAHARASHTRA)
718 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4 MIDC INDUSTRIAL AREA WALUJ DIST AURANGABAD (MAHARASHTRA)
719 BIRLA PRECISION TECHNOLOGIES LIMITED B-15/4, M.I.D.C, INDUSTRIAL AREA, WALUJ, AURANGABAD, MAHARASHTRA
720 BISMI EDUCATIONAL TRUST NO1 2ND AND 3RD FLOOR AMUTHA COMPLEX NEW SANKARANPALAYAM ROAD TOLGATE VELLORE
721 BISWAAS BAHARANA.NIALI,CUTTACK
722 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
723 BIYANI SHIKSHAN SAMITI BIYANI SHIKSHAN SAMITI, R-4, SECTOR 3, VIDYADHAR NAGAR, JAIPUR
724 BIYANI SHIKSHAN SAMITI SECTOR. NO 3, VIDHYADHAR NAGAR, JAIPUR, RAJASTHAN
725 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
726 BLACKSMITH PROJECTS PRIVATE LIMITED JAGAT COMPLEX,PLOT NO. 354, 100 FEET ROAD, GHITORNI, NEW DELHI 110030
727 BLESSING AND HOPE MISSION HARINARAYANPUR, VIDYASAGARPALLY, SRIDHAR GHOSH ROAD, BURDWAN WEST BENGAL-713101
728 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
729 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
730 BLUEBLOOD VENTURES LIMITED ROOM NO. 101, P-27, MALVIYA NAGAR, NEW DELHI
731 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED #18, SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR, BANGALORE 560043
732 BLUECHIP SERVICES INTERNATIONAL PRIVATE LIMITED NO.18 SBM BUILDING, 7TH MAIN 80 FEET ROAD, HRBR LAYOUT, KALYAN NAGAR BANGALORE - 560043
733 BLUESHIFT IMPEX PRIVATE LIMITED J 5/7, LOWER GROUND FLOOR, J BLOCK, DLF CITY, PHASE - 2, GURGAON, HARYANA-122001
734 BLUORCHID INTERNATIONAL SERVICES PRIVATE LIMITED U-131,F/F UPADHAYAY BLOCK SHAKARPUR, NEAR LAXMI NAGAR METRO STATION.DELHI
735 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
736 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
737 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
738 BOPARAIS MARTIAL SECURITY PVT LTD 101-102. BHARAT INDUTRIAL ESTATE LAL BAHAHDUR SHASTRI MARG BHANDUP-WEST MUMBAI
739 BORAL NUTANHAT YOUTH COMPUTER TRAINING CENTRE C/6 RAJNARAYAN PARK,RANGKAL MORE, BORAL MAIN ROAD , P.O. BORAL,P.S. SONARPUR ,PIN -700154 REGISTERED OFFICE 58/3 MADHYAPARA , ROYNAGAR, P.O.& P.S. BANSDRONI,KOLKATA-700070
740 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA 403601
741 BORKAR COLORPACKS PRIVATE LIMITED ALANKAR BUILDING,MARTIRES DIAS ROAD,MALBHAT,MARGAO,GOA-403601
742 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR, ASHRAM SOUTH DELHI
743 BPS MEMORIAL TRUST 262, FIRST FLOOR HARI NAGAR ASHRAM SOUTH DELHI
744 BPS SHIKSHAN SANSTHAN ION DIGITAL ZONE,BHARTIYA INSTITUTE OF ENGG. &TECH.JAIPUR-BIKANER BYPASS,NEAR SANWALI CIRCLE. POST OFFICE-BAJAJ GRAM.TEH.&DISTT.-SIKAR(RAJASTHAN)-332001
745 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR CONTACT DETAIL- 09827724467
746 BRAIN STORMER TRAINING DEVELOPMENT AND SOCIAL WELFARE SOCIETY 1ST FLOOR, MITRAVATSALA BUILDING, RAMTEKRI CORNER, MANDSAUR
747 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
748 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
749 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED PLOT NO. 16, LANE NO.4, SAIDULAJAB EXT., OPP. ANUPAM GARDEN, SAKET, NEW DELHI, SOUTH DELHI, DELHI, INDIA, 110030
750 BRICK AND BRAIN SKILL INDIA PRIVATE LIMITED D-17,THACKER INDUSTRIAL ESTATE,N.M JOSHI MARG,CHINCHPOKALI MUMBAI - 400011
751 BRICK AND BYTE INNOVATIVE PRODUCTS PRIVATE LIMITED R-102, TTC INDUSTRIAL AREA, MIDC RABALE, NAVI MUMBAI 400701
752 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
753 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
754 BRIGHT FUTURE ACADEMY SHYAM JI MARG ,KETKA ROAD SURAJPUR(CG)
755 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
756 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
757 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
758 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
759 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
760 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
761 BRIGHT FUTURE SOCIETY M.G. ROAD, HAPOLI, P.O. BOX NO. 44, POST OFFICE - ZIRO, LOWER SUBANSIRI DISTRICT
762 BRIGHT STAR MUSLIM ASSOCIATION 42, INDIRA NAGAR, B.N.P. ROAD, DEWAS
763 BRIHASPATHI TECHNOLOGIES PRIVATE LIMITED #7-1-621/259, V FLOOR, SAHITHI ARCADE, BESIDE S R NAGAR POLICE STATION, S R NAGAR, HYDERABAD
764 BRIJESH MEMORIAL SHIKSHA AVAM SAMAJ SEVA SAMITI 11 E/18 DABOULI - KANPUR NAGAR
765 BRIJ KISHORE JAGRITI SEWA SAMITI VILL AND POST BARGAWAN, TEHSIL MISHRIKH DISTRICT SITAPUR, UTTAR PRADESH
766 BRIJ KISHOR JAGRITI SEWA SAMITI VILL&PO.BARGAWAN DIST.SITAPUR PIN CODE.261151 BLOCK .PISAWAN TAHSIL.MAHOLI
767 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
768 BRIJ VIKAS SHIKSHA SAMITI MATHURA, GOBARDHAN MARG, ADING, DIST MATHURA, UTTAR PRADESH
769 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
770 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
771 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
772 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
773 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
774 BROADLINE COMPUTER SYSTEMS NO. 7, 2ND FLOOR, KHADER NAWAZ KHAN ROAD, NUNGAMBAKKAM CHENNAI
775 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
776 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
777 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
778 BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA ANAND CHIKITSALAY ROAD BHAGALPUR
779 BRSM SOFTWARE INDIA PRIVATE LTD BRSM SOFTWARE INDIA PRIVATE LTD C/O HARILAL PANJIYARA,ANAND CHIKITSALAY ROAD BHAGALPUR
780 BRSM SOFTWARE INDIA PVT LTD BRSM SOFTWARE INDIA PVT LTD ANAND CHIKITSALAY ROAD,NEAR ADARSH MARWARI LANE BHAGALPUR
781 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
782 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
783 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
784 BUDH RAM RAY SAMAJ SEWA SANSTHAN JAHARI PAKARI KEWARI KALA PO PAKRI MAHMMED AMNAUR
785 BUILDER DEVELOPERS 310- N.P. CENTER DAK BUNGLOW ROAD PATNA
786 BUILDYOURSELF SEWA SANSTHA 546/718 SARFARAJGANJ LUCKNOW
787 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
788 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
789 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
790 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
791 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
792 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
793 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
794 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
795 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA DIST HATHRAS
796 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
797 BWN COMPUTER EDUCATION VILLAGE PADU POST KOTA
798 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
799 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
800 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
801 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
802 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
803 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
804 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
805 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
806 CALLHEALTH SERVICES PRIVATE LIMITED 1-66/1/RI/08/8, 10TH & 11TH FLOOR, RAMKY GRANDIOSE, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD - 500032, TELANGANA
807 CAMBRIDGE PUBLIC EDUCATIONAL AND WELFARE TRUST VILL SAIDPUR PO SORMAR BAGHALA PS MORO DISTT DARBHANGA
808 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA; DISTRICT CENTRE, JASOLA, NEW DELHI-110025
809 CAMBRIDGE UNIVERSITY PRESS INDIA PRIVATE LIMITED 314 TO 321, 3RD FLOOR, PLOT NO 3, SPLENDOR FORUM, JASOLA DISTRICT CENTRE, JASOLA, NEW DELHI-110025
810 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
811 CAPELLA MARITIME CAREER INSTITUTE PRIVATE LIMITED 45, RAINA MARKET, NAWABGANJ
812 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
813 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
814 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
815 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
816 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
817 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
818 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
819 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
820 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY SANJAY NAGAR WARD NO.14 KURUD
821 CAREER CARE COMPUTER EDUCATION AND WELFARE SOCIETY VINOD KUMAR SACHDEV ,SANJAY NAGAR KURUD, WARD 14, MAIN ROAD KURUD , DIST. DHAMTARI, CHHATISGARH 493663
822 CAREER DEVELOPMENT OPPORTUNITY AND TRAINING C DOT NO 7 ,ST MARYS BUILDING ,R.S.L GOLDEN APARTMENT ROAD (NEAR SELVARAJ TEXTILES) VILLANGUDI,MADURAI
823 CAREER EDUCATION AND TECHNICAL SOCIETY OPP. ITI,RANIA ROAD,SIRSA-125055,HARYANA
824 CAREER EDUCOM ACADEMY 70, JALVIHAR COLONY, RAIPUR, CG, 492001
825 CAREER EDUCOM ACADEMY 70, JALVIAHAR COLONY, RAIPUR
826 CAREER PARK TRUST 3RD FLOOR, ENCO COMPLEX, KARAN NAGAR, SRINAGAR, KASHMIR J&K.
827 CAREER PARK TRUST 3RD FLOOR ENCO COMPLEX, KARAN NAGAR SRINAGAR KASHMIR
828 CAREER PLUS EDUCATIONAL SOCIETY H.O301/A37, 38, 39 IIIRD FLOOR ANSAL BUILDING, COMM.COMPLEX DR. MUKHERJEE NAGAR DELHI 110009 REGD.OFFF3/ 8 SEC11 ROHINI DELHI110085
829 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
830 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
831 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR, CHHATTISGARH
832 CAREER ZONE EDUCATIONAL SOCIETY SAI DHAM PARISAR, TORWA PULL ROAD, TORWA, BILASPUR CHHATTISGARH
833 CARE HUMANITY DELHI PARAMEDICAL & PROFESSIONAL ACADEMY PATHRAHITOLA JHANJHARPUR(RS)
834 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
835 CARE WORLD BAGHI MEHTAB NEAR BYPASS BRIDGE
836 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
837 CASA GRANDE PROP CARE PRIVATE LIMITED 40/129A, SHIVANI TOWERS, 2ND FLOOR, ECR, THIRUVANMIYUR, CHENNAI
838 CASA GRANDE PROP CARE PVT LTD NO 40/129A, SHIVANI TOWERS, 2ND FLOOR,ECR, THIRUVANMIYUR, CHENNAI
839 CATCH 24 COMMUNICATION CATCH 24 COMMUNICATION , CUG-1, 1ST FLOOR, JUMBO HOUSE , 15.DR. JHA MARG , OKHLA PHASE-3 DELHI
840 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
841 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
842 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
843 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
844 CDHU EEHDG
845 CDROME EDUCATION SOCIETY 101, PANSI HOUSE, NEAR PRAYAG SOCIETY BUILDING NO-4, LOK DHARA PHASE - 1, KALYAN (EAST)
846 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMMEDI HOUSE MOHAMMED ALI ROAD MOHARASHTRA MUMBAI
847 CEASEFIRE EXTINGUISHERS AND SYSTEMS INDIA PRIVATE LIMITED 79, MOHAMADI HOUSE, MOHAMADALI ROAD, P.O. BOX, 13097, MASJID BUNDER (WEST), MUMBAI
848 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
849 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
850 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
851 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
852 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
853 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
854 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
855 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
856 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
857 CENTER FOR COMMUNITY SOLIDARITY TRUST NO 27 BAZAAR STREET AMIRTHAPURAM TIRUTTANI
858 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
859 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD.OFFICE - VILL:HAIDADPUR, P.O:KHANTURA, P.S.:HABRA,DIST:NORTH 24 PARGANAS,PIN:743273 H.O.:MUNICIPAL SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO:3,4 & 5 , P.O:GOBARDANGA
860 CENTRAL BOARD OF COMPUTER AND TECHNICAL EDUCATION REGD. OFFICE-VILL:HAIDADPUR(NEAR BISWASREE CLUB),P.O.:KHANTURA,P.S.:HABRA,GOBARDANGA,DIST:24PGS(N),PIN:743273 H.O.-GOBARDANGA,MUNICIPALITY SUPER MARKET,SBI BUILDING,GROUND FLOOR,ROOM NO. 3 , 4 & 5
861 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR KOZHIKODE
862 CENTRAL EDUCATIONAL AND CHARITABLE TRUST CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI, THALAKKULATHUR POST KOZHIKODE
863 CENTRAL EDUCATIONAL AND CHARITABLE TRUST PURAKKATTIRI POST THALAKKULATHUR
864 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
865 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
866 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
867 CENTRAL FOOTWEAR TRAINING INSTITUTE CFTI AGRA C-41 & 42, SITE-C, INDUSTRIAL AREA, SIKANDRA, AGRA
868 CENTRAL INSTITUTE OF DESIGN CENTRAL INSTITUTE OF TOOL DESIGN (A GOVERNMENT OF INDIA SOCIETY MINISTRY OF MSME) BALANAGAR, HYDERABAD
869 CENTRAL INSTITUTE OF TOOL DESIGN CENTRAL INSTITUTE OF TOOL DESIGN, NARASPUR CROSS ROADS, BALANAGAR, HYDERABAD
870 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
871 CENTRAL PEST CONTROL 25, SAIKRUPA, CENTRAL EXCISE COLONY, CHHATRAPATI SQUARE, NAGPUR
872 CENTRAL TOOL ROOM AND TRAINING CENTRE KOLKATA CENTRAL TOOL ROOM AND TRAINING CENTRE (CTTC) BONHOOGHLY INDUSTRIAL AREA KOLKATA-700108, WEST BENGAL
873 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
874 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
875 CENTRE FOR COMMUNITY SERVICE AND ALTRUISM NO.14,NEW STREET MANALIESTATE, PUDUPALAYAM MAIN ROAD, CUDDALORE.
876 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
877 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
878 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
879 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
880 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
881 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1,INDUSTRIAL AREA, P.O:MUIDDINPUR,JALESHER ROAD FIROZABAD
882 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A1/1, INDUSTRIAL AREA, P.O-MUIDDINPUR JALESHER ROAD FIROZABAD
883 CENTRE FOR THE DEVELOPMENT OF GLASS INDUSTRY A-1/1 INDUSTRIAL AREA P.O - MUIDDINPUR JALESHAR ROAD FIROZABAD
884 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A CHANDIGARH
885 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH C PYTE PUNJAB YUVA BHAWAN, SECTOR 42-A
886 CENTRE FOR TRAINING AND EMPLOYMENT OF PUNJAB YOUTH SAS NAGAR PUNJAB YUVA BHAWAN SECTOR 42A
887 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
888 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
889 CENTRE OF EDUCATION AND DISTANCE LEARNING SAHARA HOSPITAL BASEMENT, NEAR OBC BANK PATAUDI CHOWK, BASAI ROAD,GURUGRAM
890 CENTUM FOUNDATION 127, NEELAGAGAN, MANDI ROAD, SULTANPUR, MEHRAULI, NEW DELHI – 110030
891 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
892 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
893 CHANAKYA ACADEMY RING ROAD NO 1, NEAR SARONA BRIDGE, TATIBUND, RAIPUR CG
894 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
895 CHANDRA PAL ARYA ADARSH SHIKSHA SANSTHAN BAHJOI,DISTRICT SAMBHAL(U.P)
896 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
897 CHANDRAWATI DEVI SEVA SANSTHAN SAREYA WARD NO.1 NEAR SARASWATI TALKIJ GOPALGANJ
898 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
899 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
900 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
901 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
902 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
903 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
904 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
905 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
906 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
907 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
908 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
909 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
910 CHATAK SECURITY AND LABOUR SERVICES IPC PVT LTD 1306/6 GOYAT PANA MEHAM
911 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
912 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
913 CH CHARAN SINGH MEDICAL SHIKSHAN PRASHIKSHAN SANSTHAN 1N-3 MIA, ALWAR
914 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
915 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
916 CHERRYPICK INDIA CONSULTING AND BUISINESS SOLUTIONS PRIVATE LTD 2ND FLOOR, CARMEL TOWER, COTTON HILL, VAZHUTHACAUD
917 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY DARGA ROAD BIJAPUR
918 CHETANA EDUCATION SOCIETY CHETANA EDUCATION SOCIETY MANAS RESIDENCY, DARGA ROAD BIJAPUR
919 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
920 CHETNA ALLAHABAD ROAD KARWI
921 CHETNA ALLAHABAD ROAD, KARWI
922 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
923 CHHATTISGARH TECHNOLOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FORNT OF GOVERNMENT HOSPITAL MAIN ROAD DONDILOHARA
924 CHHATTISGRAH TECHNALOGY AND EDUCATION WELFARE INSTITUTE CHHATTISGARH COMPUTER INSTITUTE IN FRONT OF GOVERNMENT HOSPITAL MANI ROAD DONDILOHRA
925 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTISGARH CHANDRANAHU SIKHAN SAMITI ,NEAR BY SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
926 CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI CHHATTSGARH CHANDRANAHU SHIKSHAN SAMITI BAGBAHARA ROAD SHANTRI BAI COLLEGE MAHASAMUND CHHATTISGARH
927 CHHAYA EDUCATIONAL TRUST 2/144/2,RAWLI, AGRA , UTTAR PRADESH
928 CHHAYA EDUCATIONAL TRUST 2/144/2, RAWLI, AGRA, UTTAR PRADESH
929 CH HDS EDUCATIONAL AND WELFARE SOCIETY 1ST FLOOR DHAMIJA COMPLEX, NEAR SHAMBHU SWEET HOUSE, LOHA BAZAR MALOUT, DISTT. MUKTSAR(PUNJAB)
930 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
931 CHHOTANAGPUR VIKAS MANCH CHHOTANAGPUR VIKAS MANCH, NEAR ST. KIRAN BALIKA SCHOOL, RANCHI-PATNA ROAD, HAZARIBAG
932 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
933 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
934 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
935 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
936 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
937 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
938 CHILD AND WOMEN FOUNDATION J. LIANZUALA BUILDING, KAWN VENG, MAUBAWK
939 CHILD AND YOUTH WELFARE SOCIETY PLOT. NO 293, DALLUPURA VASUNDHARA ENCLAVE, DELHI
940 CHILD AND YOUTH WELFAR SOCIETY PLOT. NO. 293, DALLUPURA VASUNDHARA ENCLAVE DELHI
941 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
942 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 DABUA COLONY OPP A D SR SEC SCHOOL NIT FARIDABAD
943 CHILD WELFARE AND EDUCATIONAL SOCIETY B-502 OPP A D SR SEC SCHOOL NIT FARIDABAD DABUA COLONY
944 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
945 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
946 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
947 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
948 CHIVALRY POVERTY ALLEVIATION DEVELOPMENT ASSOCIATION VILLAGE KALINAMAI, POST OFFICE MAO DISTRICT SENAPATI STATE MANIPUR
949 CHORD CHILDWELFARE HOLISTIC ORGANIZATION FOR RURAL DEVELOPMENT PLOT.NO: 496, FLAT.NO: 106, NAGASURI ENCLAVE, GOKUL PLOTS, OPP. BLOOMING DALES SCHOOL, NEAR KPHB 9TH PHASE, KUKATPALLY, HYDERABAD, INDIA – 500072
950 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
951 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION SOCIETY 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
952 CHOUDHARI ATTARSINGH YADAV MEMORIAL EDUCATION TRUST 1ST FLOOR, PRIDE PLAZA, BEHIND DR. AMBEDKAR STATU, PIMPARI, PUNE-411018
953 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
954 CHOUHAN HOUSING PRIVATE LIMITED CHOUHAN RESIDENCY, RAJEEV NAGAR, MUKTIDHAM ROAD, AZAD CHOWK, SUPELA, BHILAI-490023, CHHATTISGARH
955 CHOUHAN INFRA 301,SAHYADRI TOWER,18/A,SAPTGIRI NAGAR,NARENDRA NAGAR
956 CH RAJPAL SINGH MEMORIAL SANSTHA 400/3, SHASTRI NAGAR, MEERUT
957 CHRIST EDUCATION AND WELFARE SOCIETY 606,A WING, 6TH FLOOR, VERTEX VIKAS BUILDING,NEAR ANDHERI METRO STATION, ANDHERI EAST, MUMBAI , MAHARASHTRA
958 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
959 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
960 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
961 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
962 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
963 CITY MAKERS PRIVATE LIMITED CITY MAKERS PVT.LTD G-1,VASUDEO CITY,OPP-RAJHANSH GUEST HOUSE, BENIBABU BAGICHA, RAJENDRA PATH,PATNA.
964 CKAKPARAN KANTAKHALI CHOKHER AALO WELFARE SOCIETY VILL : MOHANPUR, PO : SOUTH MOHANPUR, PS : MAGRAHAT, SUB-DIST : MAGRAHAT - II, DIST : SOUTH 24 PARGANAS, STATE : WEST BENGAL, PIN : 743610
965 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
966 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
967 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
968 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
969 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
970 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
971 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
972 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
973 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
974 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
975 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
976 CMCORPS INTEGRATED SERVICES PVT LTD 306, 3RD FLOOR, E-BLOCK, INTERNATIONAL TRADE TOWER, NEHRU PLACE, NEW DELHI
977 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
978 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS,BEHIND NAVNEET PUBLICATIONS,GURUKUL ROAD,MEMNAGAR
979 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
980 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
981 COLLEGE TULLU ROAD KANISI DISTRICT GANJAM BEHRAMPUR OM BHURBHUVAH SVAH COLLEGE, TULLU ROAD, KANISI DISTRICT GANJAM BEHRAMPUR, 761008
982 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY, BEHIND PT. RAVI SHANKAR UNIVERSITY, DUMAR TALAB, MOHBA BAZAR, RAIPUR
983 COMBINED ACADEMY OF TECHNICAL EDUCATION ROYAL COLLEGE OF PHARMACY BEHIND PT. R. S. UNIVERSITY CAMPUS, DUMAR TALAB (MAHOBA BAZAR), RAIPUR (C.G.)
984 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
985 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
986 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
987 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
988 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
989 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
990 COMMERCIAL SYN BAGS LIMITED COMMERCIAL HOUSE, 3-4, JAORA COMPOUND, M.Y.H. ROAD, INDORE - (M.P.), INDIA
991 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
992 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
993 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
994 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK.
995 COMMUNITY RURAL DEVELOPMENT SOCIETY KASIYAMPATTI VILLAGE, ODASALPATTI POST, KADATHUR VIA, PAPPIREDDIPATTI TK
996 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
997 COMPFEEDER TAKNIKI PRASHIKSHAN SANSTHA 3,GUMASTA NAGAR NEAR SBI BRANCH ,INDORE
998 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
999 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD KUNDA HOUSE,MG ROAD, AURANGABAD, BIHAR
1000 COMPTECH TRAINING AND TECHNOLOGIES PVT LTD 2ND FLOOR, KUNDA HOUSE, MG ROAD, AURANGABAD
1001 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
1002 COMPUTER AVAM SHIKSHAN PRESHIKSHAN SOCIETY GADARWARA ALMA COMPUTER HOSPITAL ROAD NEAR NEW SBI BANK GADARWARA
1003 COMPUTER EDUCATION SOCIETY BELOW OF UNION BANK, NEAR SHAKTI CHOWK, BIJNOR (UP)
1004 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
1005 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1006 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1007 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
1008 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1009 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
1010 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
1011 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1012 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
1013 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1014 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
1015 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
1016 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
1017 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1018 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
1019 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
1020 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
1021 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
1022 COODU TRUST H.83.R M.COLONY DINDIGUL
1023 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
1024 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
1025 COREMAGE ACADEMY 518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD JAMNAGAR
1026 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
1027 COREMAGE INFOTECH 518 INDRAPRASTH COMPLEX PANCHESHWAR TOWER ROAD JAMNAGAR
1028 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
1029 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
1030 COTTON BLOSSOM INDIA PRIVATE LIMITED COTTON BLOSSOM (INDIA) PVT LTD., REGISTERED OFFICE, SHED NO.189, TEKIC TEA NAGAR, SIDCO, MUDALIPALAYAM, TIRUPUR
1031 COUNCIL FOR SKILL UTILITY TRAINING ASSOCIATION 5FT FLOOR O2 BUSSINESS CENTER, RING ROAD NO 2, NEAR RELIANCE PETROL PUMP,GONDWARA, RAIPUR C.G.
1032 COUNCIL FOR SKILL UTILITY TRANING ASSOCIATION 5 TH FLOOR, O2 BUSINESS CENTER, GONDWARA,RING ROAD NO.-2, RAIPUR, C.G.
1033 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
1034 COX QUALITY TECHNOLOGY SOLUTIONS PRIVATE LIMITED G1, 66C, WESTERN HILLS, ADDAGUTTA SOCIETY, KPHB COLONY, KUKATPALLY, HYDERABAD
1035 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
1036 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
1037 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
1038 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
1039 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
1040 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
1041 CROSS TRUST 35/26 WHITE HOUSE STREET WOMAN'S CHRISTIAN COLLEGE ROAD NAGARKOIL
1042 CRYSTAL NETWORK SOLUTIONS B-30 , KAPIL VASTU COLONY JHALAWAR , RAJASTHAN
1043 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
1044 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
1045 CSI COMPUTECH INDIA PRIVATE LIMITED INNAVIMUMBAI (HO)CSI COMPUTECH (I) PVT. LTD.106, BUILDING 3, SECTOR 3,MILLENNIUM BUSINESS PARK, MAHAPENAVI MUMBAI-400701
1046 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
1047 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
1048 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1049 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1050 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1051 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
1052 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
1053 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
1054 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
1055 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
1056 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
1057 CYBERMATE INFOTEK LIMITED 19 & 20, MOTI VALLEY TRIMULGHERRY SECUNDERABAD
1058 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
1059 CYBER SPACE 1 NO KHOOMTAI GAON, MORAN SONARI ROAD, P.O. MORANHAT DIST CHARAIDEO(SIBSAGARH) ASSAM
1060 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
1061 CYBOTECH EDUSERVE PVT LTD GOLA ROAD, NEAR IMAMBARA, NAWADA, BIHAR
1062 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
1063 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
1064 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
1065 DAKSHATA EDUCATION AND WELFARE SOCIETY 673/2 SHRI BALAJI MANDIR MARG, RAMPUR, KORBA CG
1066 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
1067 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
1068 DAKSH INFOSOFT PRIVATE LIMITED G-2, GS APARTMENT, NR. SUNSHINE HONDA, HAWA SADAK, CIVIL LINES, JAIPUR
1069 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1070 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
1071 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1072 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1073 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
1074 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
1075 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
1076 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
1077 DALITSANGH H.NO-13 LATA MARG MITRA KUNJ SOHAGPUR DISTT- HOSHANGABAD (MADHYAPRADESH)
1078 DALIT SANGH HOUSE NO. 13 MITRA KUNJ LATA MARG SOHAGPUR DIST. HOSHANGABAD MP
1079 DALIT SOLIDARITY PEOPLES 181, POCKET- 1 , SECTOR-1, DWARKA, NEW DELHI- 110075
1080 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
1081 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
1082 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
1083 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
1084 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
1085 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1086 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
1087 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1088 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
1089 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
1090 DARYAV ELECTRICAL AND H C E COMAPNY DARYAV MANJIL PHASE 3 INDRAPURI COLOY TIKAMGARH
1091 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
1092 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
1093 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
1094 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
1095 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
1096 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
1097 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1098 DDN SFA LIMITED SHIVAJI CHOWK, MURUD, LATUR MAHARASHTRA-413510
1099 DDUGKY MORD C TEST ALJBSDFLQJHF
1100 DDUGKY MORD C TEST1 LJHWDF
1101 DDUGKY MORD INC TEST2 NEW DELHI
1102 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
1103 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
1104 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
1105 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1106 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1107 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
1108 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
1109 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
1110 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
1111 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
1112 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
1113 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
1114 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
1115 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
1116 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
1117 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1118 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
1119 DEEPSHIKHA MAHILA BAL UTTHAN SAMITI C/O KIRAN ITI COLLEGE,KIRAN NURSING HOME CAMPUS, HATWARA ROAD, 4 NO. DISPENSARY, SODALA, JAIPUR
1120 DEEP SMARAK SHIKSHAN SEVA SANSTHAN YANTRA PRIVATE INDUSTRIAL TRAINING INSTITUTE, VILL HARPUR, PO BAGALI PIJARA
1121 DEEP SMARAK SHIKSHAN SEVA SANSTHAN VILL HARPUR, PO BAGALI PIJARA
1122 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
1123 DELCO INFRASTRUCTURE PROJECTS LIMITED DELCO INFRASTRUCTURE PROJECTS LIMITED 158, SECTOR-9 POCKET -1 DWARKA NEW DELHI
1124 DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED DELCO INFRASTRUCTURE PROJECTS PRIVATE LIMITED 158 SEC-9 POCKET-1 DWARKA NEW DELHI
1125 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
1126 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
1127 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1128 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
1129 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
1130 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
1131 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
1132 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
1133 DEVELOPMENT INITIATIVE DEVELOPMENT INITIATIVE, SRIRAMCHANDRAPUR, P.O.-SAKHIGOPAL, PURI, ODISHA
1134 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
1135 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
1136 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI, WARD NO. 12 INDERGARH
1137 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI WARD NUMBER 12 INDERGARG DATIA
1138 DEVI RATANGARH INSTITUTE OF EDUCATION SAMITI NEAR AARAJI INDERGARH SEVDA DATIA(M.P.)
1139 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
1140 DEXTERITY WELFARE SOCIETY AKBARPUR G.T. ROAD KHURJA, BULANDSHAHR
1141 DFHDFHFH KJDVNMDV,M DV
1142 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
1143 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
1144 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1145 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
1146 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1147 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1148 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1149 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
1150 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
1151 DHANVI CHARITABLE AND EDUCATIONAL TRUST SHOP NO 39 ADITYA COMPLEX NEAR KASAK CIRCLE BHARUCH
1152 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
1153 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
1154 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
1155 DHAYA EDUCATION AND CHARITY FOUNDATION NEWBUSSTAND BUILDING SANTHANAPURAM FIRST STREET PUDUKKOTTAI
1156 DHAYA EDUCATION AND CHARITY FOUNDATION NEW BUS STAND BUILDING OXFORD CATERING COLLEGE CAMPUS SANTHANATHAPURAM STREET PUDUKKOTTAI-01 TAMILNADU
1157 DHRUBA DUKHI CHARITABLE TRUST AT-KALARAHANGA, PO-PATIA, PS-MANCHESWAR
1158 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
1159 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
1160 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
1161 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
1162 DIGITAL LYNC TECHNOLOGIES PVT LTD PLOT NO. 627, SURVEY NO. 40,KHAJAGUDA, NAGA HILLS RD, MADHURA NAGAR COLONY, GACHIBOWLI,HYDERABAD, TELANGANA
1163 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
1164 DIGITAL SHIKSHA AND ROJGAR VIKAS SANSTHAN VPO BAGRI TH PEEPLU DISTRICT TONK RAJASTHAN
1165 DIGITAL SKILL EDUCATION WELFARE SOCIETY WARD NO. 08 PLOT NO. 0153/1481/1413 PRABHAT SKILL TRAINING & COMPUTER SANSTHAN NH. 24 PILIBHIT ROAD RITHORA
1166 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK RAMPUR
1167 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR MILAK RAMPUR UP
1168 DIKSHA SAMAJ SEWA SOCIETY MOH ASDULLAPUR NAI BASTI MILAK DISTT RAMPUR UP
1169 DIKSHA SAMAJ SEWA SOCITY MOH NAI BASTI ASDULLAPUR MILAK RAMPUR
1170 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
1171 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
1172 DISHA DISHA LANE, HISAR ROAD, SIRSA
1173 DISHA DISHA SIRSA DISHA LANE, HISAR ROAD, SIRSA- 125055
1174 DISHA DISHA SIRSA ,DISHA LEN, FRINDES COLONY,BIHAIND PREETAM PALECE ,SIRSA PIN NO. 125055
1175 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
1176 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
1177 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
1178 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
1179 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
1180 DISHA FOUNDATION 26,SAI LEELA TOWER, NEAR RACCA GREEN SQUARE, MAKAHMALABAD ROAD, HANUMANWADI, PANCHVATI ,NASIK (MAHARSTRA)
1181 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
1182 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
1183 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
1184 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
1185 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
1186 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
1187 DIVINE COLLEGE OF COMPUTER LEARNING HOUSE NO 786 ALAPUR ,MAIN MARKET ALAPUR KUNDA PRATAPGARH 229408
1188 DIVINE COMPUTER CENTRE DAWRPUI SOUTH,CANTEEN KUAL, AIZAWL, MIZORAM
1189 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
1190 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
1191 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1192 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
1193 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR, SRI SAI COMPLEX, ADJACENT HDFC BANK, RANIPUR MORE
1194 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
1195 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
1196 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
1197 DIVYSAGAR SOCIETY 108, SR. MIG,NEAR ALLAHABAD BANK, KOTRASULTANABAD,
1198 DIVYSAGAR SOCIETY MIG 74 KOTRASULTANABAD VAISHALI TIRAHA BHOPAL
1199 DIXIT EDUCATION SOCIETY C/O ARYA CAMBRIDGE INTERNATIONAL SCHOOL, SAIBABA VIHAR COMPLEX, NEAR MUCHHALA POLYTECHNIC, GHODBUNDER ROAD, THANE (W)
1200 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
1201 D K NAGARATHI EDUCATIONAL TRUST NO:103, RADHA AVENUE, SRI DEVI GARDEN, VALASARAVAKKAM, CHENNAI-87.
1202 DK SAMAJ SEVA SOCIETY MOH RAMIPUR MILAK RAMPUR
1203 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
1204 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
1205 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
1206 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1207 DMW CNC CENTRE 89 A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
1208 DNYANESHWARI SHIKSHAN PRASARAK MANDAL SUNIL TAMBARE NIVAS, SHAHU NAGAR,BEED.
1209 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
1210 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
1211 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
1212 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
1213 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
1214 DOOR DRISHTI 365 BANK COLONY DEVIL VILLAGE
1215 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
1216 DOUBLE HAND REGD OFFICE:- H.NO-1033, GALI NO-27, SHIV KUNJ, SANT NAGAR, BURARI, DELHI-110084
1217 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
1218 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
1219 DR AMBEDKAR MEMORIAL SOCIAL WELFARE AND EDUCATIONAL TRUST AT/PO-JAGDA, ROURKELA, PS-JHIRPANI, DIST-SUNDARGARH
1220 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
1221 DR A SANKARA SUBRAMANIAN GRG PLYTECHNIC COLLEGE KUPPEPALAYAM S.S KULAM (PO) COIMBATORE
1222 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
1223 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
1224 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
1225 DRAUN SHIKSHA SAMITI CHOLL ROAD MANDLESHWAR DIST. KHARGONE (MP)
1226 DRAUN SHIKSHA SAMITI CHOLI ROAD MANDLESHWAR DIST KHARGONE (MP)
1227 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1228 DR BHIM RAO AMEDKAR AKHIL BHARTIYA DALIT SANGH HOUSE NO-876,BADSI GUJRAN,TAHSIL BAWANI KHEDA,DISTRICT BHIWANI,HARYANA
1229 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA
1230 DR BHIM RAO YUVA SOCIETY VPO NIHAL KHERA TEHSIL & DIST. FAZILKA PUNJAB
1231 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1232 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
1233 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
1234 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
1235 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
1236 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
1237 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
1238 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
1239 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANSTHA DHULE PLOT NO. 09 MADHYAMIK SHIKSHAK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1240 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
1241 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
1242 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1243 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
1244 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
1245 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1246 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
1247 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
1248 DR K R DOSHI TRUST K.R.DOSHI SANKUL, OPP. T.V.KENDRA, GHOGHA CIRCLE, BHAVNAGAR.
1249 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
1250 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
1251 DR OM PRAKASH GUPTA EDUCATIONAL AND SOCIAL WELFARE TRUST 5/1A MAHAVEER GANJ II FARRUKHABAD
1252 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
1253 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
1254 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
1255 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
1256 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
1257 DSHNFJGFD FDHGF FDSGHFDJ GH F
1258 DUM DUM PARK UNNAYANI SAMANNAY 172, LAKE TOWN, BLOCK-A, FLAT NO. 2, KOLKATA
1259 DUPATI SRI EDUCATIONAL SOCIETY H NO 87-1345-10-1, ENGINEERS COLONY,KURNOOL,AP
1260 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1261 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
1262 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1263 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
1264 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
1265 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA, P.O- PANAGARH BAZER, DIST- BURDWAN
1266 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
1267 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
1268 DURGAPUR SOCIAL AND EDUCATIONAL TRUST MSAV-32, URVASHI (BENGAL AMBUJA), CITY CENTRE, DURGAPUR, DIST- PASCHIM BARDHAMAN, WEST BENGAL, PIN: 713216
1269 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
1270 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
1271 DURJAN SAL EDUCATIONAL TRUST RAM SINGH COLLEGE OF ENGG.AND TECHNOLOGY,NAGLA SIKANDAR TUNDLA-ETAH ROAD,FIROZABAD
1272 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
1273 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD NO.5,JAWAHAR NAGAR COLONY,HYDERABAD
1274 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
1275 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
1276 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
1277 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
1278 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
1279 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
1280 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
1281 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1282 EAGLE TECHSEC COMMUNICATIONS INDIA PVT LTD M-23 NEW SIYAGANJ , VIP ROAD NO.01 , MALL GODOWN ROAD INDORE
1283 EARTH INFRALAND DEVELOPERS PVT LTD 19-B,PANCHVATI COLONY,RAHEEM NAGAR,LUCKNOW
1284 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
1285 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
1286 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
1287 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
1288 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
1289 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
1290 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
1291 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
1292 ECO CLUB SIWANI MANDI WARD NO 7 NEAR PUNJABI DHARAMSHALA SIWANI MANDI DIST BHIWANI HARYANA
1293 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
1294 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
1295 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
1296 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
1297 EDGE TELECOM PRIVATE LIMITED 1ST FLOOR, MAIN SOHNA ROAD, NEAR RADHA KRISHNA MANDIR, VILLAGE BADSHAHPUR, SOHNA ROAD- GURGAON, GURUGRAM, HARYANA
1298 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
1299 EDS GADEPAN KOTA
1300 EDUCATIONAL RESEARCH AND HUMAN DEVELOPMENT COMMITTEE TRUST 1/33A,MAIN STREET, ENATHI , KIDATHIRUKKAI(POST)
1301 EDUCATIONAL SYSTEM AND WELFARE SOCIETY 61 CIVIL LINES NEAR ISLAMIYA GIRLS INTER COLLEGE BAREILLY 243001
1302 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
1303 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
1304 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
1305 EDU INSTITUTE ADDRESS
1306 EDUJOIN TRAINING FOUNDATION FLAT NO-515, 1ST FLOOR, POCKET-1, PASCHIM PURI NEAR MANDIR GURUDWARA, NEW DELHI
1307 EDUSOL EDUCATIONAL AND WELFARE SOCIETY PLOT NO. 740, SECTOR - 82, JLPL INDUSTRIAL PARK, MOHALI
1308 EDUSPARK INTERNATIONAL PRIVATE LIMITED MOTILAL NAGAR-1 SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104, MAHARASHTRA, INDIA
1309 EDUSPARK INTERNATIONAL PRIVATE LINITED MOTILAL NAGAR-1, SRIRANG SADBEMARG OFF LINK ROAD, GOREGAON (W), MUMBAI-400104
1310 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
1311 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
1312 EDUWORLD INSTITUTES PRIVATE LIMITED C-1,B-22, SAUBHAGAYA APARMENT SEC-A, MAHANAGAR LUCKNOW
1313 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
1314 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
1315 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
1316 EKATMIK VISTAR SEVA PRIVATE LIMITED VAISHNAVI COMPLEX, 255/2/3, FLAT NO. E-12, KADAM WAK VASTI
1317 EKLAVYA DEVELOPMENT SOCIETY VILLAGE POST-KANTOLI TEHSIL- MALPURA DISTRICT-TONK RAJASTHAN 304502
1318 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
1319 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
1320 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
1321 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
1322 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX.DHAKURIA,KOLKATA-700068
1323 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
1324 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
1325 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
1326 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
1327 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1328 EMERAL ENERGY SOLUTIONS PVT LTD 215, CHANDRAPRABHU COMPLEX,NR.CHANDRAPRABHU COMPLEX, NR.SARDAR PATEL STATUE, NARANPURA, AHMEDABAD.
1329 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
1330 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
1331 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
1332 ENCHANT SKILLS PRIVATE LIMITED KH NO-460, HARSAON KI MANDHIYA, GOVIND PURAM, GHAZIABAD, UTTAR PRADESH
1333 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1334 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
1335 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
1336 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
1337 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
1338 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
1339 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428,DIST. GANDHINAGAR, GUJARAT, INDIA.
1340 ENTREPRENEURSHIP DEVELOPMENT INSTITUTE OF INDIA (VIA AHMEDABAD AIRPORT & INDIRA BRIDGE), P.O. BHAT 382 428, DIST. GANDHINAGAR, GUJARAT, INDIA.
1341 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
1342 ENVIRONMENTAL ACTION TRUST 58,KAMARAJ STREET EXTERN,NARASIMMAPURAM NEW PLACE,KUNIYAMUTHUR,COIMBATORE
1343 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
1344 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
1345 E PARIVARA SAGARA NIVASA SPM ROAD SAGAR 577401
1346 E PARIVARA SAGAR NIVASA SPM ROAD SAGAR 577401
1347 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
1348 ERAM TECHNOLOGIES PVT LTD III FLOOR, INKEL TOWER, ANGAMALY
1349 ERAM TECHNOLOGIES PVT LTD III FLOOR INKEL TOWER, ANGAMALY SOUTH PO, NEAR TELK ANGAMALY
1350 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1351 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1352 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
1353 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
1354 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
1355 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
1356 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
1357 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
1358 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
1359 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
1360 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
1361 ESTEX TELECOM PRIVATE LIMITED ESTEX TELECOM PVT. LTD., ESTEX HOUSE,38, KIRTINAGAR, DLF INDUSTRIAL AREA, NEAR SYNDICATE BANK, NEW DELHI
1362 ESTEX TELECOM PRIVATE LIMITED ESTEX HOUSE 38, DLF INDUSTRIAL AREA KIRTI NAGER
1363 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
1364 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
1365 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
1366 EVANGELICAL SOCIAL ACTION FORUM GENERAL SECRETARY,EVANGELICAL SOCIAL ACTION FORUM 1696 VISWAS BHAVAN,KUNDUKULAM ROAD P.O,MANNUTHY.
1367 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
1368 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
1369 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
1370 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
1371 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
1372 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
1373 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
1374 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
1375 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
1376 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1377 EXCELLENCE TECHNICAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY SHOP 1 NEW MARKET NEAR KANCHAN GALI MUNGAOLI
1378 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
1379 EXPERT SKILL DEVELOPMENT PRIVATE LIMITED 163 C BLOCK NEW MANDI SIRSA ( HARYANA )
1380 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
1381 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
1382 FAANS CONSULTANTS PVT LTD C#6,LIGHT HOUSE HILL ROAD,OPPOSITE KASTHURBA MEDICAL COLLEGE,HAMPANKATTA
1383 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
1384 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
1385 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1386 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1387 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1388 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
1389 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1390 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
1391 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
1392 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
1393 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
1394 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
1395 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
1396 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
1397 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
1398 FALKAN PVT LTD COURT ROAD MAGAM, BUDGAM, J&K
1399 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1400 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1401 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
1402 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
1403 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
1404 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
1405 FEHMIDA JAFRI MEMORIAL EDUCATION AND WELFARE SOCIETY C 20 BALAJI AVENEW VIDISHA
1406 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
1407 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
1408 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
1409 FIDERE FACILITIES MANAGEMENT PVT LTD 7 CLUB DRIVE ROAD, MG ROAD, GHITTORNI NEW DELHI-1110030
1410 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
1411 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
1412 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
1413 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1414 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
1415 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
1416 FLAWLESS BEAUTY PRODUCTS AND SERVICES PRIVATE LIMITED L-102,L BOCK, SHISH PAL VIHAR, SECTOR-49, SOHNA ROAD,GURGAON, HARYANA-122018
1417 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE;1/1,JAYANKONDAM MAIN ROAD,ARIYALUR.
1418 FOCUS EDUCATIONAL AND CHARITABLE TRUST FIELD OFFICE : 1/1, JAYANKONDAM MAIN ROAD, ARIYALUR
1419 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
1420 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
1421 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
1422 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
1423 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
1424 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
1425 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
1426 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
1427 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
1428 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1429 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS REGISTER :- 61, DESHBANDHU APARTMENT, KALKAJI CONTACT DETAIL C-27, DAYANAND COLONY, LAJPAT NAGAR IV
1430 FOUNDATION FOR SPASTIC AND MENTALLY HANDICAPPED PERSONS UDAAN C-27, DAYANAND COLONY
1431 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
1432 FREECOM EDUCATION AND WELFARE SOCIETY HOUSE NO. 217 WARD NUMBER 05 JHANDA BAZAR BEHIND NARAYAN TALKIES SIHORA
1433 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
1434 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
1435 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
1436 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
1437 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
1438 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
1439 F TECH PRIVATE LIMITED FUTURE CAREER ACADEMY (TRAINING & PLACEMENT CENTRE) CAREER DIVISION F TECH PRIVATE LIMITED, MANJUSHREE BUILDNG, NEAR KRISHI BHAWAN, DARAGAON, TADONG, GANGTOK, EAST SIKKIM
1440 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
1441 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA AULINA
1442 FUTURE GROWTH INDIA SERVICES VILL+POST- AULINA , DIST BULANDSHAHAR
1443 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
1444 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
1445 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
1446 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
1447 FUZONE E SYSTEMS PVT LTD B-1177/78, G.D. COLONY, MAYUR VIHAR-III, DELHI-
1448 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1449 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1450 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
1451 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
1452 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
1453 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
1454 GALA PRINT CITY LIMITED B-1 LAXMI COM. CO-OP ESTATE,OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD, SUKHRAMNAGAR, AHMEDABAD.
1455 GALA PRINTCITY LIMITED B-1 LAXMI COMMERCIAL CO-OP ESTATE, OLD NAVNEET PRESS COMPOUND, AJOD DAIRY ROAD SUKHRAMNAGAR, AHMEDABAD
1456 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
1457 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1458 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
1459 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
1460 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
1461 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1462 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1463 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1464 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
1465 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1466 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
1467 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
1468 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
1469 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
1470 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
1471 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
1472 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
1473 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
1474 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1475 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
1476 GANGA DEVI MEMORIAL TRUST PRABHUNATH NAGAR CHAPRA GROUND FLOOR GDMT CAMPUS
1477 GANPATI VIDHYA PEETH WALEFARE SOCIETY NEAR INDANE GAS GODAM SHAHABAD RAMPUR
1478 GANPAT UNIVERSITY GANPAT UNIVERSITY, GANPAT VIDYANAGAR
1479 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
1480 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
1481 GARV FOUNDATION AGAR NAGAR RAILWAY ROAD, NABHA
1482 GARV SHIKSHAN SANSTHA PURAI BHILAI
1483 GARV SHIKSHAN SANSTHA MALVIYA NAGAR DURG PURAI, UTAI, BHILAI
1484 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
1485 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
1486 GAURAV MEMORIAL TRUST E/5 VARDHMAN CITY PATEL NAGAR RAISEN ROAD BHOPAL 462021
1487 GAURI EDUCATIONAL SOCIETY 28-LAXMI NAGAR, SANJAY NAGAR BYPASS ROAD BAREILLY (UTTAR-PRADESH)
1488 GAUTAM BUDH HEALTH CARE FOUNDATION C-1 SECTOR 12 NOIDA
1489 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
1490 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
1491 GAUTAM COMPUTER EDUCATION MANAGEMENT SOCIETY NEAR SHANTI LIBRARY, MAIN MARKET, RAJALDESAR CHURU RAJASTHAN
1492 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
1493 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1494 GAYATRI EDUCATIONAL AND CULTURAL SOCIETY GAYATRI EDUCATIONAL AND CULTURAL SOCIETY 8/14, GROUND FLOOR, EAST PATEL NAGAR NEW DELHI- 110008
1495 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
1496 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
1497 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
1498 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
1499 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
1500 GCS BIO FARMS PRIVATE LTD #105, ANNAPURNA BLOCK, ADITYA ENCLAVE, AMEERPET, HYDERABAD, TELANGANA.
1501 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
1502 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
1503 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
1504 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
1505 GENUINESOFT ST.HINDUCOLLEGE ROAD
1506 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
1507 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
1508 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
1509 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
1510 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
1511 GET SOURCE EDUCATION PRIVATE LIMITED GET SOURCE EDUCATION PRIVATE LIMITED 324 - C, MODEL TOWN, AMBALA
1512 GET SOURCE EDUCATION PRIVATE LIMITED 324-C,MODEL TOWN
1513 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
1514 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
1515 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
1516 GFHDYHDBAH VSGYCGDHFGSDY
1517 GFHDYHDBAH QSDWEFWE
1518 GHRP SKILL INDIA PRIVATE LIMITED J-5/7, J – BLOCK, DLF PHASE – 2, GURGAON, HARYANA - 122001
1519 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
1520 GIMIT E SERVICES GIMIT BUILDING H-11 SOUTH EXTENTION PART 1
1521 GI POWER CORPORATION LIMITED GI POWER CORPORATION LIMITED 91A MITTAL COURT, NARIMAN POINT, MUMBAI 400021
1522 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
1523 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
1524 GITANJALI FOUNDATION GITANJALI BUILDING, VILL-BARABAGAN, PO-BARABAGAN, PS-SURI,
1525 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
1526 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
1527 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1528 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1529 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
1530 G K EDUCATIONAL TRUST TOLL POST NAGROTA
1531 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
1532 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
1533 GK FOUNDATION 36/1 GOVINDPURI NEW DELHI
1534 GK FOUNDATION 36/B KALKAJI NEW DELHI
1535 GK FOUNDATION 36/1 KALKAJI NEW DELHI
1536 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
1537 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
1538 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
1539 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
1540 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1541 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
1542 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
1543 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
1544 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
1545 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
1546 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1547 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
1548 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX,DAKBANGLOW CHOWK,OPP. PUNJAB & SINDH BANK, PATNA - 1
1549 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY PARIJAT COMPKEX, 1ST FLOOR,OPP - PUNJAB & SINDH BANK, DAKBUNGLOW CHOWK, PATNA, BIHAR
1550 GLOBAL INSTITUTE OF INFORMATION TECHNOLOGY FIRST FLOOR, PARIJAT COMPLEX, DAKBANGLOW CHOWK, OPP.PUNJAB & SINDH BANK, PATNA - 1
1551 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
1552 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
1553 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
1554 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
1555 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
1556 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
1557 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE, RAMBAGH ROAD, MUZAFFARPUR BO: 2ND FLOOR, MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1558 GLOBAL SKILL DEVELOPMENT FOUNDATION HO: KAMAL KUNJ, JHUNNI LAL SAH LANE,RAMBAGH ROAD, MUZAFFARPUR BO: MAHAVIR COMPLEX, TOWARDS AAMGOLA BRIDGE, HARISABHA CHOWK, MUZAFFARPUR
1559 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
1560 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1561 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
1562 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1563 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
1564 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
1565 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
1566 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1567 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
1568 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101,
1569 GLOBSYN KNOWLEDGE FOUNDATION GLOBSYN KNOWLEDGE FOUNDATION MOUZA - CHANDI, PS - BISHNUPUR, J.L. NO. - 101, DISTRICT - 24 PARGANAS (SOUTH). KOLKATA
1570 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
1571 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
1572 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
1573 GLOWDOWN SERVICES PRIVATE LIMITED MADHUKUNI, 2 FLOOR, BANK COLONEY, NEAR UNION BANK OF INDIA
1574 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
1575 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
1576 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
1577 GNANAJYOTHI SAMSTHE REG NO 645 2ND MAIN 5TH CROSS LOKANAYAKANAGARA HEBBAL MAIN ROAD METAGALLI MYSURU
1578 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
1579 GNRC INSTITUTE OF MEDICAL SCIENCE NORTH GUWAHATI A UNIT OF GNRC LTD GNRC INSTITUTE OF MEDICAL SCIENCE, NORTH GUWAHATI SILAGRANT, NEAR IIT - GUWAHATI, DIST : KAMRUP(R) ASSAM,
1580 GOAL SOCIETY HAPPINESS OF LIFEA BHETAPARA VIDYAMANDIR PATH BYLANE-SURUJ NAGAR,H/NO-11,BELTOLA, GHY-28, KAMRUP(M), ASSAM, INDIA
1581 GOBARDHANDANGA EDUCATION SOCIETY VILL & PO-GOBARDHANDANGA,PS-SAGARDIGHI,DIST-MURSHIDABAD
1582 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR.PO+PS-CHANDRAKONA ,DIST-PASCHIM MEDINIPUR
1583 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
1584 GOBINDAPUR RAMKRISHNA SEBA SANGHA VILL-GOBINDAPUR,P.O.+P.S.-CHANDRAKONA TOWN
1585 GOBINDAPUR RAMKRISHNA SEBA SANGHA GOBINDAPUR,PO+PS-CHANDRAKONA
1586 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
1587 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
1588 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
1589 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
1590 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
1591 GOMAL JAN SEWA SANSTHAN JANKI NAGAR, WARD NO- 07, NAGAR PANCHAYAT KUSHINAGAR
1592 GOODWORTH FOREX AND SERVICES PVT LTD A-276, BASEMENT, SHIVALIK, NEW DELHI
1593 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
1594 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
1595 GOPAL KIRAN SIKSHA AVAM SANSKRITIK SAMITI NIMRAJE SADAN, NEW MOHAN NAGAR, THATIPUR
1596 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
1597 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST JONIHA FATEHPUR
1598 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
1599 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
1600 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANTHAN VILL & POST JONIHA FATEHPUR
1601 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
1602 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1603 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1604 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT, TAMILNADU STATE.
1605 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1606 GOYAL CREATION PVT LTD OFFICE A-150(B),AMBAJI INDUSTRIAL AREA.SANTPUR,ABUROAD
1607 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1608 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1609 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1610 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1611 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1612 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1613 GRAMANIKETAN CHARITABLE SOCIETY GRAMANIKETAN CHARITABLE SOCIETY LENIN NAGAR, BAKERY JN., THYCAUD PO. TRIVANDRUM
1614 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1615 GRAMDEEP MADHUBANI GOSAITOLA, PO - RAGHOPUR BLAT, VIA- RAMPATTI, DIST.- MADHUBANI, BIHAR
1616 GRAMDEEP MADHUBANI VILL - GOSAITOL, POST - RAGHOPURBALAT,VIA - RAMPATTI, DIST. - MADHUBANI, BIHAR.
1617 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1618 GRAMIN BAL EVAM MANAV VIKAS SAMITI AT JAGIRMAHESHKHUNT GRAM, PO: HALDHARA HAAT, PANCHAYAT: LAXMIPUR, BLOCK: KURSAKANTA, DISTT: ARARIA, PINCODE: 854331 (BIHAR)
1619 GRAMIN JAN KALYAN PARISHAD MAQBOOL MANZIL,SADPURA NEW COLONY, NEEM CHOWK, MUZAFFARPUR
1620 GRAMIN LOK SEVA SANSTHA GUMMALKONDA AT GUMMALKONDA POST ASARALLI TAH SIRONCHA DIST GADCHIROLI-442505
1621 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1622 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT,VISNAGAR
1623 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR
1624 GRAMIN SHAKSHARTA MISSION 2ND FLOOR, GOLD COIN COMPLEX, OPP.TALUKA PANCHAYAT, VISNAGAR, GUJARAT-384315
1625 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1626 GRAMIN SIKSHA VIKAS SANSTHAN NEW KOTWALI CHORAHA NANAU ROAD SASNI HATHRAS
1627 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1628 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1629 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1630 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1631 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1632 GRAMIN VIKAS SEVA SANSTHAN VILL POST TARIA LACCHIRAM KUSHINAGAR U.P
1633 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1634 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD, NEAR KOTWALI, SAHARA INDIA 02ND FLOOR, MOHALLA- MULIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1635 GRAMIN VIKAS SEWA SAMITI DISTRICT HOSPITAL ROAD NEAR KOTWALI SAHARA INDIA OFFICE 02ND FLOOR, MOHALLA- MURLIJOT, POST- PURANI BASTI, DISTRICT- BASTI
1636 GRAMIN VIKAS SEWA SAMITI MOHALLA- SHAKITI NAGAR POST- GANDHI NAGAR DISTRICT- BASTI, UTTAR PRADESH
1637 GRAMIN VIKAS SHIKSHAN SANSHTA GRAMIN VIKAS SHIKSHAN SANSHTA ORGANISED CAREER COMPUTER AND TECHNICAL INSTITUTE, FIRST FLOOF, STATE BANK TO GOVT. HOSPITAL ROAD, BANOSA,TQ. DARYAPUR, DIST. AMRAVATI.
1638 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1639 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1640 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1641 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1642 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1643 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1644 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1645 GRAM SHIKSHAN EVAM VIKAS SAMITI VILL +POST KAHLA MALIHABAD LUCKNOW
1646 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1647 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1648 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1649 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1650 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1651 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1652 GRASS ROOT EDUCATIONAL FOUNDATION SHIO NO-4, IST FLOOR, BALAJI COMPLEX, SATYA PLACE ROAD, BUDHANA GATE, MEERUT UP
1653 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1654 GRD EDUCATION SOCIETY 203, EAST MOHAN NAGAR, AMRITSAR, PUNJAB
1655 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1656 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1657 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1658 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1659 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1660 GREEN INDIA FOUNDATIONAL TRUST 4/66-1 SUMANGALINAGAR, PURATHAUDI, TRICHY.
1661 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALI NAGAR, PURATHAKUDI, TRICHY.
1662 GREEN INDIA FOUNDATIONAL TRUST 4/66-1, SUMANGALINAGAR, PURATHAKUDI, TRICHY.
1663 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1664 GREEN SECURE POWER SYSTEMS PRIVATE LIMITED 6-3-596/77/3/A, BANJARA HILLS RD NO 1, MADA MANZIL, BANJARA HILLS, HYDERABAD, TELANGANA
1665 GREEN VIEW EDUCATIONAL AND SKILLS INDIA PVT LTD PRADHAN COMPLEX THAKUR MARKET MAIN ROAD MAIRWA DHAM MAIRWA SIWAN BIHAR
1666 GRG POLYTECHNIC COLLEGE GRG POLYTECHNIC COLLEGE KUPPEPALAYAM S.S. KULAM POST COIMBATORE
1667 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1668 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1669 GRG TRUST GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMIL NADU
1670 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1671 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR, PHASE-1, DELHI.
1672 GROUP MEDIA PVT LTD C-2/5&6, ACHARYA NIKETAN MAYUR VIHAR PHASE-1, DELHI.
1673 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1674 GROWTH FOUNDATION OF INDIA L-46A, MALVIYA NAGAR NEW DELHI-110017
1675 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1676 G T TRUST 693 BAZZAR STREET, ATTUR,SALEM
1677 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1678 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1679 G T TRUST 693 BAZZAR STREET, ATTUR (T.K),SALEM
1680 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1681 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1682 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1683 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1684 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1685 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1686 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1687 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1688 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1689 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1690 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1691 GUNJ SHIKSHA SEWA EVAM VIKAS SAMITI ATHNER COLLEGE ROAD ATHNER DIST- BETUL (M.P.)
1692 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1693 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1694 GURU EDUCATIONAL TRUST NO-2/229E, SALEM MAIN ROAD, B. NADOOR. BOMMIDI, DHARMAPURI-635301.
1695 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1696 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1697 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1698 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1699 GURUKRUPA EDUCATIONAL TRUST MAHABAHU ENCLAVE, PLOT NO. 1753/3, AT - KALARAHANGA, POST - KIIT SQUARE, BHUBANESWAR, KHORDHA, ODISHA
1700 GURUKRUPA EDUCATIONAL TRUST PLOT NO-1753, SUB PLOT NO-3, KALARAHANGA, PO-KIT SQUARE, PS-INFO CITY, PATIA, BHUBANESWAR
1701 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1702 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1703 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1704 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1705 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1706 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1707 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1708 GURU RAJENDRA SIKSHA AVAM SAMAJ KALYAN SAMITI MAILA MAIDAN,NAVRATNA COOLAGE OF EDUCATION,RAJGARH,DHAR
1709 GVK EMERGENCY MANAGEMENT AND RESEARCH INSTITUTE MEDCHAL ROAD, DEVARYAMZAL, SECUNDERABAD, TELANGANA
1710 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1711 GYANARPAN SAMAJ SEVI SANSATHAN IN FRONT OF SUPTESHWAR GANESH MANDIR RATAN NAGAR ROAD JABALPUR
1712 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1713 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, RSM TIRAHA, KALAGARH ROAD, DHAMPUR
1714 GYAN BHARTI INFOTECH PRIVATE LIMITED NEAR PREET AUTOMOBILES, KALAGARH ROAD, DHAMPUR
1715 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1716 GYAN KALP CHARITABLE TRUST INDIC HEIGHTS, AT/PO-MUKTAPUR, KHORDHA
1717 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1718 GYAN SAROVAR SHIKSHA EVAM JAN KALYAN SAMITI 5, NEAR GAS AGENCY, S.A.T.I ROAD
1719 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1720 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1721 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1722 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1723 HAIR RAISERZ SCO 27, SECTOR 15C, CHANDIGARH
1724 HAIR RAISERZ LLP SCO 27, SECTOR 15C CHANDIGARH
1725 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1726 HAMRAHI ROSHNI MAHILA SAMITI E-3/229, ARERA COLONY, NEAR 10 NO. BUS STOP, BHOPAL
1727 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1728 HANKER SOLUTIONS PVT LTD B610, LOGIX TECHNOVA, SECTOR 132, NOIDA
1729 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1730 HAPPINESS FOR ALL WELFARE AND EDUCATION SOCIETY 1ST FLORE SAMADHAN CAREER ACADEMY TANDON BAGICHA DAMOH 470661
1731 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1732 HAPPY WELFARE SOCIETY PLAT NO 11 PURWANCHAL NAGAR ALOK DUBEY ROAD KALYANPUR LUCKNOW
1733 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1734 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1735 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1736 HARIBALA TRUST 2/173,HARIBALA ILLAM, T PUDUR, SIVAGANGAI TAMILNADU
1737 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1738 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1739 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1740 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1741 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1742 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1743 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1744 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1745 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1746 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1747 HARSH PVT LTD SDFAAFDSSDF
1748 HARYANA ESTATE SOLUTIONS HARYANA ESTATE SOLUTIONS,SHOP NO.-1,GROUND FLOOR,NEAR FOOD HUB SEC 37,MAIN SECTOR ROAD,BASAI ENCLAVE EXTN. ,GURGAON 122001
1749 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1750 HASAN EDUCATIONAL SOCIETY HASAN EDUCATIONAL SOCIETY MAIN ROAD VPO JAULA TEHSIL BUDHANA DIST MUZAFFARNAGAR UTTAR PRADESH PIN 251309
1751 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1752 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1753 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1754 HEAD HELD HIGH FOUNDATION VILLA 21-22, PALM MEADOWS, PHASE-1, RAMAGONDANAHALLI, WHITEFILED ROAD, BANGALORE
1755 HEAD HELD HIGH FOUNDATION 22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1756 HEAD HELD HIGH FOUNDATION # 643, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE
1757 HEAD HELD HIGH FOUNDATION NO.22, PALM MEADOWS, RAMAGONDANAHALLI, VARTHUR ROAD, BANGALORE
1758 HEALTH AND EDUCATION FOR ALL HEAL HEAL PARADISE, THOTAPALLI, AGIRIPALLI, KRISHNA DISTRICT,ANDHRA PRADESH
1759 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1760 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1761 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1762 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1763 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1764 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1765 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1766 HEAVY TECHNOLOGIES PRIVATE LIMITED 355,SUBHASH NAGAR,NANDINI ROAD,NEAR GOVERMENT SCHOOL,BHILAI
1767 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1768 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414,BLOCK NO 22/23/24/25 HUMNABAD ,BIDAR
1769 HELP2EDUCATE FOUNDATION CHARITABLE TRUST #414 BLOCK NO 22,23,24,25
1770 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1771 HELPING HANDS WELFARE SOCIETY 2752-C, RAM NAGAR, LONI ROAD, SHAHDARA, DELHI
1772 HELPING HAND WELFARE SOCIETY REG.OFFICE VILL SARSOPAR POST BHUSWAL BU DIST GORAKHPUR 273403 HEAD OFFICE- BHITAHA, KAURIRAM GORAKHPUR-273413
1773 HELPING HAND WELFARE SOCIETY REGISTERED OFFICE VILL SARSOPAR POST BHUSWAL BUJURG DIST GORAKHPUR 273403 HEAD OFFICE BHITAHA KAURIRAM GORAKHPUR 273413
1774 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1775 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1776 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1777 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1778 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1779 HERITAGE FOUNDATION 253, M.G. ROAD, CHAK THAKURANI, P.O: R.C. THAKURANI KALITALA HOUSING, MANGALDEEP, P.S: HARIDEVPUR KOLKATA-700104, WEST BENGAL, INDIA.
1780 HETERO LABS LIMITED HETERO CORPORATE,7-2-A2, INDUSTRIAL ESTATE, SANATHNAGAR, HYDERABAD
1781 HEWTECH SYSTEM C-2, JAIPRAKASH NAGAR ASHIYANA, PATNA, BIHAR
1782 HGS INTERNATIONAL SERVICES PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI
1783 HGXDNG CBGNCBNMCNFMHXFVM
1784 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1785 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1786 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1787 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1788 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1789 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1790 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1791 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1792 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1793 HINDUJA OUTSOURCING SOLUTIONS INDIA PRIVATE LIMITED HGS INTERNATIONAL SERVICES PRIVATE LIMITED HINDUJA HOUSE, 171, DR. ANNIE BESANT ROAD, WORLI, MUMBAI - 400018, MAHARASHTRA, INDIA
1794 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1795 HINDUSTANI TANZEEM FROGHE ILMOFUN FLAT NO. 202, KALYANI COMPLEX, LANGERTOLI CHAURAHA, PATNA - 800004
1796 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1797 HINGLAJ INSTITUTE OF TECHNICLA EDUCATION CENTRE AND SOCIAL WELFARE SAMITI REGISTED OFF DURGA NAGAR M NO 91 SHIVAJI NAGAR BHOPAL MP
1798 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1799 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1800 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1801 HIREEX CAREER SOLUTIONS SHOP NO 1 AND 2 KAPEESH MALL, M G ROAD MULUND WEST MUMBAI 400080
1802 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1803 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1804 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1805 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1806 HLL MANAGEMENT ACADEMY HLL MANAGEMENT ACADEMY TC 4/1607, KESTON ROAD, KOWDIAR P O, TRIVANDRUM
1807 HLM EDUCATIONAL SOCIETY 11 KM MILESTONE, DELHI-MEERUT ROAD
1808 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1809 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1810 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1811 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1812 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1813 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1814 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1815 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1816 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1817 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1818 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1819 HRDS INDIA HRDS INDIA DOOR NO: XIV/273, NEAR POST OFFICE, CHANDRANAGAR,PALAKKAD,KERALA
1820 HRDS INDIA THE HIGHRANGE RURAL DEVELOPMENT SOCIETY HRDS INDIA, XIV/273, NEAR POST OFFICE, CHANDRANAGAR, PALAKKAD, KERALA, INDIA
1821 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
1822 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG HNO 52 PATHALGAON LINEPARA
1823 HRISHIKESH EDUCATIONAL INSTITUTE OF TECHNOLOGY SOCIETY CG H. NO.52 PATHALGAON LINEPARA PATHALGAON
1824 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1825 HR SQUARE LLP PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1826 HSADALO FFSE
1827 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1828 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1829 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1830 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1831 HUMANITY WELFARE SOCIETY 860/22, LANE NO. 2 AMBA VIHAR MUZAFFARNAGAR
1832 HUMANITY WELFARE SOCIETY 860/22, LANE NO.2, AMBA VIHAR MUZAFFARNAGAR
1833 HUMANITY WELFARE SOCIETY 860/22, GALI NO.2 AMBA VIHAR, MUZAFFFARNAGAR
1834 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1835 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1836 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1837 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1838 HUMAN WELFARE ORGANISATION 402, 2ND FLOOR, BDA COMPLEX, 7 NO. BUS STOP, SHIVAJI NAGAR, BHOPAL
1839 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1840 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1841 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1842 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1843 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1844 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1845 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1846 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1847 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1848 ICCO C-19/A, 1ST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1849 ICCO C-19/A, FIRST FLOOR, GREEN PARK EXTENSION, NEW DELHI
1850 ICCO C-19/A, FIRST FLOOR GREENPARK EXTENSION NEW DELHI
1851 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA VILLAGE DHAKULI ZIRAKPUR, MOHALI
1852 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA, DHAKOLI ZIRAKPUR, MOHALI PUNJAB
1853 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1854 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI PUNJAB
1855 ICEI SOCIETY FOR EDUCATION SCO 5-6-7 NEELKANTH PLAZA DHAKOLI ZIRAKPUR MOHALI
1856 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1857 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY
1858 ICL KAUSHAL VIKASH SERVICES PRIVATE LIMITED 41-C GANDHI NAGAR OPP. PANCHAM MRI DIAGNOSTIC CENTRE, BAREILLY-243122
1859 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1860 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1861 ICTPMU DDUGKY TEST NEW DELHI
1862 ICTPMU TEST11 NEW DELHI110001
1863 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1864 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1865 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1866 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1867 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1868 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1869 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1870 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1871 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1872 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1873 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1874 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1875 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1876 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1877 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1878 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1879 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1880 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1881 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1882 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1883 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1884 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1885 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
1886 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
1887 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE PULWAMA J&K
1888 IMI INSTITUTE OF INFORMATION AND TECHNOLOGY KHREW PAMPORE
1889 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1890 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1891 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1892 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1893 IMPULSIVE SOCIAL AWARENESS COMMITTEE WARD NO 02 JAWALAMUKHI MOHLLA SIHORA DIST.JABALPUR M.P.
1894 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1895 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1896 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1897 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1898 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1899 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1900 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1901 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1902 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1903 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1904 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, POST-HATIBERIA,HALDIA
1905 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1906 INDIANEERS MEDIA PRIVATE LIMITED A-494, SHAHPURA, BHOPAL, MADHYA PRADESH
1907 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1908 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1909 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR POST OFFICE BOTANIC GARDEN SHIBPUR HOWRAH WEST BENGAL
1910 INDIAN INSTITUTE OF ENGINEERING SCIENCE AND TECHNOLOGY SHIBPUR SHIBPUR BOTANIC GARDEN HOWRAH
1911 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1912 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1913 INDIAN INSTITUTE OF HARDWARE TECHNOLOGY LIMITED #15, SRI LAKSHMI COMPLEX, 4TH FLOOR , ST MARKS ROAD BANGALORE-560001
1914 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1915 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1916 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1917 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1918 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1919 INDIAN MEDICAL TRUST NIMS UNIVERSITY DELHI JAIPUR HIGHWAY JAIPUR
1920 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1921 INDIAN MEDICAL TRUST 4, GOVIND MARG, NEAR MOTI DUNGRI CIRCLE, JAIPUR
1922 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1923 INDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -302031
1924 INDIAN MEDICINE DEVELOPMENT TRUST 5106 PHATAK BANS SIRKIWALAN LAL KUAN DELHI-110006
1925 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1926 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD NEW DELHI
1927 INDIAN SOCIETY OF HEALTHCARE PROFESSIONALS B1/B1 MOHAN CO-OP INDUSTRIAL ESTATE MATHURA ROAD, NEWDELHI
1928 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PRIVATE LIMITED B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BR 800004 INDIA
1929 INDIRA GOPAL INSTITUTE OF MEDICAL SERVICES PVT LTD B/2, PRAFULLA PLAZA, MAKHANIA KUAN ROAD PS-PIRBAHAORE PATNA BIHAR INDIA
1930 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1931 INDIRA MEMORIAL EDUCATIONAL SOCIETY INDRA MEMORIAL EDUCATIONAL SOCIETY ITI COMPOUND FREE GANJ HAPUR UTTAR PRADESH GHAZIABAD
1932 INDO AMERICAN FRIENDS GROUP TEHSIL ROAD , SALON , RAEBARELI , UTTERPRADESH
1933 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1934 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1935 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1936 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1937 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5000/ PHASE - 4 GIDC, VATVA, MEHMEDABAD ROAD, AHMEDABAD, GUJARAT
1938 INDO GERMAN TOOL ROOM AHMEDABAD PLOT NO. 5003 PHASE-4,GIDC,VATVA MEHMDABAD ROAD,AHMEDABAD-382445 GUJARAT
1939 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1940 INDOSYS WELFARE SOCIETY OPP. UNIVERSITY CAMPUS, TALWANDI SABO
1941 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1942 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1943 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1944 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1945 INDRAKAMAL CHARITABLE TRUST MUKHERRJEE, HATA, ARA, BHOJPUR, BIHAR, INDIA
1946 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1947 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1948 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1949 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1950 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1951 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1952 INDUS FOUNDATION 156-GA, UMAR PUR NIWA, NEAE NEHRU PARK,DHOOMANGANJ, ALLAHABAD,U.P.-211001, INDIA
1953 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1954 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1955 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1956 INDUS WELD TECH CHARITABLE TRUST NO 45/29/2, GUBBANNA INDUSTRIAL ESTATE, 6TH BLOCK, RAJAJINAGAR, BANGALORE
1957 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1958 INFORMATION TECHNOLOGY MANAGEMENT SOCIETY ITMS,NEAR PNB ABOVE DR. LAL PATHOLOGY CIVIL LINE 1ST BIJNOR
1959 INFOSOFT COMPUTER EDUCATION 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, NEAR DAY & NIGHT JN., SRIKAKULAM
1960 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1961 INFOSOL TECHNOLOGIES HEAD OFFICE:- C-25, SECTOR H, ALIGANJ LUCKNOW. UTTAR PRADESH. 226024
1962 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1963 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1964 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1965 INITIATIVE FOR SOCIAL DEVELOPMENT AND EDUCATION WELFARE SOCIETY B-311, YASHWANT SHOPPING CENTER , CARTER ROAD NO. 7 BORIVALI (EAST), MUMBAI -400066
1966 INITIATRIX TECHNOLOGIES 138 TOWER A 3RD FLOOR CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1967 INITIATRIX TECHNOLOGIES 138 3RD FLOOR TOWER A CORENTHUM CORPORATE PARK NOIDA SECTOR 62
1968 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1969 INNODUST TECHSOLUTION PRIVATE LIMITED S3/75/1,MANCHESWAR INDUSTRIAL ESTATE, RASULGAD,BHUBANESWAR,751010
1970 INNODUST TECHSOLUTION PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR,SAHIDNAGAR, BHUBANESWAR, 751007
1971 INNODUST TECHSOLUTIONS PRIVATE LIMITED PLOT NO-A/65, SECOND FLOOR, SAHIDNAGAR, BHUBANESWAR, ODISHA
1972 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED, 21-1-60, 3RD FLOOR JANDYALA VAARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA, TENALI - 522201, GURNTUR DISTRICT, ANDHRA PRADESH, INDIA
1973 INNOGEEKS GLOBAL SERVICES PRIVATE LIMITED 21-1-60,3RD FLOOR JANDYALA VARI VEEDHI, SRI SAI RESIDENTIAL SCHOOL, RAMALINGESWARA PETA,TENALI
1974 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR 21ST. CENTURY PLAZA, SECTOR 8 COMM CENTRE, NEAR ICICI BANK ROHINI, DELHI
1975 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
1976 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND. FLOOR, 21ST. CENTURY PLAZA SECTOR 8 COMM. CENTRE, NEAR ICICI BANK LTD ROHINI, DELHI-110085 INDIA
1977 INNOVA LAB INSTRUMENTS PVT LTD 201, 2ND FLOOR, 21ST. CENTURY PLAZA, SECTOR 8 COMM. CENTRE, ROHINI, DELHI
1978 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1979 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1980 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1981 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1982 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1983 INSIGHT TV NEWS NETWORK PRIVATE LIMITED 314, AKANSHA BUILDING, 2, PRESS COMPLEX, M.P. NAGAR, ZONE-1, BHOPAL
1984 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
1985 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
1986 INSTITUTE FOR GLOBAL DEVELOPMENT B-5 GREATER KAILASH ENCLAVE II, NEW DELHI
1987 INSTITUTE OF COMPUTER MANAGEMENT SCIENCE AND TECHNICAL EDUCATION RAZVI BUILDING MIRZA KAMIL HAWAL
1988 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1989 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1990 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1991 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1992 INSTITUTE OF ENVIRONMENT AND ECO DEVELOPMENT SHYAM NAGAR COLONY, MAURYAPATH, P.O.- B.V.COLLEGE, KHAJPURA, PATNA(BIHAR)
1993 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35 M.B ROAD,UDAYPUR,BELGHARIA,KOLKATA
1994 INSTITUTE OF INSTRUMENTATION AND METROLOGY 35.M.B ROAD, UDAYPUR,BELGHARIA,KOLKATA
1995 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1996 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1997 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FOLUR ABOVE UNION BANK SIRMOUR CHOUK REWA (M.P.)
1998 INSTITUTE OF SCIENCE AND PROMPT COMPUTER SYSTEM KHANNA TOWER SECOND FLOUR SIRMOUR CHOUK REWA M.P.
1999 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT HO:GI-31,ANUKAMPA-II,KALINDIPURAM PHASE II,ALLAHABAD-211011 48/9,SRK TOWER,ELGIN ROAD,CIVIL LINES ALLAHABAD-211001 U.P.
2000 INSTITUTION OF MANAGEMENT AND ENTREPRENEURSHIP DEVELOPMENT 48/9,SRK TOWER,ELGIN ROAD ,CIVIL LINES,ALLAHABAD-211001 U.P.
2001 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
2002 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
2003 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
2004 INTEGRATED DEVELOPMENT TRUST 478/13, SHAKTI NAGAR
2005 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
2006 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY, REG NO: TSR/TC/503/2014, P O PERINJANAM THRISSUR KERALA
2007 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SOCIETY OPP.GOVT UP SCHOOL PERINJANAM P O THRISSUR DIT
2008 INTEGRATED IT DEVELOPMENT SERVICE SOCIETY INTEGRATED IT DEVELOPMENT SERVICE SERVICE SOCIETY REG NO: TSR/TC/503/2014 P O PERINJANAM THRISSUR KERALA
2009 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
2010 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
2011 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
2012 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
2013 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
2014 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
2015 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
2016 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR, FRONT OF KOTAK MAHINDRA BANK; OPPOSITE METRO PILLAR NO.219; NEAR, PATEL NAGAR, WEST PATEL NAGAR, PATEL NAGAR, DELHI 110008
2017 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
2018 INTELNET IT SOLUTIONS PRIVATE LIMITED 20/1 ASHUTOSH CHOWDHURY AVENUE, 2ND FLOOR, KOLKATA, WEST BENGAL, INDIA
2019 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
2020 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
2021 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
2022 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
2023 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
2024 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
2025 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJINI DEVI EYE HOSPITAL HUMAYUN NAGAR MEDHIPATNAM TELANGANA
2026 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
2027 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET, POLUR TALUK,TIRUVANNAMALAI DISTRICT, TAMILNADU.
2028 INTERNATIONAL PARAMEDICAL AND EDUCATIONAL TRUST 71/D5,VEERAPPAN STREET,POLUR TOWN,TIRUVANNAMALAI DITRICT,TAMILNADU.
2029 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2030 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
2031 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
2032 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
2033 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
2034 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
2035 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
2036 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
2037 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
2038 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
2039 ISHA LEARNING SYSTEMS PRIVATE LIMITED 14, BHATTARAHALLI,OLD MADRAS ROAD, K R PURAM, BANGALORE
2040 ISHAN JAN SEVA SANSTHAN K-206,YASHODA NAGAR,KANPUR
2041 ISHA OUTREACH ISHA YOGA CENTER, VELLIANGIRI FOOTHILLS, ISHANA VIHAR (PO), COIMBATORE DISTRICT
2042 ISHWARDAS MEMORIAL SHIKSHA ANUSANDHAN EVAM PRASHIKSHAN SANSTHAN KHASRA NO. 1522 WARD NO. 05 NEAR PHED OFFICE LADNUN NAGAUR RAJASTHAN 341306
2043 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
2044 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
2045 ISTI EDUCATION PRIVATE LIMITED E-15, BASEMENT, LAJPAT NAGAR-I, NEW DELHI
2046 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
2047 IT LITERACY MISSION CHARITABLE SOCIETY PAMMAM COMPLEX, NEAR MUTHUMARIAMMAN TEMPLE, SATHRAM JN NEDUMANGAD, TRIVANDRUM, KERALA
2048 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
2049 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
2050 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
2051 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
2052 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
2053 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
2054 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
2055 JAAT INSTITUTE OF INFORMATION TECHNOLOGY VPO BHARATIA THANA BALDEV TEHSIL MAHAVAN DISTRICT MATHURA STATE UTTAR PRADESH PIN 281302 M NO 8755202277
2056 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
2057 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
2058 JADISH MISHRA SIKSHA PRACHAR PRASAR SAMITI JADISH MISHR SHIKSHA PRACHAR PRASAR SAMITI, SONDA(EAST), SALEMPUR ROAD, DIST- DEORIA, CITY-DEORIA, UP
2059 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE;26GANESH CHANDRA AVENUE KOLKATA MAILING ADDRESS;BUDGE BUDGE INSTITUTE OF TECHNOLOGY BUDGE BUDGE KOLKATA
2060 JAGANNATH GUPTA FAMILY TRUST REGD.OFFICE :26,GANESH CHANDRA AVENUE,KOLKATA 700013 MAILING ADDRESS: BUDGE BUDGE INSTITUTE OF TECHNOLOGY, BUDGE BUDGE, KOLKATA
2061 JAGANNATH GUPTA FAMILY TRUST NISCHINTAPUR, BUDGE BUDGE
2062 JAGAN RAJ PROFESSIONAL STUDIES PVT LTD 223,PRATAP NAGAR HOUSING SOCIETY,VASHISHATH MARG,VAISHALI NAGAR,JAIPUR,RAJ.
2063 JAGDAMBA TECHNICAL SOCIAL ORGANISATION AT & PO BHAMBLA TEH SARKAGHAT DISTT MANDI HP
2064 JAGO BISWA VILL.- JHORHAT, P.O.- BANIPUR, P.S.- SANKRAIL, DIST.- HOWRAH, WEST BENGAL
2065 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
2066 JAGO GAON VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR
2067 JAGO GAON REGISTERED OFFICE-47A,B2,SEWAK PARK,UTTAM NAGAR,NEW DELHI FIELD OFFICE-VILLAGE-DAMODERPUR,POST-PASOPUR,DISTRICT-BEGUSARAI,BIHAR, ADMIN OFFICE-HOUSE NO- A2/7/31,PLOT NO-23,PH-V, AYA NAGAR EXT,NEW DELHI-110047
2068 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
2069 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2070 JAGRITI YUVA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2071 JAGRITI YUWA MISSION WARD NO.- 8, NEW POKHRA, JAGDISHPUR THANA
2072 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2073 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2074 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2075 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA MADHYA PRADESH
2076 JAGRUK MAHILA HASTKALA BALVIKAS SAMITI NOORI MANZIL H NO 11/170 M.L.B. SCHOOL BADA BAZAR, VIDISHA
2077 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
2078 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
2079 JAGRUTI SAMAJIK SANSTHA FLAT NO, 26 DEVAKINANDAN APARTMENT, RAIKAR NAGAR , LANE NO 22, DHAYARI, PUNE 41
2080 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD
2081 JAHANGIRABAD EDUCATIONAL TRUST JAHANGIRABAD EDUCATIONAL TRUST GROUP OF INSTITUTIONS, JAHANGIRABAD FORT, JAHANGIRABAD, BARABANKI
2082 JAHNAVI TECHNICAL EDUCATIONAL SOCIETY JAHNAVI INSTITUTE OF MULTIMEDIA TECHNOLOGY C/O JAHNAVI DIGITAL STUDIO, BRIDGE ROAD, NEAR 7 ROAD JUNCTION, OPP : SBI ATM, SRIKAKULAM-532001 ANDHRA PRADESH
2083 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
2084 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
2085 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1, GOMTINAGAR
2086 JAI JAGAT EDUCATIONAL AND WELFARE SOCIETY DIGDIGA, VISHAL KHAND-1 GOMTI NAGAR, LUCKNOW, UP
2087 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
2088 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
2089 JAIN COMPUTER ACADEMY SAMITI WARD NO 01 MAHATMA GANDHI WARD BANDA BELAI
2090 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184,A NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208016
2091 JAIN HOSPITAL AND RESEARCH CENTRE PVT LTD 184 A.NO.335,MANGLAVIHAR II,KANPUR,UTTAR PRADESH,INDIA-208015
2092 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR
2093 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
2094 JAISHREEHARI JANKALYAN AVAM SHIKSHA PRASAR SMITI NEAR BY ATTA CHAKKI ,H.NO 1,BLOCK-A,SHASTRI NAGAR BHIND ,MADHYAPRADESH
2095 JAI SIKSHAN SAMITY WARD NO. 21 BHALESAR ROAD, MAHASAMUND
2096 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2097 JALPA EDUCATIONAL TRUST 128/9 OLD COLLEGE ROAD MANDI HP
2098 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
2099 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
2100 JANAMBHUMI PRAGATI SAMAJ VILL SHASTRINAGAR PO BALADMARI PS AND DISTRICT GOALPARA
2101 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
2102 JANASNEHI SOCIAL WELFARE SOCIETY SHIGGAON JANASNEHI SOCIAL WELFARE SOCIETY BVK PLAZA NEAR JMFC COURT COMPLEX, MAIN ROAD HANGAL-581104
2103 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRATI PLAZA ,JAGRATI VIHAR NEAR HEENA TRAVELS,MEERUT
2104 JAN CHETNA YUVA CLUB 118/6 3RD FLOOR JAGRITI VIHAR OPP KALEVA RESTAURANT JAGRITI VIHAR NEAR MEDICAL COLLEGE MEERUT
2105 JAN HEAVY DRIVING INSTITUTE 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2106 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
2107 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2108 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
2109 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
2110 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
2111 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
2112 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
2113 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
2114 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
2115 JAN KALYAN SAMITI JAIN
2116 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
2117 JAN KALYAN SHIKSHA SAMITI A-1413/3
2118 JAN KALYAN SOCIETY DEVIKI BHWAN NEAR DURGA MANDIR WARD NO. 7, SIWANI MANDI, DISTT. BHIWANI (HARYANA)
2119 JAN KAYAN AND SOCIETY BHNJUIEW KNEWIO JKDESH OKI
2120 JANKI DEVI EDUCATIONAL WELFARE SOCIETY 74/35, RAJPUR ROAD, OPP. HOTEL MADHUBAN DEHRAUN
2121 JAN MANAS VIKAS SANSTHAN JAN MANAS VIKAS SANSTHAN 8/29 SEC-8 INDIRA NAGAR LUCKNOW
2122 JAN MANGAL SANSTHAN JAN MANGAL SANSTHAN EKTA COLONEY, NEW PUMP HOUSE, NAGPUR ROAD, CHANDANGAON CHHINDWARA
2123 JANMAT VIKASH PRAGTI PATH SAMITI BEHIND OF SBI BANK A.B ROAD KOLARAS SHIVPURI MADHYA PRDESH
2124 JAN SAHARA SARAI VILL + PO- SARAI, PS - MANER, DIST - PATNA
2125 JAN SAHARA SARAI VILL + PO - SARAI,PS - MANER, DIST- PATNA
2126 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
2127 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
2128 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
2129 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
2130 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
2131 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
2132 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2133 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
2134 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
2135 JAN SHIKSHAN SANSTHAN DATIA RAWAT JI KA PATHA BADA BAZAR DATIYA MP
2136 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM NORTH PARAVOOR ERNAKULAM DISTRICT
2137 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
2138 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
2139 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
2140 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
2141 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
2142 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
2143 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
2144 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
2145 JATIYA COMPUTER SAKSHARTA MISSION 6, EGAROR PALLY,P.O- NOAPARA.P.S-BARANAGORE, DIST.- NORTH 24 PARGANAS, KOLKATA-700090
2146 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
2147 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2148 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
2149 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
2150 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
2151 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
2152 JAY GANESH SAMAJIK BHUUDESHIY SANSTHA KURDU HINDAVI SIKSHAN SAMUHA ARNDA ROAD KURDUWADI
2153 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
2154 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
2155 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
2156 JBM SWAMY TRUST NO:2, GROUND FLOOR, G C TOWERS, DURAISAMY ROAD, T NAGAR, CHENNAI, TAMILNADU
2157 JB PLASTOCHEM PRIVATE LIMITED JAIN FOOD COMPOUND, GUT NO. 43/B/2, N. H. NO. 06, SAVKHEDA (BK.)
2158 J C KALA EDUCATIONAL AND CULTURAL TRUST J C KALA EDUCATIONAL AND CULTURAL TRUST 15/1A SECTOR A 13TH A MAIN, YELAHANKA NEW TOWN BANGALORE
2159 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2160 JCKRC SPA DESTINATION PVT LTD JCKRC SPA DESTINATION, NATRAJ C.H.S.,PLOT NO.15, SECTOR 4, SANPADA (E), NAVI MUMBAI
2161 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2162 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE,JAMIATH HILL, VELLIMADUKUNNU,KOZHIKODE,KERALA
2163 JDT ISLAM ORPHANAGE COMITTEE JDT ISLAM ORPHANAGE COMMITTEE JAMAITH HILL, VELLIMADUKUNNU, KOZHIKODE.
2164 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
2165 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2166 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT. PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH. KELAPUR DIST. YAVATMAL
2167 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
2168 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
2169 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA
2170 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
2171 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
2172 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
2173 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
2174 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
2175 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
2176 JEEVANTI SEWA SAMITI 9, CIVIL LINES VIDISHA
2177 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
2178 JFJGF 9ODPJ
2179 JHANSI KRISHI EVAM PASHUPALAN PRASHIKSHAN SANSTHAN 1182,BABULAL KARKHANAKE PAS,GWALIOR ROAD,CIVIL LINE,JHANSI
2180 JHARKHAND SEVA MANDAL RAMNAGAR, RAM MANDIR GALI, OPPOSITE - RAMNAGAR PETROL PUMP, PO - KADMA, DIST - HAZARIBAG(JHARKHAND)
2181 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
2182 JINDAL INFRA SOLUTION LIMITED 214, AMBA TOWER DC CHOWK SEC-9 ROHINI
2183 JINDAL INFRA SOLUTIONS LIMITED 214,2ND FLOOR AMBA TOWER D.C. CHOWK SEC-9 ROHINI NEW DELHI
2184 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
2185 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
2186 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
2187 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
2188 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
2189 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI BANDIPORA JAMMU AND KASHMIR
2190 JK EDUCATIONAL SOCIETY AND SOCIAL WELFARE TRUST 2ND FLOOR JK BANK BUILDING SUMBAL SONAWARI
2191 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
2192 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
2193 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
2194 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
2195 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2196 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
2197 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
2198 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
2199 JOSEPH SRI HARSHA AND MARY INDRAJA EDUCATIONAL SOCIETY PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD.
2200 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2201 JOUDAH INFO LINGO TECH PRIVATE LIMITED JILT , 12-2-825/7, BESIDE SARVI HOTEL ANSAR COMPLEX, 2ND FLOOR MEHDIPATNAM, HYDERABAD
2202 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2203 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
2204 JP SAJITHA TECHNICAL SOLUITIONS PRIVATE LIMITED 175-3,4( I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM (POST &TALUK) VILLUPURAM(DIST) TAMIL NADU
2205 JP SAJITHA TECHNICAL SOLUTIONS PRIVATE LIMITED 175-3,4(I,J) MGR STATUE BACK SIDE KALLAI MAIN ROAD,SANKARAPURAM VILLUPURAM (DIST),TAMIL NADU
2206 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
2207 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2208 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
2209 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
2210 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
2211 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
2212 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
2213 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
2214 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
2215 JUPITER CRAFTS PLOT NO 55 – A, E.P.I.P., PHASE I, JHARMAJRI,BADDI,DISTT-SOLAN, HIMACHAL PRADESH
2216 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
2217 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
2218 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
2219 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2220 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2221 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2222 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2223 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2224 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
2225 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
2226 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING, ZODIN SQUARE
2227 KABOD COMPUTER INSTITUTE RZ ANNEX BUILDING 3RD FLOOR, ZODIN SQUARE
2228 KABOD COMPUTER INSTITUTE ZODIN SQUARE, ABOVE CITY BUS STAND, AIZAWL MIZORAM
2229 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
2230 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
2231 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
2232 KAIROS COMPOSITE SERVICES PRIVATE LIMITED DEVARYAMAGAL, MEDCHAL ROAD, SECUNDERABAD
2233 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2234 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2235 KAI VANJIBABA GRAMIN VIKAS MANDAL CHALISGAON UMANGA, NEAR BHUSHAN MANGAL KARYALAYA, BHADGAON ROAD, CHALISGAON. DIST. JALGAON
2236 KAKUMANI EDUCATIONAL SOCIETY PARAMESWARA MANGALAM,PUTTUR,CHITTOOR(DIST), ANDHRA PRADESH
2237 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATARAYAPALLAI STREET SHOLINGHUR
2238 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62,VENKATRAYPILLAI STREET SHOLINGHUR
2239 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2240 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAAYAPILLAI STREET SHOLINGHUR
2241 KALAI BHARATHI ECONOMIC DEVELOPMENT TRUST NO.62, VENKATRAYAPILLAI STREET SHOLINGHUR
2242 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
2243 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
2244 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
2245 KALPATARU GRAMODYOG SAMITI JUNIOR HIG 9 KEHKASHA APT KOH-E-FIZA BHOPAL
2246 KALPATARU GRAMODYOG SAMITI 67, OM SHIVE NAGAR LAL GHATI BHOPAL
2247 KALPNATH RAI MAHAVIDYALAYA SAMITI VILL - LAXMIPUR BAJAR, POST - BHATNI, DIST - DEORIA, STATE - UTTAR PRADESH
2248 KALPTARU EDUCATION SOCIETY KANTI ENCLAVE SAMITI DREAM VALLEY COLLEGE , NEAR RAILWAY SPRING FACTORY NH-10 SITHOLI GWALIOR (M.P.)
2249 KALRAS EDUCATIONAL TRUST KALRA COLLEGE OLD HOSPITAL ROAD UDHAMPUR
2250 KALRAS EDUCATIONAL TRUST KALRA COLLAGE OLD HOSPITAL ROAD UDHAMPUR
2251 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
2252 KALVI INSTITUTE PRIVATE LIMITED NO.9-1-66, DOUBLE AGRAHARAM STREET, SHOLAVANDAN, MADURAI, TAMIL NADU - 625214
2253 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2254 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
2255 KALYANI WELFARE SOCIETY WARD NO. 21, PANJABI GURUDWARA ROAD, GHARAULA MOHALLA, SHAHDOL
2256 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
2257 KALYANSUNDARAM WELFARE AND EDUCATIONAL TRUST G01, VASUDEO CITY,RAJENDRA PATH, BENI BABU KA BAGAICHA,NEAR ASHIYANA HYUNDAI SHOWROOM, PATNA BIHAR
2258 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
2259 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
2260 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
2261 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2262 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
2263 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
2264 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
2265 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SANVI TOWERS, ROAD NO 36, AYYEPPA SOCIETY MADHAPUR HYDERABAD
2266 KAMAKSHI EDUCATION SOCIETY PLOT NO 705,AYYEPPA SOCIETY, SANVI TOWERS HYDERBADA
2267 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
2268 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
2269 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED HOUSE NO-15,PLOT NO-1149,GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA
2270 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
2271 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
2272 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
2273 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
2274 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
2275 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GHALIB GHS, PITAMPURA NEW DELHI
2276 KAMYABVYA TECH SERVICES PRIVATE LIMITED 282 GROUND FLOOR GHALIB APARTMENT PITAMPURA NEW DELHI
2277 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2278 KANCHAN INDIA LIMITED AN ISO 9001:2008, 14001:2004 CERTIFIED COMPANY) (SPINNING DIVISION) 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2279 KANCHAN INDIA LIMITED 19-20 TEXTILE MARKET PUR ROAD BHILWARA RAJASTHAN PIN CODE 311001
2280 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2281 KANCHAN INDIA LIMITED 19-20, BHILWARA TEXTILE MARKET, PUR ROAD, BHILWARA-311001 (RAJ.)
2282 KANCHAN SEVA ASHRAM REGISTERED OFFICE - VILL- KESHOPUR, VIA- CHANDANPATTI, SAKRA, DIST -MUZAFFARPUR. HEAD OFFICE - NORTH OF ORIENT CLUB, AMGOLA, POST- RAMNA, DIST- MUZAFFARPUR
2283 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
2284 KANHA BHARAT VIKASH EVAM JANKALYAN SAMITI HAVELI ROAD BEHIND SHAKTI CINEMA
2285 KANPUR SUBHASH SHIKSHA SAMITI 127/470, W-1, SAKET NAGAR, KANPUR
2286 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
2287 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
2288 KARCHER CLEANING SYSTEMS PRIVATE LIMITED D-120, SEC-63, NOIDA, GHAZIABAD, UTTAR PRADESH
2289 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
2290 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
2291 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
2292 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
2293 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
2294 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
2295 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2296 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
2297 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
2298 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
2299 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
2300 KARUNYA EDUCATIONAL AND RESEARCH TRUST CENTRE FOR SOCIAL OUTREACH KARUNYA UNIVERSITY KARUNYA NAGAR COIMBATORE TAMIL NADU 641114
2301 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
2302 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
2303 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
2304 KASHA GOUD EDUCATIONAL SOCIETY VINAYAKA NAGAR NIZAMABAD
2305 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
2306 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
2307 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
2308 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
2309 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
2310 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
2311 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
2312 KATYANI ENERGY SOLUTION PRIVATE LIMITED HEAD OFFICE: A-86, 3RD FLOOR, MCD NO. – 944, ARJUN NAGAR, KOTLA MUBARAKPUR, NEW DELHI
2313 KATYANI ENERGY SOLUTION PVT LTD WZ 490/A BRITANNIA CHOW SRI NAGAR NEW DELHI
2314 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2315 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HRAYANA, 122001
2316 KAUSHAL BHARAT VIKAS KENDRA 1674/ 31, 1ST AND 2ND FLOOR, PADAM SINGH JAIN COMPLEX, NEAR DAULTABAD FLY OVER, NEAR RAILWAY ROAD , GURGAON , HARYANA, 122001
2317 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2318 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2319 KAUSHALYA DEVI EDUCATIONAL TRUST 71 ASHOK COLONY PILIBHIT
2320 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
2321 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
2322 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
2323 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
2324 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
2325 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
2326 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
2327 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
2328 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
2329 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
2330 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
2331 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
2332 KAY CEE CONSULTANCY COUNCIL KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2333 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2334 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2335 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2336 KAY CEE CONSULTANCY SERVICES PRIVATE LIMITED KRISHNA COMPLEX 52C, HASANPUR VILLAGE, PATPARGANJ EAST DELHI 110092 NEAR. MAX HOSPITAL
2337 KAYZEY SOCIETY MAWNGAP MAWSMAI
2338 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
2339 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
2340 KENDRIYA BHANDER B-1 SHYAMALI HOUSING ESTATE, SALT LAKE CITY, KOLKTA
2341 KERALA HOLY CROSS SISTERS SOCIETY HOLY CROSS INSTITUTE THRIKKAKARA P.O KOCHI, ERNAKULAM DISTRICT, KERALA
2342 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
2343 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
2344 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR,
2345 KESHAB UMA CHARITABLE TRUST VILL+P.O-GANGADHARPUR, P.S-PANCHLA, DIST-HOWRAH
2346 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
2347 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
2348 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
2349 KGVK NEORI VIKAS RUKKA RANCHI
2350 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
2351 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
2352 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
2353 KHAN INSTITUTE OF INFORMATION AND COMPUTER TECHNOLOGIES LLP KIICT BUILDING NEAR REST HOUSE, INFRONT OF WRD OFFICE MAIN ROAD PAWANI BALODABAZAAR,RAIPUR-493338
2354 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
2355 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
2356 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
2357 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
2358 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
2359 KHUSHI SHIKSHAN AND PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR HARJINDER NAGAR AHIRVA 208007
2360 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2361 KHUSI SHIKSHAN PRASHIKSHAN SANSTHAN 32 B 274 SADANAND NAGAR AHIRWAN HARJINDER NAGAR KANPUR NAGAR
2362 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
2363 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
2364 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2365 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
2366 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
2367 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
2368 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
2369 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
2370 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
2371 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
2372 KISAN SEWA SANSTHAN MAHESH BHAWAN, AWAS VIKAS COLONY, KATRA, BASTI U.P.-272001
2373 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
2374 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
2375 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
2376 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
2377 KITES SKILLS PRIVATE LIMITED 6-122/2, ABOVE LIC OFFICE, VISAKHA ROAD, PENDURTHI, VISAKHAPATNAM
2378 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
2379 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
2380 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
2381 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
2382 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
2383 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
2384 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
2385 K NADIMUTHU MEMORIAL EDUCATIONAL TRUST BHARATH COLLEGE OF SCIENCE AND MANAGEMENT PREMISES, BHARATH AVENUE, TRICHY ROAD, THANJAVUR-613005
2386 K N BIOSCIENCES INDIA PRIVATE LIMITED PLOT NO 28, USHODAYA ENCLAVE, MADINAGUDA MIYAPUR HYDERABAD
2387 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2388 KNOWLEDGEHUT SOLUTIONS PVT LTD NO.10, 14TH MAIN ROAD SECTOR 5, HSR LAYOUT
2389 KNOWLEDGEHUT SOLUTIONS PVT LTD #10, RELIABLE PLAZA, 5TH SECTOR, 14TH MAIN ROAD, HSR LAYOUT, BANGALORE
2390 KNOWLEDGE INFINITY EDUCATIONAL SOCIETY IDSMT COMPLEX, HALL NO 3, GHANTAGHAR, NIHARIKA, KORBA
2391 KOKAN BHUMI PRATISHTHAN 25 & 26, AJAY SHOPPING CENTRE, T H K MARG, MATUNGA ROAD (WEST), MUMBAI
2392 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
2393 KOLKATA VOCATIONAL ACADEMY PULIN AVENUE, P.O- RAJBARI, KOLKATA- 700081
2394 KOMAL CONSTRACTION COMPANY MAIN BAZAR ROAD, DANTA, TEHSIL DANTARAMGARH,DIST. SIKAR RAJSTHAN PIN 332701
2395 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
2396 KORAZON TECHNOLOGIES PRIVATE LIMITED KORAZON TECHNOLOGIES PVT. LTD. IMRAN COMPLEX 1ST FLOOR OPPOSITE WOODLAND RESTAURANT,ULUBARI ,G.S ROAD GWAHATI.
2397 KOSHISH FOUNDATION S-2 LIMBUWALA COMPLEX GPO ROAD ANAND
2398 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
2399 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
2400 KRISHNA EDUCATIONAL TRUST VILLAGE BANSEWALA ,PO BILASPUR,DISTT. YAMUNANAGAR,HARYANA
2401 KRISHNA EDUCATIONAL TRUST VILL KAMALPUR POST CHHUTMALPUR
2402 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR -10 BHILAI, DURG DIST
2403 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2404 KRISHNA EDUCATION SOCIETY 234 GENERAL MARKET SECTOR 10 BHILAI DURG DIST
2405 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
2406 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
2407 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
2408 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
2409 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
2410 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
2411 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
2412 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
2413 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
2414 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
2415 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
2416 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
2417 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
2418 KSHITIJ ACADEMIC SOCIETY 1, NAGAR MARG CHOUBE COLONY,RAIPUR
2419 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
2420 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
2421 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
2422 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
2423 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
2424 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
2425 KUMBAKUDI PANCHAYAT LEVEL FEDERATION NO. 2/142 MGR NAGAR ANNA NAGAR POST TRICHY - 620026
2426 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
2427 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A 1/28 JANAKPURI, FLAT NO:2, MAIN NAJAFGARH ROAD, NEW DELHI - 110058
2428 KUNDAN LAL GOVIND RAM EDUCATIONAL SOCIETY A1/28 JANAK PURI, MAIN NAJAFGARH ROAD, OPPOSITE METRO PILLAR NO. - 626, NEW DELHI - 110058
2429 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
2430 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
2431 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2432 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
2433 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
2434 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
2435 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD, PARGANA DIST- SHIVPURI (MP)
2436 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD ,PARGANA, DISTT SHIVPURI,
2437 KUSHWAH SHIKSHA PRASAR SAMITI NEW COLONY BAIRAD PARGANA
2438 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS IIT BOMBAY POWAI
2439 KWATT SOLUTIONS PRIVATE LIMITED 151 POWAI PLAZA HIRANANDANI GARDENS POWAI
2440 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2441 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
2442 LAHAR ACADEMY OF INFORMATION TECHNOLOGY PVT LIMITED 317,CHANDRA SADHU PARA,NEAR FOREST DEPARTMENT,A.A.ROAD,CHAMPAKNAGAR,JIRANIA,AGARTALA,WEST TRIPURA,INDIA-799045
2443 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
2444 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
2445 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
2446 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
2447 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
2448 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
2449 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
2450 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
2451 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
2452 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
2453 LAL BAHADUR SHIKSHA SAMITI KATKAR TEHSIL HINDAUN, DIST. KARAULI, RAJSTHAN PINCODE 322234
2454 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
2455 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
2456 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UP, INDIA
2457 LALJI MEMORIAL SANSTHAN 5/77, VIKAS NAGAR, LUCKNOW, UTTAR PRADESH
2458 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
2459 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
2460 LATE APPASAHEB SHRAWAN CHINDHU WANI GRAMIN SEVABHAVI SANSTHA DHULE 14 AYODHYA NAGAR ,NEAR MANGALMURTI COLONY ,BEHAND SHREERAM MANDIR,WEST SIDE OF G.T.P STOP DEOPUR DHULE
2461 LATE LALA BARU MAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA
2462 LATE LALA BARUMAL GOYAL SOCIAL WELFARE AND EDUCATIONAL SOCIETY NEAR RAILWAY CROSSING BAJRANG MARKET SIRSA CHANDIGARH ROAD UKLANA MANDI HISAR
2463 LATELALABARUMALGOYALSOCIALWELFAREEDUCATIONALSOCIETY NEAR RAILWAY CROSSING, NH-65, BAJRANG MARKET, UKLANA MANDI, HISAR, HARYANA-125113
2464 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2465 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
2466 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
2467 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
2468 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
2469 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2470 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
2471 LBS LNS HBJHCDJNSJBSBCANM
2472 LC EDUCATION SOCIETY 9-A, GALI NO. 12, JAWAHAR NAGAR, HISAR
2473 LC EDUCATION SOCIETY 9-A, GALI NO.12, JAWAHAR NAGAR, HISAR
2474 LC EDUCATION SOCIETY #9-A, STREET NO 12 , JAWAHAR NAGAR , HISAR
2475 LC EDUCATION SOCIETY 9-A, GALI NO 12, JAWAHAR NAGAR, HISAR - HARYANA
2476 LCS INFOTECH E-26 BORAL MAIN ROAD, ATABAGAN, P.O. GARIA,
2477 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
2478 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
2479 LEAF TRUST 385/15,JS PLAZA,SAB MAIN ROAD,ATHANI ,ANTHIYUR TALUKA
2480 LEAF TRUST 103A,KARUPPUSAMY KOVIL ST, NALLIGOUNDANPUDUR, KOOTHAMPOONDI POST, ANTHIYUR TALUKA,ERODE DT,TAMILNADU
2481 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
2482 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
2483 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
2484 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
2485 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
2486 LEED SOCIAL WELFARE SOCIETY E-40, MANIPURAM SOCIETY, BITTAN MARKET, BHOPAL.
2487 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
2488 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
2489 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
2490 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
2491 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
2492 LIFE CIRCLE HEALTH SERVICES PRIVATE LIMITED T HUB, IIIT HYDERABAD CAMPUS, GACHIBOWLI
2493 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
2494 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
2495 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
2496 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD.
2497 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
2498 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
2499 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
2500 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
2501 LIGHTNING INDIA FOUNDATION FOR EXCELLENCE GIRDHARI NAGAR, JAROTHI ROAD NEAR BHARAT GAS GODOWN HAPUR UTTAR PRADESH
2502 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
2503 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2504 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
2505 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
2506 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
2507 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2508 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
2509 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
2510 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
2511 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
2512 LITCHITREE SKILLS AND SOLUTIONS PVT LTD MIG(S)-1,PRAGATI ENCLAVE,NEAR ST.XAVIAR HIGH SCHOOL,BHUBANESWAR
2513 LITERACY HOUSE ANDHRA MAHILA SABHA LITERACY HOUSE, DDMS ACADEMIC CAMPUS, OU ROAD, HYDERABAD. PH: 27098406, 27096464.
2514 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
2515 LIVELIHUD PROMOTION SOCIETY 302 RAJKUMAR GUPTA SALIMPUR AHRA LANE NO 2 KADAMKUAN PATNA BIHAR
2516 LOGICPRO CONSULTING PRIVATE LIMITED H.O: 308, U-74, 3RD FLOOR, TIRUPATI COMPLEX SHAKARPUR
2517 LOGISTICS SECTOR SKILL COUNCIL LOGISTICS SKILL COUNCIL IIT MADRAS RESEARCH PARK, UNIT–E, 10TH FLOOR KANAGAM ROAD, TARAMANI
2518 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
2519 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
2520 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA
2521 LOK PANCHAYAT LOKPANCHAYAT P. B. NO.36 8, TULSI COMPLEX, KURAN ROAD, SANGAMNER, DIST. AHMEDNAGAR, MAHARASHTRA.
2522 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
2523 LOK SEVA KENDRA VILL - KARPI, KARPI SHERPUR MAIN ROAD, PO.- KARPI, DIST.- ARWAL, BIHAR
2524 LOK SEVA KENDRA VILL KARPI, SHERPUR ROAD,DIST.- ARWAL, BIHAR
2525 LOK SEVA KENDRA VILL - KARPI SHERPUR MAIN ROAD, ARWAL, BIHAR.
2526 LOMAS ELECTRICAL ENGINEERING PRIVATE LIMITED R-14/91, 1ST FLOOR, SECTOR-14, RAJ NAGAR,, GHAZIABAD
2527 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS ROAD BUS STAND ROBERTSGANJ
2528 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO- 7 ARYA NAGAR ROBERTSGANJ SONEBHADRA
2529 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE W NO-7 NEAR PNB BANK ROADWAYS BUS STAN ROAD ROBERTSGANJ
2530 LORD BUDDHA INFORMATION TECHNOLOGY INSTITUTE NEAR PNB BANK ROADWAYS BUS STAND ROAD ROBERTSGANJ SONEBHADRA
2531 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
2532 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
2533 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
2534 LOYAL ENVIRONMENTAL AWARENESS AND PROTECTION SOCIETY 115,116,PUDUCHERRY IT PARK, PEC CAMPUS,PILLAICHAVADY,ECR ROAD, PUDUCHERRY -605014
2535 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
2536 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
2537 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
2538 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
2539 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
2540 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
2541 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
2542 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
2543 LUIT VALLEY ENGINEERING PRIVATE LIMITED H. NO. 51 & 52, M. E. ROAD, BYE LANE 01, PALTAN BAZAR, GUWAHATI 781008 ASSAM, INDIA
2544 MAA AHILYA BAI HOLKAR GRAMODYOG SEWA SANSTHAN MAHARANA PRATAP NAGAR GUMNAWARA PICHHOR ROAD JHANSI
2545 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2546 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2547 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
2548 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
2549 MAA JAGDAMBA EDUCATIONSAL SOCIETY M J COLLEGE, JUNWANI KOHKA
2550 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2551 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
2552 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
2553 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
2554 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
2555 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
2556 MAA PARMBA BHAGAWATI DEVI SEWA SAMITI GRAM JAKHANIA POST JAKHANIA DISTRICT GHAZIPUR UP
2557 MAA PURNAGIRI JAN KALYAN SAMITI H.NO.-3 VANGOAN NITHOLI ROAD (NEAR OM SWEET BHANDHAR) ETAH U.P
2558 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
2559 MAA SARADA KRISHI VIGYAN MANDIR NAZARGANJ,NEAR-3 NO PUMP HOUSE PO-MIDNAPORE
2560 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
2561 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
2562 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
2563 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2564 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
2565 MAA UMA ELECTRONIC TRAINING INSTITUTE HIG-102,PUSHPUM APPARTMENT, NEAR BHARAT TALKIES BHOPAL M.P.
2566 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
2567 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
2568 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
2569 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
2570 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
2571 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST CUDDALORE
2572 MADHAR NALA THONDU NIRUVANAM NO.3, RAJAVEL NAGAR, PADHIRIKUPPAM & POST, CUDDALORE.
2573 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
2574 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
2575 MAESTROS TECHNICAL SERVICES PRIVATE LIMITED STPI CAMPUS, GROUND FLOOR, OLD BUILDING ,PATLIPUTRA PATNA
2576 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF. EAST STREET, PUNE
2577 MAGARPATTA CLUBS AND RESORTS PRIVATE LIMITED MEGASPACE, 13, SHOLAPUR BAZAR ROAD, OFF EAST STREET, PUNE
2578 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2579 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
2580 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
2581 MAGNUM SUPER DISTRIBUTORS INDIA PRIVATE LIMITED KALANIKETAN - I, VAISHALI NAGAR, KOTRA SULTANABAD, BHOPAL
2582 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
2583 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
2584 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
2585 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2586 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
2587 MAHALUXMI BUILDTECH CONSORTIUM PRIVATE LIMITED C-1 AND C-2, BASEMENT MAHALUXMI METRO TOWER SECTOR-4 VAISHALI GHAZIABAD
2588 MAHALUXMI BUILDTECH LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2589 MAHALUXMI INFRAHOME PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
2590 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP SB 9,10,11 THIRD FLOOR MANSAROVAR COMPLEX , BHOPAL
2591 MAHALWALA INTERNATIONAL EDUCARE SERVICES LLP BEHLOT BYPASS ROAD INFRONT OF DEHAT THANA GANJ BASODA VIDISHA
2592 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
2593 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
2594 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY GHAZIABAD, U.P.
2595 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
2596 MAHARAJA AGRASEN PUBLIC SCHOOL AVOM SHIKSHA SAMITI SHUBHASH PARK-2, SHANI BAZAR ROAD, KHORA COLONY, GHAZIABAD, U.P.
2597 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
2598 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
2599 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
2600 MAHARASHATRA INDUSTRIAL TRAINING CENTER KOLHAPUR PATIL COMPELX 3RD FOOR, NEAR BHAGYAREKHA TOKIES ICHALKARNJI TAL- HATKANGALE DIST KOLHAPUR
2601 MAHARASHTRA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT A-38, M.I.D.C. RAILWAY STATION AREA, AURANGABAD
2602 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
2603 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
2604 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER 1338/28 GUDLE HIGHT TORANA NAGAR KOLHAPUR
2605 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
2606 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2607 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2608 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
2609 MAHARASHTRA VYAVSAY PRASHIKSHAN MANDAL 740,'E' WARD, SHAHUPURI 3RD LANE KOLHAPUR 416001
2610 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
2611 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
2612 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
2613 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
2614 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
2615 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
2616 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA NIVAS,SANATHANAM WARD,ALAPPUZHA.
2617 MAHATMA GANDHI TECHNICAL EDUCATION SOCIETY KAVITHA ITI BUILDINGS,SANATHANAM WARD,WEST OF YMCA,KERALA,ALAPPUZHA.
2618 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
2619 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
2620 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2621 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
2622 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
2623 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2624 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
2625 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
2626 MAHENDRANATH EDUCATIONAL AND SOCIAL WELFARE ASSOCIATION VILL+PO-PRATAPDIGHI, PS-PATASHPUR, DIST-PURBA MEDINIPUR
2627 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
2628 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
2629 MAHILA AVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2630 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
2631 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2632 MAHILA EVAM BAL VIKAS SAMITI C-173-C BLOCK,NEAR AZZD MARKET,IDIRA NAGAR
2633 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
2634 MAHILA MANDAL BARMER AGOR MAHILA MANDAL BARMER AGOR NEAR POWER HOUSE ROAD INDRA COLONY
2635 MAHILA UTTHAN SANSTHAN AHMAD NAGAR NEAR CHANDNA DISTT. BARABANKI
2636 MAHIMA CAREER INSTITUTE C-145, SECTOR-J ALIGANJ LUCKNOW
2637 MAHIMA CAREER INSTITUTE C-145,SECTOR-J, ALIGANJ DIST- LUCKNOW
2638 MAHIMA FIBERS PVT LTD UNIT ASHOK FINESPUN KHASARA NO. 518/1, BHILGAON KASRAWAD DIST. KHARGOAN MP
2639 MAHIMA FIBRES PVT LTD 406, CORPORATE HOUSE, 4TH FLOOR 169 R.N.T. MARG INDORE MP
2640 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
2641 MAHISHADAL RAJ COLLEGE NAAC ACCREDITED GRADE A COLLEGE MAHISHADAL RAJ COLLEGE, POST OFFICE: MAHISHADAL, DISTRICT: PURBAMEDINIPUR, PIN: 721628, WEST BENGAL.
2642 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
2643 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
2644 MALABAR AGGREGATES PRIVATE LIMITED MALABAR AGGREGATES PRIVATE LIMITED, OZHKUR, KONDOTTY, MALAPPURAM DT., KERALA.
2645 MALABAR EDUCATIONAL SOCIETY MALABAR EDUCATIONAL SOCIETY OPP.GRIFI SUPER MARKET EDODI VATAKARA KOZHIKODE KERALA 673101
2646 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
2647 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
2648 MALDA EDUCATION GUIDE SOCIETY VILL+PO- KORIALI STREET NAME- MAIN ROAD PS- HARISHCHANDRA PUR,
2649 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
2650 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
2651 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2652 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
2653 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
2654 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2655 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
2656 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
2657 MAMTA PARADISE PRIVATE LIMITED BHAGWATI NAGAR NIWARU ROAD JHOTWARA JAIPUR
2658 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
2659 MANAH GRAMIN EVAM SAMAJ SEVA SAMITI NEAR JANPAD PANCHYAT BORODIPA PUSSORE
2660 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
2661 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2662 MA NA SHRI BABANRAO PACHPUTE VICHARDHARA TRUST A/P: KASHTI, TAL: SHRIGONDA, DIST: AHMEDNAGAR
2663 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
2664 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
2665 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
2666 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
2667 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2668 MANAV KALYAN TRUST 427, KALASAGR SHOPPING MALL, 4TH FLOOR, OPP SAI BABA TEMPLE, NR SATADHAR CROSS ROAD, GHATLODIA, AHMEDABAD
2669 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
2670 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
2671 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
2672 MANAV VIKAS SEWA SANGH 1 SUDAMA PARK GAS RAHAT WORKSHED GOVIND GARDEN BHOPAL
2673 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
2674 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
2675 MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, UDAYAVANI ROAD, MANIPAL
2676 MANIPAL MEDIA NETWORK LIMITED MANIPAL MEDIA NETWORK LIMITED UDAYAVANI BUILDING, TILE FACTORY ROAD, UDAYAVANI ROAD, MANIPAL
2677 MAN MANAGEMENT SERVICES PERVITED LIMITED MAN MANAGEMENT SERVICES PVT. LTD.,PLOT NO-4,SECTOR NO.6,SANPADA, NAVI MUMBAI,MAHARASHTRA.
2678 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
2679 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
2680 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
2681 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
2682 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V - EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2683 MANOJ VAIBHAV GEMS N JEWELLERS PRIVATE LIMITED # 47-10-19, 2ND LANE, V-EMPIRE BUILDING, 2ND FLOOR, DWARAKA NAGAR, VISAKHAPATNAM
2684 MANOMAY EATERIES PRIVATE LIMITED INDRAYTAN, NEAR AXIS BANK, MADHAV RAO SCINDIA MARG, CITY CENTRE, GWALIOR
2685 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
2686 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
2687 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
2688 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
2689 MANUH GLOBAL TECHNOLOGIES PRIVATE LIMITED 49-28-13 MADHURANAGAR VISAKHAPATNAM
2690 MANUMATA BAHUUDDESHIYA SANSTHA JALGAON 10, SAMARTH COLONY, ABOVE UNION BANK ATM, MJ COLLEGE ROAD, JALGAON DIST. JALGAON - 425001
2691 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
2692 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
2693 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
2694 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
2695 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
2696 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2697 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
2698 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
2699 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
2700 MARG DARSHAN MANAV SEWA SANSTHAN WARD NO 7 SUGAHI TEACHER COLONY SALEMPUR
2701 MARIAN COLLEGE KUTTIKKANAM AUTONOMOUS PRINCIPAL MARIAN COLLEGE KUTTIKKANAM (AUTONOMOUS) KUTTIKKANAM (PO) PEERMADE IDUKKI (DIST) KERALA STATE
2702 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
2703 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
2704 MARS DIAL NET PVT LTD 203&207 ,HEM PLAZA ,FRAZER ROAD ,PATNA,BIHAR
2705 MARS MOUNTAIN SECURITY SERVICES PVT LTD 203 & 207, 2ND FLOOR ,HEM PLAZA, FRAZER ROAD ,PATNA
2706 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
2707 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
2708 MAS CALLNET INDIA PRIVATE LIMITED A-94/10 SECTOR-58 NOIDA
2709 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI HNO 97 PARWALIYA SADAK NH-12 ROAD BHOPAL
2710 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI H.NO. 097, PARWALIYA SADAK NH-12 ROAD BHOOPAL MADHYA PARADESH - 462030
2711 MASTER EDUCATION EVAM WELFARE SOCIETY SAMITI PARWALIYA SADAK NH-12 ROAD BHOPAL
2712 MASTER MINDS SOLUTIONS P.NO:14,GANDI REDDY COLONY,BADANGPET,RANGAREDDY-500058
2713 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
2714 MATA KITAB KAUR MEMORIAL WELFARE SOCIETY OPPOSITE ITI,SURATGHAR ROAD, HANUMANGHAR JN. RAJSTHAN
2715 MATHA EDUCATIONAL SOCIETY MATHA EDUCATIONAL SOCIETY #12-21-13/1, BESIDE FIRE STATION NEAR GOKAVARAM BUS STAND, ARYAPURAM RAJAHMUNDRY
2716 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
2717 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
2718 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITI SUNHERA ROAD SABALGARH MORENA M.P.
2719 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KALYAN SAMITTI 224,NIMBAJI KI KHO NEAR MATA MANDIR JIWAJI GNJ LASHKAR GWALIOR
2720 MATHURA DEVI SHIKSHA PRASAR EVAM SAMAJ KLAYAN SAMITI 224,NIMBAJI KI KHO LASHKAR GWALIOR
2721 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
2722 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
2723 MATOSHRI SKILL DEVELOPMENT PVT LTD MATOSHRI LAWNS AMBAD ROAD,JALNA
2724 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
2725 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVANI NAGAR PAITHAN TQ. PAITHAN DIST.AURANGBAD
2726 MAUIL BAHUUDDESHIYA SEVABHAVI SANSTHA BHAVNI NAGAR PAITHAN TQ.PAITHAN DIST.AURANGABAD
2727 MAULANA HUSSAIN AHMAD MADANI CHERITABLE TRUST SECRETARY,MAULANA HUSSAIN AHMAD MADANI CHARITABLE TRUST,QUASIMPURA ROAD, DEOBAND, SAHARANPUR DIST.
2728 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
2729 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
2730 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2731 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
2732 MAYA KANWAR BA MAHILA VIKAS SAMITI SHIVAJI MARG, NEHRU NAGAR, JAIPUR
2733 MAYA SAMAJ KALYAN EVEM SHIKSHA NIKETAN SAMITI PLOT NO 41 NEELSAGAR COLONY BEHIND DURGA MANDIR NEELBAD BHOPAL
2734 MAYATECH SOLUTIONS PRIVATE LIMITED HOUSE NO 8, GEETAPURI, KHARGAPUR, GOMTINAGAR EXTENSION, LUCKNOW-226010, U.P.
2735 MAYATECH SOLUTIONS PRIVATE LIMITED A-1/8, SUMIT COMPLEX, VIBHUTI KHAND, GOMTINAGAR, LUCKNOW, UTTAR PRADESH
2736 MAYOCARE HEALTH PRIVATE LIMITED 538, IST FLOOR, TRANSPORT NAGAR, NEAR DHARMVEER MURTI,IN FRONT OF MUNDERA MANDI, ALLAHABAD
2737 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
2738 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
2739 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
2740 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
2741 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
2742 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
2743 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2744 MECTON TRAINING AND TECHNICAL SERVICES PRIVATE LIMITED 280, RING ROAD HOUSING SEECTOR, MADHAVARAM HIGH ROAD, MADHAVARAM, CHENNAI 600060
2745 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
2746 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET
2747 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
2748 MEDIWORLD EDUCATIONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEW DELHI
2749 MEDIWORLD EDUCATIOONAL SOCIETY 487 HOSPITAL BUILDING HARDEVPURI GAUTAM NAGAR NEAR FATHER AGNEL SCHOOL
2750 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
2751 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
2752 MEERA INSTITUTE OF TECHNOLOGY AND MANAGEMENT PRIVATE LIMITED 538/5-C, BANKERS COLONY JHANSI
2753 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
2754 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
2755 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
2756 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
2757 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
2758 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
2759 MEGASOFT VISHEN BHAWAN, M.G. ROAD, AURANGABAD (BIHAR)
2760 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2761 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
2762 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
2763 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
2764 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
2765 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
2766 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
2767 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
2768 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
2769 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
2770 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159 5TH. FLOOR INDUSTRY HOUSE H.T. PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
2771 MELSTAR INFORMATION TECHNOLOGIES LIMITED 159, 5TH. FLOOR INDUSTRY HOUSE H.T.PAREKH MARG CHURCH GATE RECLAMATION MUMBAI (MAHARASHTRA)
2772 MENTOR SKILLS INDIA LLP SCO 13-14-15, 2ND FLOOR, SECTOR 34A
2773 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
2774 MER PEDAGOGY PVT LTD NO 289, TTK ROAD, MANICKAM AVENUE, ALWARPET, CHENNAI
2775 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
2776 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
2777 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
2778 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2779 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
2780 METORES ISPAT PRIVATE LIMITED METORES ISPAT PRIVATE LIMITED, O-12, CIVIL TOWNSHIP, ROURKELA ORISSIA
2781 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
2782 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI,BEHIND HOTEL MAAN,GULAB BAGH ROAD, UDAIPUR
2783 MEWAR EDUCATION PVT LTD 25,MEHTA JI KI BARI BEHIND HOTEL MAAN , GULAB BAGH ROAD, UDAIPUR
2784 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2785 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
2786 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
2787 M G CHARITABLE TRUST EAST POINT CAMPUS JNANA PRABHA VIRGO NAGAR POST BANGALORE
2788 MHAALLIES IT KNOWLEDGE PRIVATE LIMITED AT POST CHITEGAON,, TQ, PAITHAN,, AURANGABAD, AURANGABAD, MAHARASHTRA, INDIA,
2789 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
2790 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
2791 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA
2792 MICROPORT INFOTECH PRIVATE LIMITED HV CYPRESS-II, NO. 96, KAVI LAKSHMISHA ROAD, (DIAGONAL ROAD) V. V. PURAM, BANGALORE BANGALORE KA 560004 IN
2793 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
2794 MIDNAPUR UNIQUE EDUCARE EDUCATIION WELFARE SOCIETY VILL-GOBINDAPUR,PO+PS-CHANDRAKONA TOWN
2795 MIDNAPUR UNIQUE EDUCARE EDUCATION WELFARE SOCIETY VILL - DAHARPUR, POST+PS - TAMLUK, DIST- PURBA MEDINIPUT
2796 MIGS EDUCTECH PRIVATE LIMITED A-86, DDA SHED, OKHLA INDUSTRIAL AREA, PHASE-2, NEW DELHI
2797 MILAT FOUNDATION BEEHAMA GANDERBAL
2798 MILE MULTIMURPOSE FOUNDATION WARDHA
2799 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
2800 MILKY FASHION CLOTHES PRIVATE LIMITED B-68, CHANAKYA PLACE, JANAKPURI, DELHI
2801 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
2802 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
2803 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
2804 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
2805 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER, ASSET NO 6, AEROCITY HOSPITALITY DISTRICT, IGI AIRPORT, NEW DELHI
2806 MIND LEADERS LEARNING INDIA PRIVATE LIMITED LEMON TREE PREMIER - DELHI AIRPORT, ASSET NO. 6, AEROCITY HOSPITALITY DISTRICT, NEW DELHI
2807 MIND SHARPER EDUCATIONAL SOCIETY 1/8C, PURI STREET NO. 1 NEAR JM CONVENT SCHOOL, MAUJPUR, DELHI-110053
2808 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
2809 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
2810 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
2811 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
2812 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI
2813 MIRAZ DETECTIVE AND SECURITY SERVICES P LTD 42, 3RD FLOOR, COMMUNITY CENTRE NARAINA INDUSTRIAL AREA, PHASE I NEW DELHI 110 028.
2814 MISAWITE TECHNOLOGIES PRIVATE LIMITED I-701, I BLOCK GOVINDPURAM
2815 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2816 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN, LUNGLEI ROAD, AIZAWL, MIZORAM
2817 MISSION FOUNDATION MOVEMENT NGAMA BUILDING, BAWNGKAWN. LUNGLEI ROAD
2818 MISSION OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2819 MISSON OF SKILLS INDIA FOUNDATION 36B KALKAJI NEW DELHI
2820 MITRAS CHARITABLE FOUNDATION FOR EDUCATIONAL AND RURAL DEVELOPMENT 301 KAGJIPURA KALPI
2821 MITR PROMOTERS PRIVATE LIMITED 139,NOBEL ENCLAVE,SECTOR-22,BEHIND ROTARY PUBLIC SCHOOL,GURGAON,HARYANA-122001.
2822 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
2823 MMCC SKILL FOUNDAION S.C.O-192,195 SECTOR-16
2824 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
2825 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
2826 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
2827 M M GROUP MRS BUILDING, 2ND FLOOR, D.C.R. MARKDET, P.O. & DIST- MALDA
2828 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
2829 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
2830 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2831 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
2832 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2833 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
2834 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
2835 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
2836 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
2837 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA TEHSIL DODA DISTRIT DODA . GPO. DODA PIN 182202
2838 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
2839 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
2840 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
2841 MODERN TRAINING INSTITUTE MODERN TRAINING INSTITUTE G.N.ROAD PARKINSGANJ SAMAD MARKET SULTANPUR UP
2842 MOHAMMADIA EDUCATIONAL AND WELFARE SOCIETY CHAND COLONY, POST PHULWARI SHARIF, DIST PATNA BIHAR 801505
2843 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
2844 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
2845 MONDAY REALTY PRIVATE LIMITED J 5/8, GROUND FLOOR, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
2846 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
2847 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
2848 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
2849 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
2850 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST REGD P O MOODLAKATTE KUNDAPURA TALUK UDUPI DISTRICT KARNATAKA
2851 MORD TEST ND
2852 MORD TEST1 SBJFLJ
2853 MORD TEST2 ADVCDS
2854 MORD TEST NEW DELHI ND
2855 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
2856 MOTHERCHAK NABODAY KISHALAY SANGHA VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301 VILL-MOTHERCHAK,P.O-BARGOKULPUR, DIST-PASCHIM MEDINIPUR,WESTBENGAL,PIN-721301
2857 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
2858 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
2859 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2860 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
2861 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
2862 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
2863 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
2864 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
2865 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
2866 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
2867 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
2868 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
2869 MOUNT EVEREST BREWERIES LIMITED 106A SHYAM BAZAR STREET 1ST FLOOR KOLKATA WEST BENGAL 700005
2870 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
2871 MOZAVI TECHNOLOGIES PVT LTD MOZAVI TECHNOLOGIES PVT LTD 26-27 MADHAVHILL NEAR TAKHTESHWAR TEMPLE WAGHAVADI ROAD BHAVNAGAR
2872 MOZAVI TECHNOLOGIES PVT LTD 26-27, MADHAVHILL NEAR TAKHTESHWAR TEMPLE,BHAVNAGAR-364001
2873 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
2874 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2875 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
2876 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2877 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
2878 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
2879 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
2880 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
2881 MS POPULAR AGENCIES 60 B/69B, HEWETT ROAD, ALLAHABAD
2882 MS RAJ ASSOCIATES B1/181, VINEET KHAND, GOMTINAGAR, LUCKNOW (U.P.)
2883 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R K COMPLEX , OPP ARRS SLIKS , HOSUR KRISHNAGIRI , TAMIL NADU 635109. CELL : 9442372741.
2884 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
2885 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
2886 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
2887 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
2888 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
2889 MUKTAI SHIKSHAN PRASARAK MANDAL PULUJWADI TAL-PANDHARPUR DIST-SOLAPUR
2890 MUKTI INDIA FOUNDATION A-105,FIRST FLOOR, ABOVE BANK OF INDIA , OPP. PILLOR NO 749, UTTAM NAGAR
2891 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
2892 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
2893 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
2894 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
2895 MVIGYAN CONSULTING PRIVATE LIMITED NO-137-E, PKT-A2, KONDLI, GHAROLI MAYUR VIHAR PH-III DELHI DL 110096
2896 MVIGYAN CONSULTING PRIVATE LIMITED 137-E,PKT,KONDLI,GHAROLI,MAYUR VIHAR, PHASE-III, DELHI
2897 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
2898 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
2899 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
2900 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
2901 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
2902 NABIHA SHIKSHAN PRASARAK MANDAL SYED SHAH TURABUL HAQ NAGAR, KGN COLONY, DARGAH ROAD PARBHANI, (MAHARASHTRA) 431 401.
2903 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
2904 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
2905 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
2906 NAIFA COMPUTER EDUCATIONAL SANSTHAN 4, PROFESSOR COLONY , ABOVE CORPORATION BANK, NEAR HOLKAR GOVT. COLLEGE,BHANWERKUA SQUARE A.B ROAD INDORE MADHYA.PRADESH
2907 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
2908 NAKSHTRA EDUCATION SOCIETY E-113, SECTOR-6, NOIDA, UTTAR PRADESH
2909 NALANDA BAHU UDDESHIYA SHIKSHAN SANSTHA GEWARDHA AT POST GEWARDHA TAH KURKHEDA DISTRICT GADCHIROLI
2910 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
2911 NALANDA EDUCATION AND RESEARCH CHARITABLE TRUST C/O - SG INSTITUTE OF SYSTEMATIC EDUCATION VILLAGE + P.O. - MURGAWAN,
2912 NALANTHA EDUCATIONAL TRUST ANBALAYA CAMPUS, THIRUPATHI NAGAR SELLAMATHADI POST
2913 NAMAN INFOTECH NAMAN INFOTECH 2ND FLOOR, UNION BANK BUILDING OPP. KUNWAR CINEMA STATION ROAD, MORADABAD
2914 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
2915 NANAK SINGH RAWAT SHIKSHA SAMITI C-252,JAWAHAR NAGAR,MHOW,TEHSIL-MHOW,DISTT. INDORE
2916 NANAK SINGH RAWAT SHIKSHA SAMITI C-232, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
2917 NANAK SINGH RAWAT SHIKSHA SAMITI C-2252, JAWAHAR NAGAR MHOW, TEHSIL MHOW DISTT. INDURE (M.P.)
2918 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR, MHOW, TEHSIL - MHOW DISTT. - INDORE
2919 NANAK SINGH RAWAT SHIKSHA SAMITI C-252, JAWAHAR NAGAR. MHOW, TEHSIL MHOW DISTT. - INDORE
2920 NANDAN DENIM LIMITED SURVEY NO 198/1 203/2 SAIJPUR GOPALPUR,PIRANA ROAD,PIPLAJ,AHMEDABAD
2921 NANDAN DENIM LIMITED SURVEY NO.198/1 & 203/2,SAIJPUR,GOPALPUR PIRANA ROAD,PIPLAJ,AHMEDABAD,GUJARAT
2922 NANDI SHIKSHA AWAM SAMAJIK SANSTHAN BRAHMPURI COLONY,DEOBAND SAHARANPUR
2923 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
2924 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
2925 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
2926 NARAYAN EDUCATIONAL SOCEITY FIRST FLOOR DESIGN COMPLEX, IN FRONT OF BDA COMPLEX,PILIBHIT ROAD BAREILLY, UP INDIA-243001
2927 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2928 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
2929 NARAYAN TRAINING SERVICES NO 546,OPP RUCHI GARDENS, BH ROAD , PRASHANTHNAGAR, NAGAPPA BLOCK , GOWRIBIDANUR , CHIKKABALLAPUR DISTRICT ,KARNATAKA - 561208
2930 NARAYAN TRAINING SERVICES NO 546 OPP RUCHI GARDENS ,B H ROAD PRASHANTHNAGAR,NAGAPPA BLOCK , GOWRIBIDANUR,CHIKKABALAPUR DISTRICT , KARNATAKA
2931 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
2932 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
2933 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
2934 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
2935 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
2936 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
2937 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
2938 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
2939 NATIONAL COUNCIL FOR CHURCH AND SOCIAL ACTION INDIA GEORGE AVENUE, SRCCE CAMPUS, A-CAMP, KURNOOL – 518004
2940 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
2941 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
2942 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
2943 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2944 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
2945 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION C/O MART INFOTECH COLLEGE ANANTNAG NEAR BUS STAND ANANTNAG
2946 NATIONAL EDUCATIONAL SOCIETY AND SOCIAL WELFARE ORGANIZATION ANANTNAG NEAR MART INFOTECH COLLEGE ANANTNAG
2947 NATIONAL EDUCATION AND WALFARE SOCIETY DEGLOOR NEAR BSNL TOWER,TEACHER COLONY,UDGIR ROAD,DEGLOOR DIST.NANDED
2948 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
2949 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
2950 NATIONAL EDUCATION DEVELOPMENT CENTER 401-D, KHURBURA MOHALLA. DEHRADUN.
2951 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
2952 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
2953 NATIONAL GROUP ORGANIZATION NO.48, CHITTOOR ROAD, KATAPADI, VELLORE .
2954 NATIONAL INSTITUTE FOR COMMUNITY DEVELOPMENT AND RESEARCH YOJNA BHAVAN, GOLDEN PARK, KALANAGAR, MADHAVNAGAR ROAD, BEHIND BYPASS PETROL PUMP, SANGLI, MAHARASHTRA
2955 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
2956 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
2957 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
2958 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
2959 NATIONAL INSTITUTE OF EDUCATION AND DEVELOPMENT CHAKRATA ROAD, SUDHOVALA CHOWK, DEHRADUN, UTTARAKHAND
2960 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
2961 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
2962 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
2963 NATIONAL INSTIUTE OF EDUCATION AND DEVELOPMENT RZT 23 NANDA BLOCK MAHAVIR ENCLAVE NEW DELHI
2964 NATIONAL INSTIUTE OF LIFE SKILLS 76-18-63, GONGRESS OFFICE ROAD, GOVERNORPET, VIJAYAWADA
2965 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
2966 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR,GURUKUL INSTITUTE,JAIN BUILDING, YAMUNANAGAR
2967 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
2968 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
2969 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
2970 NATIONAL SKILL DEVELOPMENT ACADEMY JEEVANAGAR , PAPPIREDDIPATTI PO & TK ,DHARMAPURI DT
2971 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
2972 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
2973 NATIONAL WOMEN DEVELOPMENT TRUST 53 GRAMMASAVADI STREET CUMBUM
2974 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2975 NATIONAL WOMEN DEVELOPMENT TRUST NATIONAL WOMEN DEVELOPMENT TRUST 53.GRAMACHAVADI STREET CUMBUM-625516 THENI-DT
2976 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
2977 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
2978 NATIVE EDUCATION AND EMPLOYMENT DEVELOPING SOCIETY 152 KRISHNA NAGAR COLONY KROND BERASIA ROAD BHOPAL
2979 NATIVE SKILL DEVELOPMENT AND TRAINING COUNCIL 2ND FLOOR, HAFISHA ARCADE, NEAR MATHRUBHUMI, CHETTAINGADI, THRISSUR
2980 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
2981 NATURAL AGROTECH RESEARCH AND PROCESSING SERVICE BLOCK 5 DIC/LBI OPP TUIBONG POST OFFICE
2982 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO,66 B SENGALUNEARODAI STREET, KANCHIPURAM - 631502, TAMIL NADU
2983 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
2984 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
2985 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2986 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
2987 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
2988 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
2989 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
2990 NAVACHETHANA MALLAPPALLY INSTITUTE
2991 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
2992 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
2993 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2994 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2995 NAVAYUGA CONSULTANCY SERVICE NO.28, CHETTY STREET
2996 NAV BHARAT FOUNDATION 3852/9, 2ND FLOOR, KANHAIYA NAGAR, DELHI
2997 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
2998 NAVIGATION EDUCATIONAL AND WELFARE SOCIETY WARD 4 BARTHARA ROAD KHOJAWARE WALA KUWAN KE PASS GOHAD DISTT- BHIND MP
2999 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
3000 NAVJYOT ENTERPRISES 24,GROUND FLOOR,BHARAT INDUSTRIAL ESTATE,LAL BAHADUR SHASTRI MARG, BHANDUP-WEST, MUMBAI
3001 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
3002 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
3003 NAVKAR EDUCATION TRUST NAVKAR PLOT NO.634/9/A, OPP. VASUNDHARA BUS STOP, GULBAI TEKRA, AHMEDABAD, GUJARAT
3004 NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE NAVKRANTI MANAGEMENT AND TECHNICAL COLLEGE, GADHINGLAJ TAL GADHINGLAJ
3005 NAV NIRMAN SEWA SAMITI 01 HATHWALA ROAD, SAMALKHA DISTRICT PANIPAT
3006 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
3007 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
3008 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
3009 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
3010 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3011 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3012 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
3013 NAVRAJ EDUCATIONAL SOCIETY B-19, RIYAL RESIDENCY, NEAR SHAHPURA THANA, GULMOHAR, BHOPAL
3014 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
3015 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
3016 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
3017 NAVYUVAK SAMAJIK AND SHICHAD SANSTHAN I-32, 117/K/13, MP UDYOG MOTI VIHAR, SARVODAYA NAG KANPUR KANPUR KANPUR - 208025 UTTAR PRADESH
3018 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3019 NAYA SAVERA SANSTHA VILLAGE MUDSENA MADARI POST PAREVA VAISH DISTRICT PILIBHIT
3020 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
3021 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
3022 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
3023 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3024 NCC COMPUTER EDUCATION MAUNA PAKARI NEAR GANDHI CHOWK MAIN ROAD CHAPRA
3025 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
3026 NCLM SHIKSHAN SANSTHAN 546, KHALSI LINE KYDGANJ ALLAHABAD
3027 NCLM SHIKSHAN SANSTHAN 546 K.L KYDGANJ BANK OF BARODA BUILDING ALLAHBAD UTTAR PRADESH
3028 NDIAN MEDICAL TRUST NIMS UNIVERSITY JAIPUR DELHI HIGHWAY, JAIPUR -30203
3029 NEARAVU FOUNDATION #6/1,SHIVAJI BUILDING, 4TH MAIN, 4TH CROSS, SUBRAMANYA SWAMY TEMPLE STREET, KUMARA PARK (W), SHESHADRIPURAM, BANGALORE
3030 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
3031 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD, AGRA
3032 NEELAM EDUCATIONAL TRUST 146 SEC 9 AVAS VIKAS COLONY SIKANDRA BODLA ROAD
3033 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
3034 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
3035 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
3036 NEHRU MAHILA MANADAL GOVIND BHAWAN KHAJURI SADAK KHAJURI
3037 NEHRU MAHILA MANDAL GOVIND BHAWAN KHAJURI SADAK BHOPAL
3038 NEHRU SASHAKTIKARAN KENDRA MAHUA TIRAHA,PIPRAICH ROAD,GORAKHPUR
3039 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
3040 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
3041 NEHRU YUVA MANDAL SAMITI VILL - PATARASIA, POST- BARKHERA, PILIBHIT (UP)
3042 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
3043 NEHRU YUVA MANDAL SAMITI VILL PATRASIYA POST BARKHERA KALAN PILIBHIT UP
3044 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
3045 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
3046 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
3047 NERAVU FOUNDATION 6/1, 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET,KUMARA PARK WEST, SHESHADRIPURAM, BLORE- 560020
3048 NERAVU FOUNDATION #6/1 SHIVAJI BUILDING 4TH MAIN, 4TH CROSS, SUBRAMANAYA SWAMY TEMPLE STREET, KUMARA PARK(W), SHESHADRIPURAM, BANGALORE
3049 NEST NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3050 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
3051 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
3052 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
3053 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
3054 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
3055 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
3056 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3057 NEVIS EDUCATIONAL AND ECONOMIC DEVELOPMENT TRUST 35/10J RASTHAMANAVELI ST., MAYILADUTHURAI
3058 NEW ARAWALI SHIKSHA SAMITI NEAR LALDAS MANDIR, OPP. OF PNB KATHUMAR , TEHSIL - KATHUMAR , DIST.- ALWAR , RAJASTHAN
3059 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
3060 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
3061 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
3062 NEW ERA EDUCATION DEVELOPMENT SOCIETY CO TARA INFOTECH NEAR PS BANK MALL GODOWN ROAD RAMPURA PHUL
3063 NEW ERA EDUCATION DEVELOPMENT SOCIETY NEED TARA INFOTECH NEAR PS BANK RAMPURA PHUL
3064 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
3065 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
3066 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
3067 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3068 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3069 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3070 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3071 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3072 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3073 NEW HORIZON EDUCATIONAL AND SCIENTIFIC ACCESS TRUST SHAHPUR TAMAUNI, SIMARIA, KAJRELY
3074 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
3075 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
3076 NEW LBS SANSTHAN PRATAPGARH ZERO MILE CHOURAHA , PRATAPGARH , RAJASTHAN
3077 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
3078 NEW SAHARA EDUCATION AND WELFARE SOCIETY AURANGABAD MAHARASHTRA C% ATI COLLEGE, AZAD CHOWK, N-6, CIDCO, AURANGABAD.431003 MAHARASHTRA
3079 NEW SIMBOL TAKNIKI PRASHIKSHAN SANSTHAN CIVIL LINE KATNI
3080 NEW SWIFT EDUCATION AND EMPLOYMENT CONSULTANCY PRIVATE LIMITED 29/238 KHALSHA CHAMBERS BEAWAR RAOD AJMER
3081 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3082 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3083 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK,PIJ ROAD, NADIAD - 387002 GUJARAT
3084 NEWTECH IT EDUCATION PRIVATE LIMITED SFI, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD - GUJARAT, INDIA.
3085 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
3086 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
3087 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
3088 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3089 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
3090 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
3091 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
3092 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
3093 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3094 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3095 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
3096 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
3097 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
3098 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3099 NEXTGEN INFRATEL PRIVATE LIMITED E-2, SECTOR 63 NOIDA GAUTAM BUDDHA NAGAR UP
3100 NEXT STEP LOGISTICS MANAGEMENT PVT LTD NO 14, 1ST FLOOR, SAI NIVAS, 5TH CROSS, 1ST BLOCK, AKSHAYA NAGAR, RAMMURTHY NAGAR EXTN, BANGALORE
3101 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
3102 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
3103 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
3104 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
3105 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
3106 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
3107 NIELIT IMPHAL NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY (NIELIT) IMPHAL AKAMPAT P.O BOX 104, IMPHAL, MANIPUR 795001
3108 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
3109 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
3110 NIHAR SKILL EDUCATION NIHAR SKILL EDUCATION REG.OFFICE:1/338/1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR,CUDDAPAH, ANDHRA PRADESH
3111 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
3112 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
3113 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3114 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3115 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
3116 NILAGIRI INSTITUTE OF HOTEL MANAGEMENT AND CATERING TECHNOLOGY INDUSTRIAL SCHOOL 12-687H NEAR JUDICIAL MAGISTRATE COURT MYSORE ROAD GUDALUR THE NILGIRIS TAMILNADU
3117 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
3118 NILANCHAL CHEMICAL AND FERTILIZERS LIMITED C/O RAM RADHIKA MAHAVIDHYALAY GRAM : - CHATIYA POST :- MEHRUNA LAR , SALEMPUR
3119 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
3120 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
3121 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
3122 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
3123 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
3124 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
3125 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
3126 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
3127 NIRBAL VARG SWASTHYA KALYAN SAMITI 448 WAZIDPUR SOUTH JAUNPUR 222002 UP
3128 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
3129 NIRMALA MAHILA SHILP KALA KENDRA ADARSH NAGAR SECT-1 LAKHIMPUR PUR ROAD SITAPUR
3130 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA, AHMEDABAD-
3131 NIRMAL FOUNDATION 144 SUYOG COMPLEX NR SAKAR SCHOOL NEW CG ROAD CHANDKHEDA AHMEDABAD
3132 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
3133 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
3134 NISHKAM SEWA SANSTHAN NEAR 101 NO. RAILWAY GETA, MERTA ROAD TAHSIL MERTA CITY DISTRICT NAGAUR
3135 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, PO - SOUTH SINTHEE, PS - SINTHI,
3136 NISHTHA INSTITUTE OF SKILL DEVELOPMENT PRIVATE LIMITED 168, SOUTH SINTHEE ROAD, P.S.- SINTHI, P.O.- SOUTH SINTHEE, KOLKATA
3137 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
3138 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
3139 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
3140 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3141 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
3142 NITEOIT SOLUTIONS PVT LTD HYDERABAD: PLOT NO 6, H NO 1-66/4/6, KAVURI HILLS, MADHAPUR, HYDERABAD BANGALORE: NITEOIT, #118, 2ND FLOOR, HORAMAVU CROSS, BANASWADI RING ROAD, BANGALORE – 560043
3143 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
3144 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
3145 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
3146 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
3147 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3148 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
3149 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
3150 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
3151 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SHITALA MATA LANE GROUND FLOOR, FLAT NO- AS 6
3152 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 20/1 SITALA MATA LANE, P.S. BARANAGAR, KOLKATA-90
3153 NOAPARA VIVEKANANDA SOCIAL WELFARE SOCIETY 2O/1 SITALA MATA LANE GROUND FLOOR FLAT NO AS6
3154 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
3155 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
3156 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
3157 NOBLE INSTITUTE OF CNC TECHNOLOGY 48-15-23,NAGARJUNA NAGAR,OPP NEW GOVERNMENT HOSPITAL,VIJAYAWADA-520008.
3158 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
3159 NOBLE MUSLIM MINORTIY EDUCATIONAL AND WELFARE SOCIETY YUNUS COLONY,AURANGABAD, 431001
3160 NO EDUCATION RAVINDRA NAGAR RAIPUR
3161 NOIDA PRODUCTIVITY COUNCIL 150 - ALISTONIA ESTATE, SECTOR CHI-3, GREATER NOIDA
3162 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
3163 NORTH EAST INSTITUTE FASHION TECHNOLOGY NEIFT,SECOND FLOOR,(NEXT TO SBI EVENING BRANCH) G.N.B. ROAD,GUWAHATI
3164 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
3165 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
3166 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
3167 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
3168 NOW NURTURING ONES WILLPOWER FOUNDATION 17-D-96, AIIMS EMPLOYEE CGHS, MAYUR VIHAR, PHASE III, NEW DELHI
3169 NPA EDUCARE WELFARE SOCIETY 8, MALIK PLAZA, ASHOK NAGAR, NEAR M.B. INTER COLLEGE, BAREILLY
3170 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
3171 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
3172 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
3173 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
3174 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
3175 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
3176 N RING TECHNOLOGIES PRIVATE LIMITED 6/234 VIKAS NAGAR LUCKNOW UTTAR PRADESH INDIA
3177 NRLM SKILLS SAMRAT,CHANKYAPURI
3178 NR MULTIIMEDIA PVT LTD FLAT NO 302, SWAMI SADAN,, GPO SQUARE, CIVIL LINES, NAGPUR - 440001, MAHARASHTRA, INDIA
3179 NR MULTI MEDIA FLAT NO 302, SWAMI SADAN, GPO SQUARE, CIVIL LINES, NAGPUR -440001
3180 NR MULTI MEDIA P.N.03,NEW BEZONBAGH,GERDEN LAYOUT,BH BEZONBAGH BUS STOP,KAMPTEE RD..,NAGPUR-440004
3181 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3182 NST ACADEMY REGD OFFICE : NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3183 NST ACADEMY REGD OFFICE: NST ACADEMY, 30/9, 80 FEET ROAD, INDIRANAGAR, BANGALORE.
3184 N S WELFARE SOCIETY RAVIDAS NAGAR NEAR BLOCK OFFICE NOORPUR BINOR UP
3185 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3186 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3187 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
3188 N V R EDUCATIONAL AND CHARITABLE TRUST C/O NATIONAL INSTITUTE OF ADVANCED TECHNOLOGY (NIAT-ITI),CHENNAI-TIRUPATHI HIGHWAYS(NH-205),TEACHERS NAGAR,TIRUTTANI.
3189 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3190 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
3191 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
3192 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3193 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
3194 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
3195 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
3196 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
3197 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
3198 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
3199 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
3200 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
3201 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
3202 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
3203 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
3204 O C SWEATERS LLP PLOT NO 32-33 SEC 4 IMT MANESAR GURGAON
3205 ODISA TECHNICAL AND MANAGEMENT EDUCATIONAL SOCIETY SHREE LAXMI NIVAS , LAXMINAGAR , BABUA BAGICH , COX COLONY , PO INDUSTRIAL ESTATE , JHARSUGUDA DIST JHARSUGUDA ORRISA
3206 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3207 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
3208 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3209 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
3210 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
3211 OLIRUM INDIA TRUST A1143, IISTREET, THAMARAI NAGAR, TIRUVANNAMALAI
3212 OLIRUM INDIA TRUST A1143, THAMARAI NAGAR, TIRUVANNAMALAI
3213 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
3214 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
3215 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
3216 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
3217 OMEGA TRUST OPERATION MISSION ECONOMICAL GROWTH ASSOCIATION TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI DOWN, MANAMADURAI TALUK, SIVAGANGAI DISTRICT, TAMIL NADU, S.INDIA - 630 606
3218 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
3219 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
3220 OMKARESHWAR CONSULTING AND OUTSOURCING SERVICES PRIVATE LIMITED 58 ELDECO GREENS GOMTI NAGAR UTTAR PRADESH LUCKNOW
3221 OM SAI CONTRUCTION OM SAI CONSTRUCTION 61/2 MAHAVEER CHOWK NARAYANPUR CHHATTISGARH
3222 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
3223 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH MAIN ROAD LOHA TQ LOHA DIST NANDED
3224 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH SANGEWAR COPMLEX MAIN ROAD LOHA TQ LOHA DIST NANDED
3225 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA OMSAI INFOTECH BUS STAND OPPOSITE MAIN ROAD LOHA TQ LOHA DIST NANDED
3226 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
3227 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
3228 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
3229 OMTECH COMPUTER SOCIETY I FLOOR ALLAHABAD BANK NAINITAL ROAD BAHERI BAREILLY
3230 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
3231 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
3232 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
3233 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
3234 ONEWAY SKILL MANAGEMENT AND TECHNOLOGY PRIVATE LIMITED FLAT NO. 1645-A DHANAS CHANDIGARH
3235 ONEX MEDICAL AND EDUCATION WELFARE SOCEITY 178/14 NEAR- SARSWATI SCHOOL, NEHRU NAGAR, SAMAN , REWA, MADHYA PRADESH -486001
3236 ONFIELDIN PRIVATE LIMITED #16, ANJANAVILAS, S.R. LAYOUT, SRIRAMPURA - II STAGE, MYSORE - 570023
3237 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
3238 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY PUNGH, SUNDERNAGAR, DISTT MANDI (HP)
3239 OPEN EDUCATIONAL DEVELOPMENT RESEARCH AND WELFARE SOCIETY LEHRAGAGA-148031 DISTT. SANGRUR (PB.)
3240 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
3241 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
3242 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
3243 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
3244 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3245 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3246 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
3247 ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3248 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3249 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
3250 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
3251 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3252 ORIGIN CADD INFOTECH NO:49 THIYAGI KUMARAN STREET THANEERPANDAL, PEELAMENU COIMBATORE TAMILNADU
3253 ORIGIN CADD INFOTECH 49 ,THIYAGI KUMARAN THANEERPANDAL ,PEELAMEDU COIMBATORE
3254 ORION TRUST SAGOLBAND THINGOM LEIKAI
3255 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
3256 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
3257 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3258 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
3259 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
3260 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
3261 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3262 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3263 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
3264 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
3265 ORRISIS ORGANISATION FOR REMOVING REGIONAL IMBALANCES AND SOCIAL INJUSTICE IN SOCIETY AT- PANITANKI ROAD, PO- MODIPARA, PS- TOWN, DIST.- SAMBALPUR
3266 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
3267 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3268 OSHO PACKAGING PVT LTD REGD.OFFICE: S.P.44, PITAM PURA, NEW DELHI
3269 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
3270 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
3271 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
3272 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
3273 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
3274 OVER AIR TECHNOLOGIES PRIVATE LIMITED #2385, SECTOR-22C, CHANDIGARH
3275 OVER AIR TECHNOLOGIES PRIVATE LIMITED S.C.O-84/1, SECTOR-58, SHAHI MAJRA MOHALI
3276 OXFORD SHIKHHA PRASAR SANSTHAN TIWARIYAN CHHIBRAMAU, KANNAUJ U.P.
3277 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI U.P. IN CODE-262701
3278 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3279 OXYGEN ASE INSTITUTE OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA
3280 OXYGEN ASE INSTITUTE SETH COLONY ARJUNPURWA LAKHIMPUR KHERI
3281 OXYGEN INSTITUTE ASE OXYGEN INSTITUTE ASE SETH COLONY ARJUNPURWA
3282 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
3283 PABAN JYOTI BHUYAN GHY
3284 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
3285 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
3286 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
3287 PACE WELFARE AND SKILL DEVELOPMENT SOCIETY 84 WARD NO.8, GALI NO.1 NAVANKUR GALI, GANJ BASODA DISTRICT VIDISHA MP-464221
3288 PACHUAU CONSULTING PRIVATE LIMITED B-42, SECOND FLOOR, DAWRPUI VENGTHAR, AIZAWL, MIZORAM
3289 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
3290 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
3291 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
3292 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
3293 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
3294 PADMAJA WELFARE SOCIETY HOUSE OF SHRI GAGAN, FLA NO.- 101/B, RAGHVENDRA LOK, PUNAICHAK, BAILEY ROAD, PATNA, BIHAR
3295 PAHAL JAN SEVA SANSTHAN LUNIYA HOUSE BEHIND COLLECTRATE NEAR AJMER CLUB AJMR
3296 PAKHI SAMAJIK SEWA SANSTHA C-26, MEZZANINE FLOOR, CONNAUGHT PALACE NEW DELHI- 110001
3297 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
3298 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
3299 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
3300 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
3301 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
3302 PANAH FOUNDATION 5,KAILASH NAGAR, NEAR GAYATRY SOCIETY. B/H- RAJIV GHANDHI BHAVAN SAIJPUR BHOGHA,NARODA ROAD
3303 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
3304 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
3305 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
3306 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
3307 PANCHSHEEL THINKERS SAMITI MERHWA (BANGANGA ROAD)SHOHRATGARH SIDDHARTHNAGAR 272205 UTTAR PRADESH
3308 PANCHSHEEL THINKERS SAMITI OPEN SHELTER HOME NEAR CDPO OFFICE BHEEMAPAR SIDDHARTHNAGAR
3309 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
3310 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
3311 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
3312 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
3313 PANDIT LEKHRAM VEDIC MISSION D-15/1,GF,ARDEE CITY, GURGAON, HARYANA
3314 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
3315 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU.
3316 PANKAJ MEMORIAL CHARITABLE TRUST FOR EDUCATION AND RESEARCH 50 B SECTOR A SUBASH NAGAR JAMMU JAMMU
3317 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
3318 PANSI TECHNOLOGIES 101,PANSI HOUSE,NEAR BY PARYAG SOCIETY BUILDING,LOKDHARA KALYAN (E), TISGAON RD, LOKGRAM, KALYAN, MAHARASHTRA 421306
3319 PARAKRAM ASSOCIATION OF GWALIOR ENGINEERS 78-TANSEN NAGAR GWALIOR
3320 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
3321 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
3322 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20 NEW ASHOK NAGAR DELHI
3323 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B 20, NEW ASHOK NAGAR, DELHI
3324 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20, NEW ASHOK NAGAR, DELHI-110096
3325 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
3326 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
3327 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
3328 PARAM INFO SOCIETY OF INFORMATION AND TECHNOLOGY SERVICES 5 VISHNUPURI MAIN , FLAT NO 202 , VISHNUPURI , INDORE
3329 PARAMOUNT WELFARE SOCIETY 90/6, SHKTI NAGAR BARI, RAISEN,M.P
3330 PARAMPARA FOUNDATION JF-2/8,BLOCK-2,JANTA FLAT,ARYA KUMAR ROAD,P.O.-RAJENDRA NAGAR,P.S.-KADAMKUAN,PATNA
3331 PARAMPARA FOUNDATION JF-2/8,BLOCK 2 JANTA FLAT,ARYA KUMAR ROAD,RAJENDRA NAGAR,P.O. RAJENDRA NAGAR,P.S.-KADAMKUAN
3332 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
3333 PARAS SPORTS AND EDUCATIONAL SOCIETY J.K BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3334 PARAS SPORTS AND EDUCATIONAL SOCIETY JK BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3335 PARAS SPORTS AND EDUCATIONAL SOCIETY JK, BUILDING, OPP KHALSA COLLEGE, AMRITSAR
3336 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
3337 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
3338 PARIDHI AT NAYATOLA,BHIKHANPUR PO BHAGALPUR BHAGALPUR
3339 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
3340 PARINITA GRAMEEN VIKAS SAMITI WARD NO.14 PAWAR DHARMSHALA NEAR BUS STAND NASRULLAGANJ DIST. SEHORE (M.P.)
3341 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
3342 PARISHRAM RESOURCES PRIVATE LIMITED 7TH FLOOR, PLOT 14A, VIOM BUILDING SECTOR 18, MARUTI INDUSTRIAL COMPLEX GURGAON GURGAON HR
3343 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
3344 PARSHI TRAINING AND TECHNICAL SERVICES PVT LTD 101,1RST FLOOR,PINK TOWER,OPP.NEHRU GARDEN,TONK ROAD,JAIPUR.
3345 PARTH SHIKHSHAN SAMITI ASHOK NAGAR SARKANDA BILASPUR
3346 PARVEENTRAVELS NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, VEPERY
3347 PARVEEN TRAVELS PRIVATE LIMITED NO 178 PERAMBUR BARRACKS ROAD, PURASAIWAKKAM, CHENNAI
3348 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
3349 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
3350 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
3351 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
3352 PAS PROJECTS PRIVATE LIMITED JEWEL HEIGHTS FIRST FLOOR 23, BISHESHWAR NATH ROAD LALBAGH LUCKNOW LUCKNOW UP.
3353 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
3354 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
3355 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM
3356 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING, RS ROAD,GUDIYATHAM GUDIYATHAM TK,VELLORE DT
3357 PAVUNAMMAL FOUNDATION NO:1,SILKMILL BUILDING,RS ROAD,GUDIYATHAM,VELLORE DT,TAMILNADU
3358 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
3359 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
3360 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
3361 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
3362 PC INFOTECH GROUP PC INFOTECH GROUP, 3RD FLOOR, CENTRAL MARKET, TINKONIA, BURDWAN, WEST BENGAL-713101
3363 PEACE DEVELOPMENT SOCIETY NEAR MAZAR HAFIZ JAMAL SAHAB BAJORI TOLA RAMPUR UP
3364 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, OPP. GURUDWARA, DEHRADUN
3365 PEARL INSTITUTE OF FINANCIAL MARKET PVT LTD 18/68, MOHINI ROAD, DAALNWALA
3366 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
3367 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3368 PEDAGOGUES EDUCATION INDIA PRIVATE LIMITED 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3369 PEDAGOGUES EDUCATION INDIA PVT LTD 810,VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3370 PEDAGOGUES EDUCATION INDIA PVT LTD 810, VISHAL BHAWAN, 95, NEHRU PLACE, NEW DELHI
3371 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
3372 PENTAGON MARITIME TRAINING AND RESEARCH INSTITUTE PMTRI BUILDING, PENTAGON HOUSE, CIDCO SERVICE I NDUSTRI AL AREA, PLOT NO. 60, SECTOR-1, SHIRVANE, NERUL-E, NAVI MUMBAI
3373 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
3374 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
3375 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
3376 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
3377 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
3378 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
3379 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL ,HARYANA
3380 PEOPLE WELFARE EDUCATIONAL TRUST VILLAGE GORGARH TEHSIL INDRI DISTT. KARNAL HARYANA
3381 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
3382 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
3383 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
3384 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
3385 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
3386 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
3387 PERIYAR MANIAMMAI EDUCATIONAL AND CHARITABLE SOCIETY PMIST (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR, VALLAM, THANJAVUR - 613403, TAMILNADU.
3388 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PMIST( PERIYAR MANIAAMAI UNIVERSITY ), PERIYAR NAGAR, VALLAM, THANJAVUR- 613403 TAMILNADU.
3389 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR-613403, TAMILNADU.
3390 PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY PERIYAR MANIAMMAI INSTITUTE OF SCIENCE AND TECHNOLOGY, (PERIYAR MANIAMMAI UNIVERSITY), PERIYAR NAGAR,VALLAM, THANJAVUR - 613403, TAMILNADU.
3391 PHILADELPHIA RURAL DEVELOPMENT SOCIETY PHILADELPHIA COMPOUND TAHSILPARA WARD NO-13 BIJAPUR DISTRICT BIJAPUR
3392 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
3393 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
3394 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
3395 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
3396 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
3397 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
3398 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
3399 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
3400 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
3401 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
3402 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
3403 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
3404 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
3405 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
3406 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
3407 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
3408 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
3409 PLAN TO EMPOWER F 13/17 B, TF JOGA BAI EXTEN. JAMIA NAGAR OKHLA, NED DELHI
3410 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
3411 PLEASE DELETE TEST APPLICATION TEST IN TEST
3412 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
3413 PLUSTRUST 101, SRI SABARI RESIDENCY, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD.
3414 PLUSTRUST FLAT NO 101, SRI SABARI RESIDENCY, 11-3-397, SRINIVAS NAGAR COLONY, SRINIVAS NAGAR, SECUNDERABAD
3415 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
3416 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
3417 POLYVALENT CONSULTING PVT LTD KAKADEO,PLOT NO.-117/L/248, NAVEEN NAGAR, KANPUR
3418 PONNI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE,PATTUKONAMPATTI POST,PAPPIREDDIPATTI TALUK,DHARMAPURI DT,PINCOAD :636905.
3419 POONI RURAL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT, TAMILNADU, PINCODE : 636905. CELL NO : 8903501733
3420 POONI RURAL SKILL DEVELOPMENT TRUST 1/107,SAMIYAPURAMKOOTROAD VILLAGE, PATTUKONAMPATTI POST, PAPPIREDDIPATTI TALUK, DHARMAPURI DT.TAMILNADU , PINCODE :636905 .CELL : 8903501733.
3421 PORNICA EDUCATIONAL TRAINING INSTITUTE OLD SUBRAMANI KOVIL STREET, PAUPPARAPATTI PO, PENNAGARAM TALUK, DHARMAPURI DISTRICT
3422 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
3423 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
3424 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
3425 PRABHAV MOTORS PRIVATE LIMITED MALOUT-HANUMANGARH BYPASS ABOHAR
3426 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
3427 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
3428 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
3429 PRADEEP JAIN PKG, EDUCATIONAL TRUST, RN COLLEGE OF ENGINEERING AND TECHNOLOGY, MOHINDPUR, THIRANA, ASSANDH ROAD, NEAR THERMAL POWER PLANT
3430 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3431 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
3432 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
3433 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
3434 PRAGATI FOUNDATION ABOVE LAKSHMI SUPAR MARKET NEEM CHOURAHA BODA BAG REWA M P
3435 PRAGATI FOUNDATION NEAR PANDEN BUILDING NEEM CHOURAHA BODA BAAG REWA M P
3436 PRAGATI UNIVERSAL TRUST PLOT NO – 9, KHASRA NO – 173, BLOCK –A, GALI NO – 6, MAHARANA VIHAR, DISTRICT GHAZIABAD, GHAZIABAD UTTAR PRADESH – 201009
3437 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
3438 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
3439 PRAKALPGRAST KALYANKARI SAMITEE GONDIAS JANVIKAS FOUNDATION KMJ HOSPITAL ROAD, SHASTRI WARD, GONDIA-441601 (MS)
3440 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
3441 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
3442 PRAKASH DEEP SEWA SANSTHAN PDSS SCHOOL OF SKILL DEVELOPMENT H.N. 60, NARAYAN NAGAR WARD, GORA BAZAR, RAEBARELI (U.P.) MOBILE: 9616542695
3443 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR COLONY
3444 PRAKASH JAN SEWA SANSTHA PRAKASH JAN SEWA SANSTHA, AT-NUTAN NAGAR, POST-KORRA, DISTRICT-HAZARIBAG 825301
3445 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3446 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3447 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
3448 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
3449 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
3450 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3451 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3452 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
3453 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
3454 PRAPTI EDUCATIONAL AND WELFARE TRUST G.B.LANE, ICHAPUR NAWABGANJ,NORTH BARRACKPORE, POLICE STATION: NOAPARA, DIST: NORTH 24 PARGANAS
3455 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
3456 PRATAP SEWA SAMITI GOMATI NAGAR PANCHO PEERAN SULTANPUR
3457 PRATHAM HEERA SALES PRIVATE LIMITED KRIDA BHAVAN BUILDING, BEHIND MUNICIPAL COUNCIL, NANDURBAR
3458 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
3459 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
3460 PRATHYAK SERVICES PRIVATE LIMITED F-16, RING ROAD, ADIL NAGAR LUCKNOW
3461 PRATHYAK SERVICES PRIVATE LIMITED 1ST FLOOR 11/159 SECTOR 11 VIKAS NAGAR, LUCKNOW
3462 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
3463 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
3464 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
3465 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
3466 PRATISHTHA C-67 JEEWAN PARK PANKHA ROAD UTTAM NAGAR DELHI-110059
3467 PRAWAH SRI RAM TOWER, ASHIANA DIGHA ROAD, PATNA
3468 PRAWAH SRIRAM TOWER ASHIANA DIGHA ROAD, OPPOSITE IMERIAL GARDEN BEDDING HALL, PATNA
3469 PRAWAH 303, RAMJEET APARTMENT, ARA GARDEN ROAD, JAGDEO PATH, PATNA
3470 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
3471 PREM KUNJ CONSTRUCTION AND ENGG PVT LTD 2 KATEWA NAGAR EXT.,GUJAR KI THARI , NEW SANGANER ROAD JAIPUR
3472 PREMLILA VITHALDAS POLYTECHNIC SNDT WOMENS UNIVERSITY MUMBAI PREMLILA VITHALDAS POLYTECHNIC SIR VITHALDAS VIDYAVIHAR, JUHU ROAD, SANTACRUZ (WEST), MUMBAI-400 049. TELEPHONE: 26608676, 26608493, 26608462, 26606648 EXTN. 253 EMAIL: PVP@PVPSNDT.ORG, PRINCIPAL@PVPSNDT.ORG
3473 PRERANA RUGUDIPARA BALANGIR
3474 PRERANA RUGUDIPARA BALANGIR ODISHA
3475 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
3476 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
3477 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3478 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
3479 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3480 PRESTIGE EDUCATION SOCIETY PRESTIGE EDUCATION SOCIETY, 2- EDUCATION AND HEALTH SECTOR, SCHEME 74C, VIJAY NAGAR, INDORE
3481 PRIME EDUCATIONAL TRUST 20, PERUMAL NORTH STREET, NAGAPATITNAM
3482 PRIME EDUCATIONAL TRUST NO 20 PERUMAL NORTH STREET
3483 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3484 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3485 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
3486 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY ANANTAPUR (V&M) ANANTAPUR(D) A.P
3487 PRINCE OF PEACE EDUCATIONAL SOCIETY HOUSING BOARD COLONY, ANANTAPUR(V) ANANTAPUR(M) ANANTAPUR (D) ANHRAPRADESH
3488 PRINCIPAL GOVERNMENT INDUSTRIAL TRAINING INSTITUTE ROPAR NANGAL ROAD, ROPAR
3489 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10 HUDA PARK,NEAR NEW BUS STAND KURUKSHETRA
3490 PRISHA INSTITUTE OF EDUCATION AND TECHNOLOGY OPP. SECTOR-10,HUDA PARK,NEAR NEW BUS STAND,KURUKSHETRA
3491 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
3492 PRIX AUTOMATION BASEMENT, SEHRAWAT BHAWAN, OPP. SARASWATI MAHILA COLLEGE, PALWAL, HARYANA
3493 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAVKHAR RD. WARD. NO.5 SHRIRAMPUR. DIST. AHMEDNAGAR
3494 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BLDG. DAWKHAR RD. WARD NO.5 SHRIRAMPUR , DIST AHMEDNAGAR ,MS
3495 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING., DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR, DIST-AHMEDNAGAR
3496 PRIYADARSHINI MAHILA TANTRA SHIKSHAN MANDAL MERCHANT ASSOCIATION BUILDING, DAWKHAR ROAD, WARD NO 5, SHRIRAMPUR
3497 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
3498 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
3499 PRIYA GRIH UDYOG VIKAS AVAM SHIKSHA PRASAR SAMITEE N7/48 R-11 PATEL NAGAR CHHOTIBHIKHARIPUR D.L.W VARANASI
3500 PRIYANKA URBAN AND RURAL DEVELOPMENT ORGANIZATION NO.8 6TH MAIN ROAD NEAR GANGAMMA TEMPLE GANGANAGAR R T NAGAR POST BANGALORE
3501 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
3502 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
3503 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
3504 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3505 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
3506 PROFESSIONAL FASHION AND MANAGEMENT PRIVATE LIMITED D-116, OKHLA INDUSTRIAL AREA, PHASE 1, OKHLA, NEW DELHI
3507 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
3508 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS SY.NO 98/3A PRASANNAYAPALLI (V) RAPTHAD(M)ANANTAPUR (D) ANDHRAPRADESH 515002
3509 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS DOOR NO 30/348 BALAJINAGAR DHARMAVARAM ANANTAPUR (D) ANDHRAPRADESH (S)
3510 PROFFESSIONAL MANAGEMENT CONSULTING SERVICESS 30-348 BALAJI NAGAR KOTHAPETA DHARMAVARAM ANANTAPUR ANDHRAPRADESH-INDIA
3511 PROFFESSSIONAL MANAGEMENT CONSULTING SERVICES SY. NO. 98/3A, PRASANNAYAPALLI (V), RAPTADU (M), ANANTAPUR
3512 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
3513 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, M.J.D. GOVERNMENT P.G. COLLEGE KE PASS, TARANAGAR, DIST.- CHURU
3514 PROMPT ACT SECURITY SERVICES PRIVATE LIMITED JANATA STORE, NEAR M.J.D. GOVT P.G. COLLEGE, TARANAGAR
3515 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
3516 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
3517 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3518 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
3519 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
3520 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
3521 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
3522 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, GRAM BORKHEDI, A.B. ROAD, MHOW
3523 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE, A.B. ROAD , INDORE , MADHYA PRADESH
3524 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
3525 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
3526 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
3527 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
3528 PSLMM DG
3529 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
3530 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
3531 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
3532 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
3533 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
3534 PUB BARPETA SOCIAL WELFARE SOCIETY VILL- MAZDIA , P.O- PACHIM MAZDIA, P.S- SARTHEBARI, DIST- BARPETA, ASSAM.
3535 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
3536 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
3537 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
3538 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3539 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
3540 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3541 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
3542 PUNE CONSULTANCY SERVICES PRIVATE LIMITED REGISTERED ADDRESS : A2-803,GANGA OSIAN MEADOWS,NEAR ADITYA BIRLA HOSPITAL,THERGAON,PUNE PLANT & TRAINING MANAGEMENT ADDRESS : PLOT NO: 116, SURVEY NO: 31/14, KIRTI CLASSIQUE, NEAR KPIT CUMMINS, RAJIV GANDHI INFOTECH PART,PHASE-1, HINJEWADI MARUNJI ROAD.PUNE 411057
3543 PUNJ AAB EDUCATION AND WELFARE SOCIETY MOONAK # 96, WARD NO. 1, VPO MOONAK DISTT. SANGRUR (PUNJAB)
3544 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
3545 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
3546 PUNJAB SEVA SAMITEE 36A, WHOLE SALE CLOTH MARKET, GANDHIBAGH, NAGPUR, MAHARASHTRA
3547 PUNYSHLOK AHILYADEVI MAHILA BAHUUDESHIYA SANSTHA NEAR J.V MEHTA NAVAYUG VIDHYALAY BEHIND AMBIKA KRIDA MANDAL RAILWAY STATION KHAMGAON
3548 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
3549 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3550 PUSHP KIRAN UNION FOR REAL ENLIGHTENMENT PURE 106, ASOLA, CHHATTARPUR ROAD, DELHI
3551 PUTHIYAPATHAIFOUNDATION 2/54A TRICHY ROAD RANGANATHAPURAM SULUR COIMBATORE
3552 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
3553 QUADRANT POLE PRIVATE LIMITED 4/41,BRINDAVANAM 3RD STREET, IYER BUNGALOW, MADURAI.
3554 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3555 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
3556 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
3557 QUANTUM GLOBAL INFRATECH LTD N1 / 150, IRC VILLAGE, NAYAPALLI, BHUBANESHWAR, ODISHA
3558 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
3559 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
3560 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
3561 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
3562 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
3563 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
3564 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
3565 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
3566 RADHA GOVIND PUBLIC WELFARE SOCIETY RADHA GOVIND PUBLIC WELFARE SOCIETY, C/O RADHA GOVIND GROUP OF INSTITUTIONS, RAMGARH, JAHRKHAND
3567 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
3568 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3569 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
3570 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3571 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
3572 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
3573 RAGHAVS FOUNDATION 10-3-444/120A, P.S.NAGAR, VIJAY NAGAR COLONY, HYDERABAD
3574 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
3575 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
3576 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM,
3577 RAHIM MOTORS PRIVATE LIMITED SIDCO ELECTRONIC COMPLEX, RANGRETH BUDGAM
3578 RAHI SHIKSHAN SANSTHA RAHI ESTATE, AHILYA NAGAR JAITALA ROAD, NAGPUR
3579 RAHUL AGGARWAL B146, NEHRU COLONY, DEHRADUN
3580 RAI CONTRACTOR 211 NEW COLONY NO. 1 BIRLA NAGAR GWALIOR
3581 RAIGANJ COMPUTER AND INFORMATION TECHHNOLOGY 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3582 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
3583 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
3584 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
3585 RAJA BARIAR EDUCATIONAL WELFARE TRUST VILL-P.O - DOMA VIA KHUSRUPUR DIST-PATNA BIHAR
3586 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3587 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3588 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
3589 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
3590 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
3591 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
3592 RAJASTHAN SHIKSHAN PARSHIKSHAN SANSTHAN 77 VIDHYA VIHAR, BEHIND CHETALI ENCLAVE, 5 E CHHOTI
3593 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
3594 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
3595 RAJDHANI EDUTECH ENTERPRISES EW-07,INDRAPRASTH RDA COLONY,RAIPURA,RAIPUR,CHHATISGARH
3596 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
3597 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHIITWAPUR ROAD, LALKUAN, HUSSAINGANJ, LUCKNOW (U.P) - 226001
3598 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P) - 226001
3599 RAJEEV AOUDHYOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW (U.P)
3600 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
3601 RAJEEV INDUSTRIAL TRAINING AND RESEARCH INSTITUTE 22(A), STATION ROAD OPPOSITE VIKAS DEEP BUILDING,HUSAIN GANJ LUCKNOW
3602 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
3603 RAJ INDUSTRIAL SECURITY SERVICE PVT LTD J-87 , NOIDA SECTOR 41
3604 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
3605 RAJIV GANDHI LITEARCY MISSION DR.LONE COMPLEX OPPNEW HOSPITALKUPWARA ROAD SOPORE DISTRICT BARAMULLA KASHMIR
3606 RAJIV GANDHI LITERACY MISSION RAJIV GANDHI LITERACY MISSION DR. LONE COMPLEX OPP NEW HOSPITAL KUPWARA ROAD SOPORE DISTRICT BARAMULLA J&K
3607 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
3608 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
3609 RAJLAXMI PETROCHEM PVT LTD 84/2 INANI HOUSE MAIN ROAD LATUR
3610 RAJ SHREE 787
3611 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
3612 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
3613 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
3614 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301, SHIVALIK PLAZZA-B, NR.I.I.M. AMBABADI
3615 RAJYOGI ESOLUTIONS PRIVATE LIMITED B-301/207 SHIVALIK PLAZA,OPP.AMA,IIM ROAD, NEAR PANJARA POLE, AMBABADI,AHMEDABAD
3616 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, MANISH PLAZA III, SECTOR-10, DWARKA, NEW DELHI
3617 RAKSHAK SECURITAS PVT LTD T-5, PLOT NO. 12, SECTOR-10, DWARKA
3618 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
3619 RAM MORADABAD
3620 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
3621 RAMA EDUCATIONAL SOCIETY A-1/8, LAKHANPUR, KANPUR NAGAR
3622 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
3623 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
3624 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
3625 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
3626 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
3627 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
3628 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL
3629 RAM AWADH SHAW MEMORIAL TRUST ANDAL MORE, ANDAL,
3630 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
3631 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
3632 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT GHAZIPUR
3633 RAM JANAKI AADARSH SHIKSHA NIKETAN SAMITI AAMGHAT SUBHASH NAGAR GHAZIPUR UP 233001
3634 RAMKY ENCLAVE LIMITED RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN RAOD,SOMAJIGUDA,HYDERABAD,TELANGANA
3635 RAMKY ENCLAVE LIMITED 6-3-1089/G/10&11,GULMOHAR AVENUE,RAJBHAVAN ROAD,SOMAJIGUDA,HYDERABAD,TELANGANA,INDIA
3636 RAMKY FOUNDATION RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD , TELANGANA, INDIA.
3637 RAMKY FOUNDATION RAMKY FOUNDATION, RAMKY GRANDIOSE, 9TH FLOOR, RAMKY TOWERS COMPLEX, GACHIBOWLI, HYDERABAD, TELANGANA
3638 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
3639 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3640 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
3641 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
3642 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
3643 RAM SARAN EDUCATIONAL SOCIETY 161/3A/A PURA FATEH MOHAMMAD ARAIL MORE NAINI ALLAHABAD
3644 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
3645 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
3646 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
3647 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
3648 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
3649 RANKS DIGITAL MEDIA PRIVATE LIMITED G-20, 2ND FLOOR, SECTOR-63, NOIDA
3650 RANKS DIGITAL MEDIA PRIVATE LIMITED RDM CORPORATE OFFICE, 2ND FLOOR, G-20, SECTOR - 63, NOIDA, UP.
3651 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
3652 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
3653 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA,WEST BENGAL
3654 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,DEWLI,CHAKDAHA,NADIA
3655 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD RASULLAPUR,CHAKDAHA,NADIA
3656 RASHTRIYA MUKTA JANA SHIKSHA PARISHAD VILL-RASULLAPUR,P.O-DEWLI,P.S-CHAKDAHA,DIST-NADIA,PIN-741222
3657 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
3658 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
3659 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
3660 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST.-DURG
3661 RASTOGI EDUCATION 31,COMMERCIAL COMPLEX, M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG C.G.
3662 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
3663 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI
3664 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 ,M. L. NEHRU NAGAR (EAST), BHILAI DIST. DURG (C.G.)
3665 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3666 RASTOGI INDUSTRIES LIMITED 7B/3 AND 4 NEHRU NAGAR (EAST) BHILAI
3667 RASTRIYA BAL VIKAS SAMITI W-1,127/2,2ND FLOOR, MANGLAM COMPLEX SAKET NAGAR
3668 RASTRIYA MANAV VIKAS SAMITI SHIV KRIPA COMPLEX OPP. PWD OFFICE AGRA ROAD DAUSA(RAJ)
3669 RASTRIYA SAMAJIK UTTHAN SANSTHAN KHAJURI KHAJURI,KUSHAL GARH ROAD TEHSIL THANDLA DISTRICT JHABUA M.P.457777
3670 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
3671 RATNADEEP COUNSULTANT PVT LTD RATNDEEP CONSULTANTS PVT LTD, ABOVE IDBI BANK, SHREE RAMJEE ARCADE , RATU ROAD, RANCHI
3672 RAVI EDUCATION SOCIETY VPO ATELA KALAN,BHIWANI
3673 RAVINDRA FOUNDATION 702/1, CIVIL LINES JHANSI
3674 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA, SATARA KARMAVEER SAMADHI PARISAR, NEAR POWAI NAKA, SATARA (MAHARASHTRA)
3675 RAYAT SHIKSHAN SANSTHA SATARA RAYAT SHIKSHAN SANSTHA ,SATARA KARMAVEER SAMADHI PARISAR NEAR POWAI NAKA SATARA (MAHARASHTRA )
3676 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
3677 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
3678 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3679 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
3680 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
3681 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
3682 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3683 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
3684 REAL EDUCATION TRUST 24, 25 VISHRAMNAGAR, OPP AKHAND ANAND SCHOOL, VED ROAD,SURAT.
3685 REAL REVOLUTION MARKETING PRIVATE LIMITED B-32, MAHESH NAGAR, TONK PHATAK, JAIPUR
3686 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
3687 REBIRTH EDUCATION AND RESEARCH FOUNDATION 3RD FLOOR, MARUTINANDAN COMPLEX, OPP G D HIGH SCHOOL, VISNAGAR
3688 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
3689 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
3690 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
3691 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
3692 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
3693 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
3694 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
3695 REKHA SOCIETY DGGHDGHSH
3696 RELIABLE FIRST ADCON PRIVATE LIMITED 412-422, FOURTH FLOOR, DEVNANDAN MALL, OPP : SANYAS ASHRAM, NR- M. J. LIBRARY, AHMEDABAD
3697 RELIABLE INFOSOFT PVT LTD BELA COMPLEX 1ST FLOOR BINODPUR KATIHAR
3698 RELIABLEVOCATIONAL TRAINING INSTITUTE PRIVATE LIMITED B-19, PANCHVATI COLONY, RAHEEM NAGAR, MAHANAGAR, LUCKNOW, U.P.
3699 RELISYS MEDICAL DEVICES LIMITED SURVEY NUMBER 312 MANGALPALLY POCHARAM ROAD IBRAHIMPATNAM RANGAREDDY TELANGANA 501510
3700 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
3701 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
3702 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
3703 RESCUE SKILLS PRIVATE LIMITED MUNICIPAL COMPLEX UPSTAIRS, OLD BUS STAND, ULAVAR SANDHAI, KARUR
3704 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
3705 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
3706 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR
3707 RESEARCH INDIA LOK KALYAN SOCIETY WARD NO-15 NAYAK MOHALLA RAJNAGAR DIST-CHHATARPUR (M.P.)
3708 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
3709 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
3710 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
3711 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
3712 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
3713 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
3714 REWARD SOCIETY 4/450, PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3715 REWARD SOCIETY NO.4/450, INDIRA PRIYADHARSHINI NAGAR, TRICHY MAIN RD, SALAMEDU, VILLUPURAM
3716 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
3717 REYNOLD SHIRTING LIMITED 402,4TH FLOOR, KAMLA HUB,N.S.ROAD NO.1 JUHU SCHEME, VILE PARLE (WEST) MUMBAI MUMBAI, 400049
3718 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
3719 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
3720 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
3721 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
3722 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
3723 RIDDHI SIDDHI BAHUUDDESHIY SANSTHA GUDADHI AKOLA BHAGIRATHI NAGAR NEAR WED MANGAL KARYALAY GURDHI ROAD AKOLA
3724 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
3725 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
3726 RISHABHDEV EDUCATION AND RESEARCH INSTITUTE 5, INDRALOK APARTMENT, NEAR MOTIBAG CHOWK, CIVIL LINES, RAIPUR, CHHATISHGARH
3727 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
3728 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
3729 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
3730 RJ RJ
3731 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
3732 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
3733 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
3734 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
3735 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
3736 R M EDUCATIONAL TRUST NO.42/25, GEE GEE COMPLEX,2ND FLOOR, ANNA SALAI, MOUNT ROAD, CHENNAI
3737 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
3738 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
3739 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3740 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
3741 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
3742 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
3743 ROHIT HOSPITALITY SERVICES PRIVATE LIMITED B-4151, 2ND FLOOR, GREEN FIELD COLONY, FARIDABAD, HARYANA
3744 ROHSTOFFE INTERNATIONAL PRIVATE LIMITED 1304, REGENT CHAMBERS, JAMNALAL BAJAJ ROAD, NARIMAN POINT
3745 ROJGAR MARGDARSHAN AVAM SWAROJGAR PRASHIKSHAN SANSTHAN NEAR NEW BUS STAND,SHARDAPURAM,P.O. BANSAGAR COLONY,REWA (M.P.)486001
3746 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
3747 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
3748 ROUNAK ALPASANKHYANK BAHUUDDESHIY SHIKSHAN SANSTHA DREAMS TECHNOLOGY, DR. ZAKIR HUSSAIN WARD, NEAR WATER TANK, BHANDARA
3749 ROYAL EDUCATIONAL AND SOCIAL WELFARE SOCIETY H.NO. - 347 INSAF NAGAR INDIRA NAGAR
3750 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
3751 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
3752 ROYAL WINGS AUTO PRIVATE LIMITED NO.73,& 74 THIRUMALI STREET VEERAPANCHATRAM, ERODE
3753 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
3754 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
3755 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
3756 RPEDUCATIONALTRUST PLOT-44,NEAR GANPATI MANDIR,SHASTRI NAGAR,VASAI (W),PALGHAR
3757 R P EDUCATIONAL TRUST PLOT NO. 44, SHASTRI NAGAR, NEAR GANPATI MANDIR, VASAI WEST, DIST PALGHAR
3758 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
3759 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
3760 R S ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR
3761 RS ENTERPRISES 1/455 VIDHYADHAR NAGAR JAIPUR RAJASTHAN
3762 RSESK SOCIETY MAHENDRU
3763 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
3764 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
3765 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
3766 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
3767 RUBBER BOARD P.B.NO:1122,KOTTAYAM-2,KERALA,INDIA
3768 RUBBER TRAINING INSTITUTE RUBBER TRAINING INSTITUTE, RUBBER BOARD P O, KOTTAYAM, KERALA
3769 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
3770 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
3771 RUDRA DEVELOPMENT FOUNDATION VILL GAIGHATA
3772 RUPA FOUNDATION CHAKKALAR KHAL, KHEYADAHA - 2, CHOWBAGA, PS - SONARPUR, SOUTH 24 PGS, WEST BENGAL, KOLKATA, PIN- 700150 LANDMARK- JADAVPUR, OPPOSITE HERITAGE INSITUTE OF TECHNOLOGY, GATE NO – 09
3773 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
3774 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
3775 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
3776 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3777 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
3778 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
3779 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST GUNTUR A.P
3780 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
3781 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST,GUNTUR,A.P
3782 RURAL CONNEXTION FOUNDATION RURAL CONNEXTION FOUNDATION A-195, MALVIYA NAGAR, JAIPUR
3783 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
3784 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3785 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
3786 RURAL EDUCATION AND ACTION FOR CHANGE RURAL EDUCATION AND ACTION FOR CHANGE NUNGOUROK VILLAGE,DISTRICT:CHANDEL, BLOCK:MACHI,P.O.PALLEL MANIPUR 795135
3787 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
3788 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3789 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3790 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
3791 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
3792 RURAL EDUCATION AND DEVELOPMENT SOCIETY READS 77-DHARMARAJA KOIL STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
3793 RURAL ENVIRONMENT AWARENESS LEGAL DEVELOPMENT SOCIETY REAL SOCIETY NO. 5 THIRUMALAI BHAVAN KAILSANTHAR KOVIL ORCH OPP.
3794 RURAL FOUNDATION HEAD OFFICE: DULARI DHAM, NEAR KISAN SEWA ASHRAM, AHROULI MOD, POKHRAYAN,KANPUR DEHAT-209111-UTTAR PRADESH
3795 RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY REGISTERED OFFICE HOUSE NO. 54-140,WARD NO.-60 SONKARBADI,DAGNIYA DIST RAIPUR- 492001 C.G. ADMINISTRATIVE OFFICE RURAL INSTITUTE FOR CAREER AND EMPLOYMENT SOCIETY (RICES) OLD SARANGARH BUS STAND BEHIND KANHA HOSPITAL WARD NO. 31 RAIGARH 496001 C.G. FOR ENQUIRY – 07762 - 222569/215448, 9522223698, 9329057958 EMAIL - SUPPORT@RICEEDU.ORG , ADMIN@RICEEDU.ORG WEBSITE:-WWW.RICEEDU.ORG
3796 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
3797 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
3798 RV SKILL AND ENTREPRENEUR PRIVATE LIMITED FRONTLINE HOUSE,B-48,2ND FLOOR,NARAINA INDUSTRIAL AREA PHASE-2,NARAINA
3799 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
3800 SAAJ SKILL INDIA PRIVATE LIMITED B-4/A , GROUND FLOOR , GALI NO. 15 , MADHU VIHAR MARKET , NEW DELHI
3801 SAATIVIK KARMA RESEARCH FOUNDATION F-412 VILLAGE & POST OFFICE GHITORINI NEW DELHI
3802 SAATIVIK KARMA RESEARCH FOUNDATION F-412, VILLAGE & POST OFFICE GHITORINI NEW DELHI
3803 SABAL BHARAT SANSTHAN P NO 275 GURU JAMBESHWAR NAGAR GANDHI PATH JAIPUR 302021
3804 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
3805 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
3806 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
3807 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR(UK)
3808 SABRI BULBUL DILSHAD ALI TRUST VILL- RAHMATPUR, PO- PIRAN KALIYAR, ROORKEE, HARIDWAR (UK) 247667
3809 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
3810 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3811 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
3812 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
3813 SADGUNA TECHNOLOGIES NAIMNAGAR
3814 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
3815 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
3816 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
3817 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
3818 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PRAYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3819 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASUNDHARA ENCLAVE, DELHI
3820 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY REGD 110/B-4, PARYATAN VIHAR, VASHUNDHARA ENCLAVE, DELHI
3821 SAFDSF SADFASD
3822 SAFE TOWERS PRIVATE LIMITED GROUND FLOOR, PLOT NO-65, POCKET-1, JASOLA VIHAR, NEW DELHI-110025
3823 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY, INDORE
3824 SAGAR SAMAJIK VIKAS SAMITI 384 SHEETAL NAGAR, NEAR GOVIND COLONY INDORE
3825 SAGE SUSTAINABLE APPROACH FOR GREEN ENVIRONMENT LLP 205, SECOND FLOOR, BHAVANI INDUSTRIAL ESTATE, OPP. IIT BOMBAY MAIN GATE, POWAI, MUMBAI
3826 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAVIL WADI, M.G. ROAD, NAVSARI
3827 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI,M.G. ROAD, NAVSARI
3828 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT - A, JOSHI STREET, NEAR ANAWIL WADI, JOSHI STREET, M.G. ROAD, NAVSARI
3829 SAHAKAR SEVA TRUST 3RD FLOOR, NILKANTH APT-A, JOSHI STREET, NEAR ANAWIL WADI, M.G. ROAD, NAVSARI
3830 SAHARA COMPUTER EDUCATION H NO 1-5-129 DIAMOND TEXTILE COMPLEX 2ND FLOOR MAIN ROAD OPP BSNL OFFICE ZAHEERABAD DIST SANGAREDDY, TELANGANA 502220
3831 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
3832 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
3833 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
3834 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
3835 SAHASRA SAMBHAV SKILL DEVELOPMENT PVT LTD A-4 PHASE-II,NOIDA
3836 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
3837 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
3838 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
3839 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3840 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3841 SAHIL SEWA SAMITI 26/8 JUHI LAL COLONY THANA KIDWAI NAGAR KANPUR
3842 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3843 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3844 SAHIL SEWA SAMITI 26/8 JUHI DEPO LAL COLONY THANA KIDWAI NAGAR KANPUR
3845 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
3846 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
3847 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
3848 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
3849 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
3850 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
3851 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
3852 SAHYOG SAMITI VILL. NAGLA MOHAN, JUGSANA, BALDEO, MATHURA
3853 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
3854 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
3855 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED 16, IDA, BALANAGAR, HYDERABAD, TELANGANA, INDIA
3856 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
3857 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
3858 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
3859 SAIF EDUCATION SOCIETY 3 HIDAYAT COMPLEX MIRZA MARKET ASHTA DIST.SEHORE
3860 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
3861 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
3862 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
3863 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
3864 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
3865 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
3866 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
3867 SAINATH EDUCATIONAL SOCIETY ANGASAR S-21, RIICO RESIDENTIAL, PHASE-1, JHUNJHUNU
3868 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
3869 SAI RAM EDUCATIONAL AND SOCIAL WELFARE TRUST 6,PITCHAI STREET, NEAR OLD BUS STAND, VIRUDHUNAGAR.
3870 SAIRAM HEALTH CARE CHARITABLE TRUST SUNIL NAGAR BALIRAMPUR NEW NANDED MAHARASHTRA MIDC
3871 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3872 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
3873 SAISA EDU SERVICES PRIVATE LIMITED B-309 LOGIX TECHNOVA PARK A-4, SECTOR 132, EXPRESSWAY, NOIDA, UTTAR PRADESH
3874 SAI SHARANAM FOUNDATION S-661, SCHOOL BLOCK, SHAKARPUR DELHI
3875 SAI SHARANAM FOUNDATION S-661 SCHOOL BLOCK, SHAKARPUR, DELHI
3876 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
3877 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
3878 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
3879 SAI SWASTIK EDUCATIONAL TRUST PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA
3880 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
3881 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
3882 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
3883 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
3884 SAJAR HEALTH EDUCATIONAL AND CHARITABLE TRUST 52, VAIGAI STREET, VELMURUGAN NAGAR, BYPASS ROAD, MADURAI
3885 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
3886 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3887 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
3888 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3889 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
3890 SALTO TECHNOLOGIES PRIVATE LIMITED J-5/8, DLF CITY, PHASE-2, GURGAON, HARYANA - 122001
3891 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
3892 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
3893 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
3894 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
3895 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
3896 SAMAJ KALYAN CHIKITSA SEVA SANSTHA MADHAV NAGAR COLONY BY PASS ROAD SHIVPURI (M.P.)
3897 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3898 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
3899 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3900 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
3901 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
3902 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
3903 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
3904 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
3905 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
3906 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
3907 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
3908 SAMARTH EDUSKILLS PVT LTD GD-ITL TOWER,706,B09 GDITL TOWER,NETAJI SUBASH PLACE,PITAMPURA,DELHI-110034
3909 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3910 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
3911 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR, RAJASTHAN
3912 SAMARTH TRADENT PRIVATE LIMITED A 247, MURLIPURA SCHEME, JAIPUR
3913 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
3914 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
3915 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
3916 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
3917 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
3918 SAMBAL SIKHASAN SANSTHAN SHIVSINGHPURA SIKAR
3919 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
3920 SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI SAMBHAV SIKSHAN EVAM SAMAJ KALYAN SAMITI, VINAYAK NAGAR DARRASHIVPURI NEAR INFANT PUBLIC SCHOOL SAHARANPUR PIN: 247001
3921 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
3922 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
3923 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
3924 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
3925 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
3926 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
3927 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
3928 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
3929 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
3930 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9,LALA LAJPAT RAI COLONY,ASHOKA GARDEN,RAISEN ROAD,BHOPAL
3931 SAM SKILLS DEVELOPMENT AND IT SOLUTIONS PRIVATE LIMITED 40/9, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3932 SAMTA KHADI GRAMUDYOG SANSTHAN 211 A AWAS VIKAS COLONY, ETAWAH, UP
3933 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
3934 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3935 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
3936 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
3937 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
3938 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
3939 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
3940 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
3941 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
3942 SANDEEP TEST ASDASDASD
3943 SANDESH MNGO INDIA INDIA 1 INDORE
3944 SANDIP FOUNDATION 2ED FLOOR KOTESHWAR PLAZA JN ROAD MULUND MUMBAI
3945 SANDIP FOUNDATION POST MAHIRAVANI, TRIMBAK ROAD NASIK MHARASTRA
3946 SANE OVERSEAS PRIVATE LIMITED PLOT.NO.F-38 PHASE7 INDUSTRIAL AREA MOHALI NEAR ESIC HOSPITAL MOHALI PUNJAB
3947 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
3948 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
3949 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
3950 SANGMESHWAR EDUCATIONAL TRUST REGD HOUSE NUMBER 142 SECTOR 07 URBAN ESTATE KURUKSHETRA HARYANA
3951 SANGMESHWAR EDUCATIONAL TRUST REGD #142, SECTOR 07, URBAN ESTATE, KURUKSHETRA-136118, HARYANA
3952 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3953 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
3954 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
3955 SANKALP JYOTI ASHOK NAGAR-1, LAST, KANKARBAGH, PATNA-800020
3956 SANKALP KRIT SEVA MANCH AT-BHUPATIPUR(SOUTH) PO- DHELWAN PS-RAMKRISHNA NAGAR
3957 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
3958 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
3959 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
3960 SANSAR FOUNDATION SANSAR FOUNDATION, 3RD FLOOR, AMJ BUSINESS PARK, VIJAYA ROAD, NEXT TO CBT, DHARWAD
3961 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
3962 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
3963 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
3964 SANSKRITI SAMVARDHAN MANDAL SHARDANAGAR SAGROLI DIST. NANDED
3965 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE KHANDWA
3966 SANT ASHWA SHIKSHAN SAMITI PANDHANA ROAD TAPADIYA ZEEN KE SAMNE
3967 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
3968 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
3969 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3970 SANTIPUR BHARAT SIKSHA INSTITUTE VILL+P.OMECHEDA, P.SKOLAGHAT, DISTPURBA MEDINIPUR, PIN721137
3971 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
3972 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU DIST DHOLPUR RAJASTHAN
3973 SANT SHRI SHRI 1008 KASHYAP SANATAN SANSTHAN VILLAGE SHISHE KA PURA POST SAKHWARA TEHSIL SAIPAU
3974 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
3975 SAP INTEGRATED SECURITY AND IT SERVICES PRIVATE LIMITED B-544. POCKET-11, JASOLA VIHAR, NEW DELHI-110025
3976 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
3977 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
3978 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
3979 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
3980 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
3981 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
3982 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
3983 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
3984 SARASWATI BAHUUDDISHIYA SHIKSHAN SANSTHA NANDED SHOP NO. 23,24 & 60 SAHAYOG CHAMBERS, KAILASH NAGAR, NANDED
3985 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR ,BEHIND TUN TUN BABU PETROL PUMP,BANSEL BUILDING,CHAPRA ROAD,SIWAN ,BIHAR
3986 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,NEAR IDBI BANK,BEHIND UMASHANKAR SINGH PETROL PUMP,CHAPRA ROAD, SIWAN BIHAR
3987 SARASWATI CHARITABLE TRUST NEW ADARSH NAGAR,BEHIND UMASHANKAR SINGH PETROL PUMP,NEAR IDBI BANK,CHAPARA ROAD,SIWAN ,BIHAR
3988 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
3989 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
3990 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE - VILLAGE/POST- MADANPURA, TEH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN CORP.OFFICE - SHREE NATH CAMPUS, NEAR GAYATRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRPURA, CHECHAT, TH.- RAMGANJMANDI, DIST.- KOTA, RAJASTHAN
3991 SARASWATI EDUCATION AND WELFARE SOCIETY REG. OFFICE- VILLAGE/POST- MADANPURA, TEH- RAMGANJMANDI, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN. CORP. OFFICE- SHREE NATH CAMPUS, NEAR GAYTRI MANDIR, SHAHID BHAGAT SINGH CHOURAHA, CHANDRAPURA, CHECHAT, TEH.- RAMGANJMANDI, KOTA, RAJASTHAN
3992 SARASWATI INSTITUTIONS OF COMPUTER EDUCATIONAL SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX LAWRENCE ROAD
3993 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
3994 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
3995 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
3996 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
3997 SARAWATI MANDIR SANSTHA 1359, BAJIRAO ROAD, SHUKRAWAR PETH, SHUKRAWAR PETH, PUNE, MAHARASHTRA 411002
3998 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
3999 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
4000 SARGURU SHIRIDII SYSTEMS PRIVATE LIMITED 43/P, KASTHURI NILAYAM, KAMARAJ STREET, GOVINDASALAI, PONDICHERRY
4001 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
4002 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
4003 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
4004 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR, ARERA COLONY BHOPAL - 462016 MADHYA PRADESH , INDIA
4005 SARKS METAL PRIVATE LIMITED SARKS METAL PRIVATE LIMITED PLOT NO. 27A, E-3 SECTOR ,, ARERA COLONY, BHOPAL - 462016, MADHYA PRADESH, INDIA
4006 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGES CAMPUS DATODA KHANDWA ROAD, INDORE
4007 SARODINI SARASWATI SHIKSHA SAMITI SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS, VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4008 SARODINI SARASWATI SHIKSHA SAMITI IMI COLLEGE CAMPUS VILLAGE DATODA KHANDWA ROAD, INDORE (MP)
4009 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
4010 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
4011 SAROJ GOPAL EDUCATIONAL SOCIETY VILLAGE - MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI, CHHATTISGARH
4012 SAROJ GOPAL EDUCATIONAL SOCIETY MAHKAKURD, UTAI - GANIYARI ROAD UTAI, BHILAI
4013 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
4014 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
4015 SARSWATICHANDRA FOUNDATION TRUST SARSWATICHANDRA FOUNDATION TRUST 268C, MAIN ROAD, HMT LAYAUT RT NAGAR, BANGALORE KARNATAKA 560032
4016 SARSWATI EDUCATION AND WALFARE SOCIETY NEAR COMMUNITY HALL, KARTAR COMPLEX, LAWRENCE ROAD, JALALABAD-WEST
4017 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
4018 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
4019 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
4020 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
4021 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS,BARABANKI
4022 SARTHAK SUMERGANJ,RAMSANEHIGHAT,DIS.BARABANKI
4023 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
4024 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4025 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
4026 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
4027 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
4028 SARVA HITAISHI SHIKSHAN SAMITEE 49, SIDHHESHWAR COLONY JHABUA, M.P.
4029 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
4030 SARVAJANIK JANKALYAN PARMARTHIK NYAS SARVAJANIK JANKALYAN PARMARTHIK NYAS E-3/27-A, ARERA COLONY, BHOPAL MADHYA PRADESH - 462016
4031 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
4032 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
4033 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
4034 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4035 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
4036 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
4037 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4038 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4039 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4040 SARVODAYA FOUNDATION H.NO:- 16-11-739/A/1, 4TH FLOOR, FLAT NO:- 401, S.S. TOWERS ( BESIDES KAMALA HOSPITAL) DILSUKHNAGAR HYDERABAD – 500060, TELANGANA STATE
4041 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4042 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4043 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4044 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
4045 SARVODAYA VINDHY VIKASH SAMITI ADARSH NAGAR, BARA, DIST.- REWA (M.P.) 486001
4046 SARVODYA EDUCATIONAL TRUST 290 MAIN ROAD NEW PLOT JAMMU
4047 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
4048 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
4049 SARV SHRI MAA NARMADA SHIKHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALYAN SAGAR MP
4050 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
4051 SARV SHRI MAA NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD DEORI KALAN SAGAR
4052 SARV SHRI NARMADA SHIKSHA EVAM JAN KALYAN SEWA SAMITI BAZAR WARD, DEORI KALAN SAGAR MADHYA PRADESH
4053 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
4054 SATH SATH 04/332 VIJYANT KHAND GOMTI NAGAR LUCKNOW
4055 SATISH GRAMODHYOG SANSTHAN 57/54 (2) FREEGANJ SIDDHNATH TAKEEZ, NEAR-RAILWAY MAL GODAM BAHRAICH
4056 SATISH GRAMODYOG SANSTHAN SIDDHNATH TAKEEZ, RAILWAY MAL GODAM ROAD BAHRAICH
4057 SATISH GRAMODYOG SANSTHAN 57/54 (2) FREE GANJ SIDDHNATH TAKEEZ NEAR-RAILWAY MAL GODAM ROAD BAHRAICH
4058 SATMILE SATISH CLUB O PATHAGAR VILL-CHHAT ELAJAN, P.O.-ELAJANER KUTHI, DIST-COOCHBEHAR
4059 SATNAM KHADI GRAMODYOG SEWA SAMITI VILLAGE HARDASPUR POST DUBIHAN, GHAZIPUR, UTTAR PRADESH-
4060 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
4061 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
4062 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
4063 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DISTRICT NANDURBAR -MAHARASHTRA 425414
4064 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO-110 BHUJGAON TALUKA AKRANI DIST NANDURBAR
4065 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
4066 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
4067 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
4068 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
4069 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4070 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
4071 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
4072 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
4073 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
4074 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
4075 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
4076 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4077 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4078 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4079 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
4080 SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH P O CHERTHALA ALAPPUZHA
4081 SATYAM GRAMA SANGHAM SATYAM GRAMA SANGHAM CHERUVALLISSERIL MARARIKULAM NORTH.P.O CHERTHALA ALAPPUZHA KERALA
4082 SATYAM SATPUDA SAMAJ SEWA SAMITI 62,SHIKSHAK COLONY, KHAJARI ROAD, CHHINDWARA MADHYA PRADESH
4083 SATYAM SKILLS CENTER VISHAKAPATNAM
4084 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
4085 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
4086 SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE SAUMYA BEAUTY PARLOUR AND TRAINING INSTITUTE 319/1 HAMIRPUR RAOD RATH DISTRICT HAMIRPUR U.P. 210431
4087 SAUMYA BEUTY PARLOUR AND TRAINING INSTITUTE MOHAL SAUMYA BEAUTY PARLOUR,POST RATH DISTT HAMIRPUR U.P
4088 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
4089 SAVANT TECH SOL PRIVATE LIMITED SARAN COMPOUND, TARKESHWAR PATH, NAGESHWAR COLONY, BORING ROAD.
4090 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
4091 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
4092 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
4093 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
4094 SAWRAJ MINORITY FOUNDATION AT SATAMBA POST, BHANDEGAON, HINGOLI, MAHARASHTRA
4095 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
4096 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
4097 SBDA AT-GVBBGFHGFBFGB
4098 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
4099 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
4100 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
4101 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
4102 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
4103 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
4104 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
4105 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
4106 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
4107 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
4108 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45 H.G.B ROAD.
4109 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
4110 SCHEMATIC AIRCON AND AUTOMATION PRIVATE LIMITED 101 EAST WING MEGACENTER SOLAPUR ROAD HADAPSAR PUNE
4111 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
4112 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4113 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4114 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
4115 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4116 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
4117 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
4118 SCHOOL OF COMMUNITY SCIENCE AND TECHNOLOGY IIEST SHIBPUR DOWNING HALL WEST WING BOTANICAL GARDEN SHIBPUR HOWRAH
4119 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
4120 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
4121 SCL GLOBAL LOGISTICS INDIA PRIVATE LIMITED UNIT NO FF-C,ARMENIAN CENTRE.,OLD NO.71,NEW NO.94,ARMENIAN STREET,GEORGE TOWN,CHENNAI-600001
4122 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR
4123 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
4124 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPPOSITE KARIMPIN TASTE LAND, MC ROAD, NATTAKOM
4125 SCRONY EDUCATIONAL CHARITABLE TRUST GOOD SHEPHERD COLLEGE BUILDINGS, ETTUPADY ROAD, OPP. KARIMPIN TASTE LAND ,M C ROAD NATTAKOM
4126 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
4127 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
4128 SECOND INNING HOUSE H. NO. 380, J J COLONY, BLOCK – D, DSIDC, BAWANA, NEW DELHI – 110039, INDIA.
4129 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
4130 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
4131 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
4132 SEED AND TREE CONSULTANTS PVT LTD T12, DOOR NO 2004, BLURIDGE TOWNSHIP, HINJEWADI,PUNE
4133 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004, BLURIDGE , HINJEWADI PHASE 1
4134 SEED AND TREE CONSULTANTS PVT LTD T12 , DOOR NO 2004 , BLURIDGE HINJEWADI PHASE 1
4135 SEEDS VENTURE SOCIETY 2M-69,MAHATMAGANDHI NAGAR,KANKARBAGH,PATNA
4136 SEER SHIKSHA SMITI FIRDOS NAGAR BHOPAL
4137 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
4138 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
4139 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
4140 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
4141 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
4142 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
4143 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
4144 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
4145 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
4146 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
4147 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
4148 SERAPHIC IT SOLUTIONS A-501 NISHDIN AURA, MAHALAXMI NAGAR, INDORE CONTACT NO. 9644034142
4149 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
4150 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD BANGALORE-560001, KARNATAKA
4151 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
4152 SERVICE MASTER CLEAN LTD 112-113, 1ST FLOOR, RAMANASHREE ARCADE, 18 MG ROAD, BANGALORE-560001, KARNATAKA
4153 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST NEAR GOVT ITI, VENGIKKAL AND POST TIRUVANNAMALAI - 606604 TIRUVANNAMALAI TK & DIST OFFICE PH : 04175-233277
4154 SERVICE TRIBAL AND URBAN RURAL DEVELOPMENT FOUNDATION STAR FOUNDATION NO.1727/D3, ANNAMALAIYAR NAGAR EAST, NEAR GOVT. ITI., VENGIKKAL & POST, TIRUVANNAMALAI-606604, TIRUVANNAMALAI TK & DT., OFFICE PH : 04175-233277 MOB : 8610778503
4155 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
4156 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
4157 SETH G L SHIKSHAN SANSTHAN CITY PLAZA, IN FRONT OF BUS STAND, NEAR CHANDIGARH HOSPITAL, HANUMANGARH JUNCTION
4158 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
4159 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
4160 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
4161 SEVENTS CONSULTANTS PRIVATE LIMITED ROOM NO:-29, 3RD FLOOR, MARINE DRIVE, GCDA COMPLEX, KOCHI, KERALA
4162 SEVENTS CONSULTANTS PRIVATE LIMITED NO: 19, 3RD FLOOR,GCDA COMMERCIAL COMPLEX, MARINE DRIVE, KOCHI, KERALA
4163 SEVICA 1 SARAI KHAWAJA
4164 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
4165 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
4166 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
4167 SHABHGAI SHIKSHAN KENDRA SAHBHAGI SHIKSHAN KENDRA SAHBHAGI ROAD, CHHATHA MEEL (BEHIND POLICE FIRE STATION), SITAPUR ROAD, LUCKNOW-226201 (U.P.) INDIA, PHONE: 9452293783, 9935302536
4168 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
4169 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
4170 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
4171 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
4172 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
4173 SHAKSHI SAMAJ SEVI SANSTHA OPP. TEHSIL NAKUR, TOWN NAKUR, SAHARANPUR
4174 SHAKTHI KNITTING PRIVATE LIMITED LAND MARVEL FLAT NO. F-1, FIRST FLOOR NEW NO. 3, FIRST MAIN ROAD INDIRA NAGAR, ADAYAR CHENNAI. TAMILNADU
4175 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
4176 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
4177 SHAMBHAVI EDUSKILL CONSULTANTS OPC PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
4178 SHAMBHAVI EDUSKILL CONSULTANTS PRIVATE LIMITED 101,SURENDRA NATH ENCLAVE, PREM NAGAR, RD NO 4,LATMA, RANCHI, RANCHI, JHARKHAND, INDIA
4179 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
4180 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
4181 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
4182 SHANTI GD ISPAT AND POWER PRIVATE LIMITED HEAD OFFICE: 402 RAJEEV GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR PLANT ADDRESS: VILLAGE AMJHAR DISTRICT CHAMPA JANJGIR
4183 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
4184 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4185 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
4186 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4187 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL INFRONT OF SBI KIOSK 18 NO ROAD MOTHER TERESA NAGAR CAMP 01 WARD 20 BHILAI DURG CHHATTISGARH
4188 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
4189 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
4190 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
4191 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
4192 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
4193 SHARON INSUL INDIA LIMITED SHARON INSUL INDIA LIMITED SHARON TOWER, SEAPORT-AIRPORT TOAD, KAKKANAD, ERNAKULAM, KERALA
4194 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161, AGGRASAIN INDUSTRIAL AREA AGGRASAIN
4195 SHARP EDGE MANAGEMENT CONSULTANCY PRIVATE LIMITED 161 AGGRASAIN INDUSTRIAL AREA AGGRASAIN NAGAR
4196 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
4197 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
4198 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
4199 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
4200 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
4201 SHEVOM RUBBER INDUSTRIES PVT LTD 3/338 VISHWAS KHAND GOMTINAGAR, LUCKNOW
4202 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
4203 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
4204 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
4205 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
4206 SHIKSHA FOUNDATION GROUND FLOOR, CLIFTON PARK TOWER, NEAR SWAMINARAYAN COLLEGE, KANKARIA ROAD, SHAH ALAM ROLL NAKA, AHMEDABAD
4207 SHIKSHA PRASARINI SAMITI MADAN MOHAN MALVIYA VIDYA MANDIR PLOT NO 26 GHAZIPUR TIRAHA, SHAHDATPURA, MAU
4208 SHIKSHAUNNATI CHAPARER PAR ALIPURDUAR
4209 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR 222142 UP
4210 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
4211 SHIKSHA VISTAR SANSTHA HOUSE NO 40, SEC 9/2 , GANDHI NAGAR
4212 SHILP SHREE MAHILA SEWA SAMITI 1/256 VIKAS NAGAR LUCKNOW
4213 SHINE ACADEMY D.NO:12-4-582, OBULADEVA NAGAR, ANANTAPUR.
4214 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
4215 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
4216 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
4217 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
4218 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
4219 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JANSI.( U P)
4220 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
4221 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANJ, NEAR HOTEL AMBROSIA, SIPRI BAZAR, JHANSI.
4222 SHIVA GRAMODYOG SEWA SANSTHAN SHIVA CHAMBER, 368/1, NANAK GANG,NEAR HOTEL AMBROSIA,SIPRI BAZAR, JHANSI.
4223 SHIVALIK JAN KALYAN SAMITI SIDDHI VINAYAK BHAVAN OPP. ARYANS HOSPITAL KHALGHAT A.B. ROAD DIST. DHAR (MP)
4224 SHIVAM DEVANSH FAB PRIVATE LIMITED VILLAGE MOHALA, CHHAPROLA ROAD, SIKRI, BALLABGHGARH, FARIDABAD (HARYANA)
4225 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, JAFRABAD GODHRA 389001
4226 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE COLLEGE TO KANELAV ROAD, OPP. JAFARABAD GRAM PANCHAYAT, GODHRA
4227 SHIVAM EDUCATION AND RESEARCH FOUNDATION D-1, ANAND NAGAR SOCIETY, SCIENCE TO KANELAV ROAD, JAFRABAD, GODHRA
4228 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
4229 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
4230 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
4231 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
4232 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4233 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4234 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
4235 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
4236 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
4237 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
4238 SHIV EDUCATION SOCIETY NEAR MLN COLLEGE, RADAUR YAMUNA NAGAR,HARYANA
4239 SHIVPRABHU BAHUUDDESHIYA KRIDA SHIKSHAN VA SANSKRUTIK MANDAL BULDANA VISHNUWADI, CIRCULAR ROAD, BULDANA, TQ. DIST. BULDANA- 443001 MAHARASHTRA (INDIA)
4240 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
4241 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
4242 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
4243 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
4244 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
4245 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
4246 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
4247 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
4248 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
4249 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
4250 SHODH 180/22, ZAKIR NAGAR, OKHLA
4251 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
4252 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
4253 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
4254 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 35, SAI DWARKA, SHASTRI NAGAR
4255 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
4256 SHRAWASTI GRAMODYOG SEWA SANSTHAN VILLAGE- AURAIYA NIDHAN , POST- KATAHA, GILAUALA SHRAWASTI , PIN- 271835
4257 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4258 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4259 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
4260 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
4261 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
4262 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
4263 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
4264 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
4265 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD, JINTUR
4266 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR BHAJI MANDI ROAD JINTUR TQ JINTUR DIST PARBHANI
4267 SHREE BAHUUDDESHIYA SEVABHAVI SANSTHA JINTUR HOUSE NO 626 SHIVAJI NAGAR JINTUR TQ JINTUR DIST PARBHANI (MS)
4268 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
4269 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
4270 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
4271 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
4272 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
4273 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
4274 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
4275 SHREE JAINARAYAN GHOSAL SIKHSA SANSTHAN D 44/15, RAMAPURA, VARANASI, UTTAR PRADESH
4276 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
4277 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN,MATHURA
4278 SHREE KRISHNA SHIKSHA SAMITI 1132,ARYA NAGAR,KOSI KALAN
4279 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
4280 SHREE LAXMI COMPUTER CENTER LAXMI COMPUTER CENTER BASAVANA BAGEWADI
4281 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
4282 SHREE MAN MANDIR EDUCATION TRUST "RIVERA WAVE",OFFICE NO.902,9TH FLOOR,NEAR JADDU'S HOTEL,KALAVAD MAIN ROAD RAJKOT GUJARAT
4283 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
4284 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
4285 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
4286 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
4287 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
4288 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
4289 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
4290 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
4291 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
4292 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
4293 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
4294 SHREE RAM KRIPA BUILD HOME PRIVATE LIMITED 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
4295 SHREERAM OM REAL ESTATE 26 , BAJRANG VIHAR,BEHIND DURGAPURA RAILWAY STATION,DURGAPURA JAIPUR
4296 SHREE RAM VOCATIONAL AND CULTURAL SOCIETY WZ-54, WEST PATEL NAGAR, NEAR METRO PILLAR NO. 219, NEW DELHI-110008
4297 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
4298 SHREE SANT GADGEBABAB BAHUDDESHIY SHIKSHAN SANSTHA KIRAN NAGAR NO 1 AMRAVATI 444606 S P GODE HOUSE KIRAN NAGAR NO 1 NEAR SAI MANDIR AMRAVATI
4299 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
4300 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
4301 SHREE SHERA EDUCATIONAL TRUST SHREE SHERA EDUCATIONAL TRUST(R),C/O COMMUNITY PLOYTECHNIC BELLARE,SHAHIN MAAL ,IIND FLOOR,OPP KSRTC BUS STAND,BELLARE,BELLARE POST,SULLYA TALLUK,DHAKSHINA KANNADA DIST,KARNATAKA STATE
4302 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
4303 SHREE VIDYA NIKETAN TRUST #353/1903, AIGINIA, PATRAPADA, BHUBANESWAR, ODISHA
4304 SHREE VIDYA NIKETAN TRUST #353/1901, NEAR NIRUPAMA APPARTMENT, NAYAPALLI, BHUBANESWAR,ODISHA
4305 SHRESTH WELFARE TRUST SHRESTH WELFARE TRUST PRAGATI WEB WORLD NEAR DR. SONALI DESHMUKH HOSPITAL RUKHMINI NAGAR AMRAVATI
4306 SHREYA PETROCHEM PRIVATE LIMITED SHREE NIKETAN,380,ASHOK NAGAR-UDAIPUR - 313001
4307 SHREYA PETROCHEM PRIVATE LIMITED KRISHNA KAUSAHL - GATTANI SQURE,HARIDAS JI KI MAGRI UDAIPUR
4308 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
4309 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
4310 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
4311 SHRI BALAJI INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED DUBEY COLONY MOWA RAIPUR
4312 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
4313 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI, RAIPUR, CHHATTISGARH
4314 SHRI BHAGWAN MAHAVEER JAIN EDUCATIONAL AND CULTURAL SOCIETY MATS TOWER, PANDRI,
4315 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
4316 SHRI CHHTRAPATI SHIVAJI VIDYA PRASARAK MANDAL PLOT NO 16 BABU NETAJI SUDHASHCHANDRA COLONY BORSE NAGAR GONDUR ROAD DEOPUR DHULE
4317 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
4318 SHRI DADASAHEB GAWAI CHARITABLE TRUST AMRAVATI CONGRESS NAGAR ROAD SHYAM NAGAR AMRAVATI
4319 SHRI DAUJI REWATI INFRABUILD PRIVATE LIMITED H. NO. 31/177-A, PREM NAGAR, RAJPUR CHUNGI AGRA AGRA UTTAR PRADESH 282001
4320 SHRI DEEP CHAND EDUCATIONAL SOCIETY FLAT 2B SWASTIK APARTMENT, E 39 VISHWAS PARK UTTAM NAGAR NEW DELHI
4321 SHRI DIGAMBER PRASHIKSHAN AVAM ANUSANDHAN SANSTHAN A-131, RANJEET NAGAR, BHARATPUR RAJASTHAN
4322 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
4323 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHANIVILL), SEJBAHAR (PO) RAIPUR
4324 SHRI GANGAJALI EDUCATION SOCIETY SSIPMT, OLD DHAMTARI ROAD, MUJGAHAN (VILL), SEJBAHAR (PO) RAIPUR
4325 SHRI GHARSHI RAM SHIKSHA SAMITI VILL-DHANI KIRAROD, POST-DHARSON
4326 SHRI GHARSI RAM SHIKSHA SAMITI VILL- DHANI KIRAROD,POST- DHARSOUN
4327 SHRI GOPAL DARBAR LOK KALYAN SAMITI GANDHI NAGAR MAHOBA UP
4328 SHRI GOPAL DARBAR LOK KALYAN SAMITI GHATKOTRA MAURANIPUR
4329 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED
4330 SHRI GURU GOBIND SINGHJI INSTITUTE OF ENGINEERING AND TECHNOLOGY LATUR ROAD, VISHNUPURI, NANDED, MAHARASHTRA
4331 SHRI GURU HARGOVIND SOCIETY 13, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4332 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
4333 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4334 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
4335 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
4336 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST 408, AGGARWAL PRESTIGE MALL, PLOT NO. 02, COMMUNITY CENTRE, PITAMPURA, DELHI
4337 SHRI JAGANNATH MEMORIAL EDUCATIONAL TRUST STANFORD INTERNATIONAL SCHOOL,MERRUT-SONEPAT ROAD, PALRI, NEAR GLAXO COMPANY, SONEPAT
4338 SHRI JAGDAMBA BAL VIDYA MANDIR SULTANGARH FATEHPUR UP VILL SULTANGARH SULTANGARH BINDKI
4339 SHRI JAGDAMBA MATA SHIKSHAN KRIDA BAHUUDDESHIYA SANSTHA TAMBOLA AT POST TAMBOLA TA LONAR DIST BULDHANA
4340 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
4341 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
4342 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
4343 SHRI JYOTI SERVICES P LTD H-17 IST FLOOR, SOUTH EXTENTION-I DELHI DL 110049 IN
4344 SHRI JYOTI SERVICES PVT LTD H.NO 17, 1ST FLOOR,SOUTH EXTENSION,DELHI
4345 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS SHRINAGAR COLONY MAHESHWAR ROAD MANDLESHWAR
4346 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS SHRINAGAR COLONY MANDLESHWAR
4347 SHRIKANWARTARA CHHAJED PARMARTHIK NYAS MAHESHWAR ROAD SHRINAGAR COLONY MANDLESHWAR
4348 SHRI KHANDERAI BAHUUDESHIYA VIKAS SANSTHA GAYATRI APPARTMENT ,FLAT NO-8,GOAPLAWADI,TAL-DAUND,DIST-PUNE
4349 SHRI KHANDERAI BAHUUDESHIYA VIKAS SANSTHA GAYATRI APPARTMENT ,FLAT NO-8,GOAPLAWADI,TAL-DAUND,DIST-PUNE
4350 SHRI KHERAPATI MAHARAJ SHIKSHA SAMITI BRIJPUR ROAD, ARROO TIRAHA, DABRA
4351 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
4352 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
4353 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
4354 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
4355 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED MAHARASHTRA
4356 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI TQ.DIST.NANDED. MAHARASHTRA
4357 SHRIKRUSHNA BAHUUDDESHIY SEVABHAVI SANSTHA AT.POST.PAWDEWADI. TQ.DIST.NANDED. MAHARASHTRA
4358 SHRI LIXMAN SINGHJI MEMORIAL EDUCATIONAL AND WELFARE SOCIETY MARWAR MUNDWA UNCHI GALI, MARWAD MUNDWA VILLAGE AND TEHSIL MARWAD MUNDWA, DISTRICT NAGAUR
4359 SHRI MAHALAXMI MULTI PURPOSE CO OP SOCIETY LTD TOPINKATTI, TAL: KHANAPUR, DIST: BELGAUM
4360 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
4361 SHRI MAHAVEER SEVA SMITI RAJA BHOJ PVT ITI CAMPUS, WARD, NO.52 SANJAY NAGAR MISROD, BHOPAL (M.P.) 462026
4362 SHRI MOHANRAO DESHPANDE EDUCATION SOCIETY A/P-AJRA, TAL-AJRA, DIST-KOLHAPUR, MAHARASHTRA
4363 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
4364 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
4365 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
4366 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
4367 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
4368 SHRI OM NAMO SHIKSHAN SANSTHAN V/P - BORUNDA, TEH.- PIPARCITY DIST.- JODHPUR RAJASTHAN
4369 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4370 SHRI PITAMBRA VIDHYAPEETH NYAS JR MIG 1/1 GEETANJALI COMPLEX KOTRA SULTANABAD BHOPAL
4371 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4372 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4373 SHRI PITAMBRA VIDHYAPEETH NYAS JR. M.I.G.1/1 GEETANJALI COMPLEX KOTRA BHOPAL
4374 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
4375 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
4376 SHRI RAMANA FOUNDATION 26F/16 RMS ROAD, NAGAL NAGAR,DINDIGUL
4377 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4378 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4379 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
4380 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITI KARAHI
4381 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITI KARAHI
4382 SHRI RAM PUBLIC SCHOOL SHIKSHA SAMITIA KARAHIFATEHPURSIKRIAGRA
4383 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
4384 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
4385 SHRI RAM SIKHAN AWM SEVA SANSTHAN VILL-KUSHMAHA(BHAGWANAPUR),VIA-LAXMIGUNJ,DIST-KUSHINAGER(U.P.)274305
4386 SHRI RAM SKILLS DEVELOPMENT PRIVATE LIMITED MAIN BARWALA ROAD, VIRAT NAGAR,HANSI, DIST HISAR.
4387 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4388 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4389 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4390 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
4391 SHRI SADGURU SAI SAMARTH JEEVAN ADHAR SAMAJIK SANSTHA BRANCH GADHINGLAJ BHADGAON ROAD,DOCTOR COLONY,NEAR SHIVSAGAR HOTEL,GADHINGLAJ
4392 SHRI SAI EDUCATIONAL AND WELFARE ASSOCIATION 376/1 SECTOR-5 VASUNDHARA GHAZIABAD
4393 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
4394 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
4395 SHRI SHIKSHA PRASAR EVAM JANKALYAN SAMITI 26,BAJARIYA MOHALLA SEONDHA DISTT DATIA MADHYA PRADESH
4396 SHRISHTI HELPING HANDS WELFARE SOCIETY A-602 NEW ASHOKA GARDEN, 80 FEET ROAD,BHOPAL
4397 SHRI SIDDHIVINAYAK EDUCATION SOCIETY CINEMA ROAD WARD NO 6 JUNNARDEO
4398 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
4399 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
4400 SHRI SWAMY RAMA FOUNDATION TRUST THE SWAMI RAM FOUNDATION TRUST, RAM NAGAR, SWAMI RAM MARG, VILLAGE BHUREWALA NARIANGARH134 203, DISTTAMBALA, HARYANA, REWA, HARYANA, INDIA
4401 SHRI THAKUR JI EDUCATIONAL WELFARE TRUST 17/213 BHARAULI BAZAR STATION ROAD, DEORIA
4402 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENT,16/1 SOUTH TUKOGANJ, INDORE
4403 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
4404 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APARTMENTS,16/1 SOUTH TUKOGANJ INDORE
4405 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
4406 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
4407 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
4408 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
4409 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
4410 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
4411 SIDDIQE MEMORIAL FOUNDATION PAPU PICTER PLACE SUJAWALPUR PO+PS-SAKRA MUZAFFARPUR
4412 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
4413 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
4414 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
4415 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
4416 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
4417 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
4418 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
4419 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
4420 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT GOVINDPURI NEW DELHI
4421 SIGNITIVE SKILLS INDIA PRIVATE LIMITED 1795/8 BASEMENT F/S GOVINDPURI EXTENTION NEW DELHI 110019
4422 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
4423 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
4424 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
4425 SIKSHYA BHARATI TRUST SIKSHYA BHARATI TRUST COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK STATE-ODISHA
4426 SIKSHYA BHARATI TRUST AT-COLLEGE ROAD, BANKI PO-BANKI DIST-CUTTACK
4427 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
4428 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
4429 SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED SILVER OAK SHOPS AND OFFICES COOPERATIVE HOUSING SOCIETY LIMITED, SILVEROAK COLLEGE OF ENGINEERING AND TECHNOLOGY, 352,353 A , NR. BHAVIK PUBLICATIONS, OPP. BHAGWAT VIDYAPITH, S.G.HIGHWAY, AHMEDABAD- 382481
4430 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
4431 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4432 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4433 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4434 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4435 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4436 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4437 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
4438 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
4439 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
4440 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
4441 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
4442 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
4443 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
4444 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
4445 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
4446 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
4447 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
4448 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
4449 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
4450 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
4451 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
4452 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
4453 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
4454 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
4455 SISHU KALYANA SWADHIKARA KENDRA HEAD OFFICE AT - RUGUDIPARA, SAI MANDIR LANE PO/DIST - BALANGIR, ODISHA
4456 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
4457 SITA INFRA AND SERVICES PVT LTD "SITA INFRA AND SERVICES 301,JUBEAD COMPLEX,EXIBTION ROAD,PATNA"
4458 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
4459 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
4460 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
4461 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
4462 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
4463 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
4464 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO-VC-2, MAHALUXMI PLAZA, SEC-3, VAISHALI, GHAZIABAD
4465 SJP HOTELS AND RESORTS PRIVATE LIMITED C-1 & C-2, MAHALUXMI METRO TOWER, SECTOR-4, VAISHALI
4466 SJP HOTELS AND RESORTS PRIVATE LIMITED PLOT NO. V-2, MAHALUXMI PLAZA, SECTOR-3, VAISHALI, GHAZIABAD
4467 SJS SKILLS DEVELOPMENT CENTER A UNIT OF SHRI JYOTI SERVICES P LTD SM KUTEER ,92 CIVIL LINE MEERUT CANTT
4468 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
4469 SKILL CUBE PVT LTD SUNCITY SUCCESS TOWER , UNIT NO 419-419A ,4TH FLOOR,SECTOR 65 , GURUGRAM
4470 SKILL DEVELOPMENT AND INFORMATION SOCIETY LIG-147 DINDAYAL COLONY, BHILAI
4471 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
4472 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
4473 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
4474 SKILL INDIA ENTERPRISE PRIVATE LIMITED BH-27, BAPAT CHOURAHA, SUKHLIYA
4475 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
4476 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
4477 SKILL POINT CAREER DEVELOPMENT WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYAPALAYAM,
4478 SKILL POINT CAREER WELFARE TRUST 64,INDIRA GANDHI STREET, PALAYA PALAYAM,ERODE
4479 SKILLPRO TECHNOLOGIES PVT LTD 2ND FLOOR, 33 SUBASH ROAD, DEHRADUN UTTARAKHAND
4480 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
4481 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
4482 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
4483 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
4484 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
4485 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
4486 SKILL VISION SOCIAL EDUCATIONAL SOCIETY 81 KOHARAPEER THALIWALAN CHOWK BAREILLY
4487 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
4488 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
4489 S K MANDAL FOUNDATION ROAD NO.-5, PURVI PATEL NAGAR , NEAR GANDHI MURTI , PATNA
4490 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
4491 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
4492 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
4493 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
4494 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TECHNICAL INSTITUTE, SHREE AMBALAL UPADHYAY SAHAKAR BHAVAN, NR. SAHAKAR HALL, AMBAWADI
4495 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
4496 SKY ORGANAIZATION HEBBAGODI, HOSUR ROAD BANGALORE. ANEKAL TQ BANGALORE DIST.
4497 SLC EDUCATIONAL SOCIETY 101, 1-11-112/2 CHAKRAVARTHY TOWERS SHYAMLAL BUILDINGS BEGUMPET, HYDERABAD
4498 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
4499 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
4500 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
4501 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
4502 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
4503 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING LAYOUT, MUNNEKOLLALA, MARATHAHALLI
4504 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARATHAHALLI, ABOVE DOMINO OR IMPERIAL HOTEL
4505 SMARTGRO MARKETING PRIVATE LIMITED 1, SAROJ SQUARE, 2ND FLOOR, SILVER SPRING ROAD, MUNNEKOLLALA, MARATHAHALLI, BANGALORE
4506 SMART MODERN SHIKSHAN SANSTHAN VPO- BAGHOLI TEH-UDAIPURWATI DIST-JHUNJHUNU RAJASTHAN
4507 SMARTONE TECHNO SOFT PRIVATE LIMITED NARURANGABAD, COURT ROAD, ETAWAH-206001
4508 SMART SKILL TECH PRIVATE LIMITED PLOT NO 137 SEC 24
4509 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
4510 SMARTTRICKTECH PRIVATE LIMITED GROUND FLOOR SHOP NO 1MOHALLA CHAWAD BY PASS ROAD SASNI
4511 SMART ZONE GUNJABARI
4512 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
4513 SMITA MAHILA SHIKSHAN SANSTHAN 567 ANAND COLONY BALDEOBAG JABALPUR MADHYA PRADESH 482002
4514 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
4515 SMT DEVKI DEVI SEVA SAMITI LIG 123 GOVINDPUR ALLAHABAD
4516 SMT DEVKI DEVI SEVA SAMITI L.I.G. GOVIND PUR ALLAHABAD
4517 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
4518 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
4519 SMYAK MAGASVARGIYA BAHUUDESHIYA SEVABHAVI SANSTHA JALNA SMYAK NIVAS PLOT NO 20,NEAR VRUNDAVAN NARSARI BHAGYA NAGAR OLD JALNA
4520 SMYAK MAGASVARGIYA BAHUUDESHIYA SEVABHAVI SANSTHA JALNA 1ST FLOOR LUCKY PAINT NUTAN VASAHAT ABAD ROAD JALNA
4521 SNAP NEAR MANIPAL HOSPITALS
4522 SNC INFOTECH PRIVATE LIMITED KC-114, KAVI NAGAR , GHAZIABAD
4523 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
4524 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
4525 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
4526 SNS FOUNDATION 508, 3RD FLOOR, JAISWAL COMPLEX, SAKCHI, JAMSHEDPUR EAST SINGHBHUM
4527 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8­3­1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4528 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
4529 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
4530 SOCIAL AGRICULTURE CHILDRENS EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMABAKKUDI TALUK, PUDUKKOTTAI DISRICT.
4531 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
4532 SOCIAL AWARENESS RURAL INTEGRATION TECHNICAL ASSOCIATION VILLMADHUPUR MEERANPUR , POSTBALA PAICKOULI ,(GOSHAINGANJ)DISTT AMBEDKAR NAGAR , PIN CODE 224141
4533 SOCIAL DEVELOPMENT ORGANISATION H.NO. 50, MASOUD ALI BUILDING, TAAJ LEIRAK, HAFIZ HATTA, IMPHA EAST,MANIUR -7095001
4534 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
4535 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 3 HOUSE NO C 31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR
4536 SOCIAL EDUCATION AND LIBERTY FOUNDATION GALI NO 4 HOUSE NO C-31 SHANI BAZAR NANHEY PARK NAWADA UTTAM NAGAR NEW DELHI
4537 SOCIAL JUSTICE AND DEVELOPMENT INDIA HAUBUANGI BUILDING,CANTEEN KUAL DAWRPUI SOUTH AZIAWL MZORAM
4538 SOCIAL ORGANISATION FOR TRANSFORMATION C/O SHALI BHADRA MUTHA ,255, IN FRONT OF GOPAL MANDIR,MAIN ROAD, SADAR MARKET,RAIPUR,C.G.
4539 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
4540 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
4541 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
4542 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
4543 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
4544 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
4545 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
4546 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
4547 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT CHITRAGUPTA COLONY, BEHIND GODDA COLLEGE, GODDA
4548 SOCIETY FOR ADVANCEMENT IN TRIBES HEALTH EDUCATION AND ENVIRONMENT SATHEE (SOCIETY FOR ADVANCEMENT IN TRIBES, HEALTH, EDUCATION AND ENVIRONMENT) CHITRAGUPTA COLONY BEHIND GODDA COLLEGE, GODDA-814133 JHARKHAND
4549 SOCIETYFORADVANCEMENTINTRIBESHEALTHEDUCATIONANDENVIRONMENTSATHEE CHITRAGUPTA COLONY,BEHIND GODDA COLLEGE,GODDA
4550 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
4551 SOCIETY FOR AWARENESS AND INVOLVEMENT FOR FUTURE IMPROVEMENTS DOOR NO. 11-2-165, MARKET STREET, RAYADURG, ANANTHAPUR DIST
4552 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
4553 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
4554 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
4555 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
4556 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
4557 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
4558 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
4559 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
4560 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
4561 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
4562 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
4563 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
4564 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
4565 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
4566 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEVELOPMENT VILLAGE & P.O- KANISHAIL P.S & DISTRICT- KARIMGANJ
4567 SOCIETY FOR EDUCATION AND SOCIAL ACTIVITIES FF-31, SF-30,31,19,VATSALYA STATUS, OPP RAILWAY STATION, KADI
4568 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
4569 SOCIETYFORHEALTHACTIONDEVELOPMENTANDENVIRONMENTALSERVICES PLOT NO-468/3A, SHREE VIHAR, PATIA, CHANDRASEKHARPUR, BHUBANESWAR
4570 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
4571 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
4572 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
4573 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
4574 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
4575 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
4576 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
4577 SOCIETY FOR INFRASTRUCTURAL PROMOTION AND RURAL ADVANCEMENT AT- GANGANIWAS, NEW RAUSAPATANA PO-BAXIBAZAR PS-PURIGHAT, DIST - CUTTACK
4578 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.) 05922-262075,09410681250
4579 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.)
4580 SOCIETY FOR INSTITUTE OF PSYCHOLOGICAL RESEARCH AND HEALTH 247/3 MOHAMMADI SARAI OPP. HEERA LAL PAL ADVOCATE AMROHA-244221 DISTT. AMROHA (U.P.)
4581 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
4582 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
4583 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
4584 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
4585 SOCIETY FOR RESOURCE INTEGRATION AND DEVELOPMENT ACTION SRIDA CENTRE POST - BARELA MANDLA ROAD, JABALPUR DISTRICT
4586 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
4587 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
4588 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
4589 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4590 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4591 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI,NEW DELHI-110075
4592 SOCIETY FOR SOCIAL SECURITY AND EMPOWERMENT PLOT NO 462, DWARKA SECTOR 19, BEHIND SBI, NEW DELHI
4593 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
4594 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
4595 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
4596 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
4597 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
4598 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
4599 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
4600 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
4601 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
4602 SOCIETY TOWARDS OPERATION POLLUTION REGISTERED OFFICE: R-613, MANGOL PURI, BRANCH OFFICE: H.NO. RZB- 10 KH.NO. 79/16/2, NIHAL VIHAR, NANGLOI
4603 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
4604 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
4605 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
4606 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
4607 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
4608 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
4609 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
4610 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
4611 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4612 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4613 SOMANY FOUNDATION RZ-43, WEST SAGARPUR, GEETANJALI PARK, NEW DELHI
4614 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
4615 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
4616 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
4617 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
4618 SOMYA SKILLS AND EDUCATION PVT LTD 9 A, RAM NAGAR, MOTI BUNGLOW, DEWAS
4619 SONAPUR PALLY UNNAYAN SAMITY SONAPUR PART-I,PO-SONAPUR,DISTRICT-CACHAR
4620 SONARPUR SWAMI VIVEKANANDA MANAS MISSION VILL- GHASIARA, P.O.+P.S.- SONARPUR, DIST-SOUTH 24 PARGANAS, KOLKATA-700150, WEST BENGAL
4621 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
4622 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
4623 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
4624 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4625 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4626 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
4627 SONY XPERIA FGFDGFGFD
4628 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
4629 SOS CARE C-88/A, GF, KAUSHIK SADAN, GALI NO.3, JANTA GARDEN, PANDAV NAGAR, DELHI-110091
4630 SOS CARE INDIA C-88/A,GF, GALI NO.3,KAUSHIK SADAN, JANTA GARDEN,PANDAV NAGAR,DELHI-91
4631 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
4632 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
4633 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR
4634 SOSS INFRA WELFARE SOCIETY VILL-KAUSHALPUR POST-RAMANUJNAGAR DIST-SURAJPUR (CG)
4635 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
4636 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 2 FERN ROAD 2ND FLOOR KOLKATA 700019
4637 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 2 FERN ROAD 2ND FLOOR KOLKATA 700019
4638 SOUTH BENGAL SOCIETY OF MANAGEMENT STUDIES 74 TOPSIA ROAD SOUTH TOPSIA KOLKATA 700048
4639 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
4640 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
4641 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, PIN - 700031
4642 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
4643 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
4644 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
4645 SOUTH VIHAR WELFARE SOCIETY FOR TRIBAL HNO 134 KHUNTI BHAWAN SOUTH OFFICE PARA DORANDA RANCHI
4646 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
4647 SPANDANA SWAYAM SEVA TRUST NEAR TALUK OFFICE AZAD RODE THIRTHAHALLI SHIMOGA KARNATAKA 577432
4648 SPARK HEALTH CLINICAL SERVICES PRIVATE LIMITED PLOT NO: 2 & 3, GROUND FLOOR, PANKAJ TOWERS, RAGHAVENDRA COLONY, PEERJADI GUDA, UPPAL, HYDERABAD
4649 SPARSH 310 CHANDRALOK TOWER KAPOORTHALA, LUCKNOW
4650 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
4651 SPBL ENERGY PVT LTD 901 B BLOCK PANKI
4652 SPBL ENERGY PVT LTD 901 B BLOCK PANKI
4653 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
4654 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
4655 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
4656 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
4657 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
4658 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
4659 S P GRAMYA VIKAS AVAM GRAMODYOG SANSTHAN 636/431 TAKROHI POST CHINHAT SECTOR 11 INDIRA NAGAR LUCKNOW UP
4660 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
4661 SR ASIA 4F-CS-25, ANSAL PLAZA, VAISHALI, GHAZIABAD INDIA
4662 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
4663 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
4664 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
4665 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
4666 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
4667 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
4668 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
4669 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
4670 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
4671 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
4672 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
4673 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
4674 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
4675 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
4676 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
4677 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
4678 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
4679 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
4680 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
4681 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
4682 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
4683 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
4684 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
4685 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
4686 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY SRI ANJENAYASWAMY EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY, SIDDAPURA
4687 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
4688 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
4689 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
4690 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA
4691 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
4692 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
4693 SRI BALAMBAL MEMORIAL TRUST 36, NEYVELI MAIN ROAD, VALADUR 607303
4694 SRI BALAMBAL MEMORIAL TRUST 36, NEYVELI MAIN ROAD, VADALUR, KURINJIPADI TK, CUDDALORE DIST, TAMILNADU
4695 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
4696 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
4697 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
4698 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
4699 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
4700 SRI BUDDALA NARSIMHAMURTHY SEVA SANGHAM D.NO:8-252/5,DRIVERS COLONY, TETALI, TANUKU WEST GODAVARI DISTRICT, ANDHRA PRADESH
4701 SRI BUDDALA NARSIMHAMURTHY SEVA SANGHAM D.NO:8-252/5,DRIVERS COLONY, TETALI, TANUKU WEST GODAVARI DISTRICT, ANDHRA PRADESH
4702 SRI BUDDALA NARSIMHAMURTHY SEVA SANGHAM D.NO:8-252/5,DRIVERS COLONY, TETALI, TANUKU WEST GODAVARI DISTRICT, ANDHRA PRADESH
4703 SRI BUDDALA NARSIMHAMURTHY SEVA SANGHAM D.NO:8-252/5,DRIVERS COLONY, TETALI, TANUKU WEST GODAVARI DISTRICT, ANDHRA PRADESH
4704 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
4705 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
4706 SRI GOKULAM TRUST 13,KALIAMMAN KOVIL ST, KOOMAPATTI, SRIVALLIPUTHUR TK, VIRUDHUNAGAR DT
4707 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
4708 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
4709 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
4710 SRI JYOTHI HUMAN RESOURCES WELFARE ASSOCIATION 23-66/A/1/ MADHURA NAGAR SHAMSHABAD,9490324304
4711 SRI KALAI HERBAL BEAUTY PARLOUR MAHILA SANGHA #141 NEW 7 11 MAIN 1ST CROSS K P AGRAHARA BANGALORE
4712 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
4713 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
4714 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
4715 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
4716 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4717 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4718 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
4719 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
4720 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
4721 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
4722 SRI KRISHNA EDUCATION TRUST SRI KRISHNA EDUCATION TRUST, SHISHYA BEML PUBLIC SCHOOL, DR. AMBEDKAR ROAD, BEML TOWNSHIP, NEW THIPPANSANDRA, BANGALORE
4723 SRI KUMARAGURU MILL SRI KUMARAGURU MILL, KG HOUSE, 126 ARTS COLLEGE ROAD, COIMBATORE
4724 SRI KUMARAGURU MILL LTD KG HOUSE, 126 - ARTS COLLEGE ROAD, COIMBATORE
4725 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
4726 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
4727 SRI LALDEO MEERA FOUNDATION MEERA BHAWAN,MAIN ROAD KOERIA TOLA,RAXAUL,EAST CHAMPARAN,BIHAR-845305
4728 SRIMAD DAYANAND SWARSWATI SIKHSHA SAMITI VEDPRKASH BRHMADEV VILLAGE-DHORIKUTI POST-RAYA
4729 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
4730 SRI MAHESWARA EDUCATIONAL TRUST SET HOME ADDRESS: 1/154,SILLARAHALLI (VILL & PO),PAPPIREDDIPATTI (TK),DHARMAPURI (DT)-635303. OFFICE ADDRESS:SRI GURU MAHESWARA PARAMEDICAL INSTITUTION,PAPPIREDDIPATTI ( VILL & PO & TK),DHARMAPURI (DT)
4731 SRI MAHESWARA EDUCATIONAL TRUST SET 1/154,SILLARAHALLI VILL & PO,PAPPIREDDIPATTI TK,DHARMAPURI DT,TAMILNADU,INDIA
4732 SRI MALAYAMMAN EDUCATIONAL TRUST SRI MALAYAMMAN EDUCATIONAL TRUST(OLD RAGHAVENDRA SCHOOL) NO 738, DR. RADHAKRISHNAN NAGAR, 4TH CROSS,MADURAPURI, THURAIYUR 621010
4733 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
4734 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
4735 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
4736 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
4737 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
4738 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
4739 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4740 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
4741 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4742 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
4743 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
4744 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
4745 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
4746 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
4747 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
4748 SRI RADHA KRISHNA INFOTECH PRIVATE LIMITED B-172, B BLOCK, BHARAT VIHAR KAKROLA, NEW DELHI - 110078, INDIA
4749 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
4750 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4751 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
4752 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
4753 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4754 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
4755 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
4756 SRIRAM AND PRITAM MEMORIAL COMMUNITY DEVELOPMENT SOCIETY 40-246, RAGAVENDRA NAGAR , MOULALI-ALI, HYDERABAD
4757 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
4758 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: DOOR NO: 75621, FLOT NO.8, JETTI DELUX APARTMENT, PRAKASH NAGAR, RAJAHMUNDRY533103. EAST GODAVAI DISTRICT.
4759 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
4760 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
4761 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
4762 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
4763 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
4764 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
4765 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
4766 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
4767 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
4768 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
4769 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
4770 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
4771 SRI SATHYA SAI EDUCATIONAL AND CHARITABLE TRUST M/S.DR.M.G.R INSTITUTRE CAMPUS, NO.8,NEDUMARAN NAGAR
4772 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
4773 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
4774 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
4775 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
4776 SRI SHAMBHAVI VIDYA BHARATHI EDUCATIONAL AND CULTURAL SOCIETY D.NO: 1-4-193, VIJAYA HIGH SCHOOL, BOIWADA, NIRMAL, TELANGANA
4777 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
4778 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
4779 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
4780 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
4781 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY YASHODAGANASHREE NILAYA 8TH CROSS, SAPTHGIRI EXTN. TUMKUR-
4782 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
4783 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATRE, M.G.ROAD, TUMKUR
4784 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
4785 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4786 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4787 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
4788 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
4789 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
4790 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
4791 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
4792 SRISTI FOUNDATION 8TH FLOOR , RESHMI COMPLEX , P & T COLONY , KIDWAIPURI , PATNA
4793 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
4794 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
4795 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
4796 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
4797 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
4798 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
4799 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
4800 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
4801 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
4802 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
4803 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
4804 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
4805 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
4806 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4807 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
4808 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
4809 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4810 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI TALUK, THIRUVALLUR DISTRICT
4811 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
4812 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI, THIRUVALLUR DISTRICT
4813 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
4814 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
4815 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
4816 SRI VIRU MAHILA EDUCATIONAL INDUSTRIES CULTURAL AND SOCIAL SERVICE TRUST HIREMALLI DAVANGERE(D)
4817 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
4818 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
4819 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
4820 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
4821 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
4822 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
4823 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
4824 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
4825 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
4826 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
4827 SRM MULTISERVICES PRIVATE LIMITED 78 NEAR WATER TANK MUNSHIGANJ SITAPUR
4828 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
4829 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
4830 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
4831 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
4832 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
4833 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
4834 SSC DDHGH
4835 SS COMPUTERS SS COMPUTER, 2/237, LALIGAM ROAD, NALLAMPALLI.
4836 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
4837 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
4838 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4839 SSM EDUCATION PVT LTD SSM GROUP 1ST FLOOR, SCO-227, SECTOR-10 NEAR NEW BUS STAND HUDA MARKET
4840 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
4841 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4842 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
4843 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
4844 SSR SERVICES INDIA LLP #17-83/3, BRUNDHVANAM GARDENS, OPP GOVT HOSPITAL, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRA PRADESH, INDIA
4845 SSR SERVICES INDIA LLP # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
4846 SSR SERVICES INDIA LLP 17-89/4, MAIN ROAD, OPP SBI, PENDURTHY, VISAKHAPATNAM-531173, ANDHRAPRADESH
4847 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
4848 STANDARD IT SOLUTIONS STANDARD IT SOLUTIONS #402 POOJITHA ESTATES MIG-5 ROAD NO-1 KPHB HYDERABAD
4849 STANDARD PUBLICITY PRIVATE LIMITED STANDARD PUBLICITY PRIVATE LIMITED 7/1 C LINDSAY STREET , 1ST FLOOR. KOLKATA – 700087
4850 STARBRU TECHSYSTEMS PRIVATE LIMITED 103,SUKHMANI APARTMENT,VISHNUPURI, AB ROAD , INDORE(M.P.)
4851 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
4852 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4853 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
4854 STARLINE HOLIDAYS PRIVATE LIMITED 234, POCKET-4, ROHINI, NEW DELHI-110085
4855 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
4856 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
4857 STAR SCHOOL SAMITI SHIV KUMAR SINGH INSTITUTE OF TECHNOLOGY AND SCIENCE RAU NEAR IIM PITHAMPUR BYPASS ROAD INDORE
4858 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
4859 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
4860 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
4861 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4862 STAR SECUTECH PRIVATE LIMITED STAR SECUTECH PRIVATE LIMITED C 77, SECTOR 2, NOIDA
4863 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4864 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4865 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
4866 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
4867 STAR SPECTRUM SECURITY PRIVATE LIMITED K.NO. 1147, I & II FLOOR, RITHALA INDL. AREA, NEAR RITHALA METRO STATION, RITHALA DELHI 110085
4868 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
4869 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
4870 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
4871 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
4872 STEP AHEAD FOUNDATION 410,4TH FLOOR, SUNDARAM BUILDING, RDC, RAJ NAGAR, GHAZIABAD.
4873 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
4874 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
4875 STEP TO FORWARD SANSTHAN 43, D NEW CIVIL LINES FATEHPUR
4876 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
4877 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
4878 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
4879 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
4880 ST MARYS TAILORING AND CHARITABLE TRUST 4/122,AMBATHKAR STREET,KUDUMIYAMPATTI,ACHALVADI PO,HARUR TK,DHARMAPURI DT,TAMILNADU,INDIA-636903
4881 ST MARYS TAILORING AND CHARITABLE TRUST 4/112,AMBATHKAR STREET,KUDUMIYAMPATTI,ACHALVADI PO,HARUR TK,DHARMAPURI DT-636903
4882 ST MARYS TECHNOLOGICAL FOUNDATION PLOT NO.102, HIGH COURT COLONY, VANASTHALIPURAM, HYDERABAD
4883 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
4884 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
4885 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4886 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GURU JAMBESHWAR UNIVERSITY HISAR
4887 STUDY MATRIX SKILL DEVELOPMENT MISSION PLOT NO 31 VIKAS NAGAR OPPOSITE GJU HISAR HARYANA
4888 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
4889 STYLE N SCISSORS 4/36-J SUNRISE ENCLAVE GROUND FLOOR, CHITRAKOOT SCHEME JAIPUR ,RAJASTHAN
4890 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
4891 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI
4892 SUBHASH EDUCATIONAL SOCIETY KAHLI, TERWA, GAUSGANJ, HARDOI BLOCK- KACHHAUNA DISTRICT- HARDOI
4893 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
4894 SUBHASH EDUCATIONAL SOCIETY SUBHASH CHANDRA BOSE INSTITUTE OF HIGHER EDUCATION, PRABANDH NAGAR, MUBARAKPUR,NEAR IIM, LUCKNOW
4895 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
4896 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
4897 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
4898 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
4899 SUBHIKSAM CHARITABLE TRUST NO:1, ARUNACHALAESWARER COMPLEX,PONNAI KOOT ROAD,THIRUVALAM,KATPADI TK,VELLORE DT
4900 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
4901 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
4902 SUGANTHI EDUCATIONAL TRUST GKM COLLEGE OF ENGINEERING & TECHNOLOGY GKM NAGAR NEW PERUNGALATHUR CHENNAI
4903 SUGANTHI EDUCATIONAL TRUST GKM COLLEGE OF ENGINEERING & TECHNOLOGY GKM NAGAR, NEW PERUNGALATHUR CHENNAI
4904 SUGANTHI EDUCATIONAL TRUST GKM COLLEGE OF ENGINEERING & TECHNOLOGY GKM NAGAR NEW PERUNGALATHUR CHENNAI
4905 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
4906 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
4907 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
4908 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
4909 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
4910 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
4911 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
4912 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
4913 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA TESIL KAILARAS DISST MORENA M.P.
4914 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA TAHASIL KAILARAS
4915 SUNDER FOUNDATION SOCIAL WELFARE SOCIETY KAILARAS VILLEGE AND POST NIRARA
4916 SUN INDUSTRIAL AUTOMATION AND SOLUTIONS NO.95, DEVELOPED PLOT, ELECTRONIC INDUSTRIAL ESTATE, PERUNGUDI, CHENNAI
4917 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
4918 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
4919 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
4920 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
4921 SUNRISE EDUCATION AND WELFARE SOCIETY B-1/3716, BHAGWAN PUR KHERA, SHAHDARA, DELHI
4922 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
4923 SUNRISE WELFARE SOCIETY SARDARSHAHAR ROAD, SHRI DUNGARGARH
4924 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH KALAHANDI
4925 SUNSHINE EDUCATIONAL TRUST AT/P.O/P.S-DHARAMGARH
4926 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
4927 SUPER COMPUTER COLLEGE GENERAL BUS STAND ANANTNAG
4928 SUPER COMPUTERS GENERAL BUS STAND ANANTNAG
4929 SUPER FINE KNITTERS LIMITED 269, INDUSTRIAL AREA -A, LUDHIANA, PUNJAB
4930 SUPERFINE KNITTERS LIMITED 269, INDUSTRIAL AREA-A, LUDHIANA
4931 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
4932 SURABHI SWAYAMSEVI SANSTHA ALIBAG RAIGAD SADASHIV COMPLEX,3RD FLOOR,ROOM NO.301,BEHIND TUSHAR HOTEL,NAGDONGRI,CHENDHARE,TEL-ALIBAG,DIST-RAIGAD
4933 SURABHI SWAYAMSEVI SANSTHA ALIBAG RAIGAD SADASHIV COMPLEX,3RD FLOOR,ROOM NO 301 BEHIND TUSHAR HOTEL,NAGDONGRI,CHENDHARE,TEL-ALIBAG,DIST-RAIGAD
4934 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
4935 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
4936 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4937 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4938 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
4939 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
4940 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
4941 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
4942 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
4943 SURAJ FOUNDATION VILLAGE AND POST JAGIR
4944 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
4945 SURAKSHA SKILLS AND SOLUTIONS PRIVATE LIMITED 135,RAJGARH ROAD,NEAR BHARALU BRIDGE,GUWAHATI
4946 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
4947 SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED SURE SHOT INTEGRATED MARKETING SOLUTIONS PRIVATE LIMITED, H NO 2-152,VANI NAGAR, MALKAJGIRI, HYDERABAD, TS
4948 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
4949 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN,NEAR BUS STAND
4950 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4951 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
4952 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
4953 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
4954 SUTRA SAMAJ SEVI SANSTHA POLICE KOTWALI NE BACK DURG
4955 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
4956 S V EDUCATION AND INFRASTRUCTURE PRIVATE LIMITED 2-1-5/34 PLR LUXURY HOMES UPPERPALLY HYDERABAD
4957 SVG EXPRESS SERVICES PRIVATE LIMITED C 114 F ROAD NO 8 VKI JAIPUR
4958 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
4959 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
4960 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
4961 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
4962 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
4963 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
4964 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
4965 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
4966 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
4967 SWAMI VIVEKANAND EDUCATIONAL AND WELFARE TRUST J.M.K COMPLEX , NEAR BUS STAND , PURNEA
4968 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
4969 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
4970 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
4971 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
4972 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
4973 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR, KANPUR
4974 SWAPNIL INSTITUTE OF SOFTWARE TECHNOLOGIES 41 LAKHANPUR HOUSING SOCIETY, VIKAS NAGAR KANPUR
4975 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4976 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4977 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
4978 SWARGIYA SHRI TEJALAL JI SOLANKI SMRITI GRAM VIKAS SHIKSHAN SAMITI VANVASI SEWA MANDAL PARISAR, MAHARAJPUR MANDLA
4979 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
4980 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
4981 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
4982 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
4983 SWASTHAY SHIKSHA EVAM VYAKTIGAT VIKAS ANUSANDHAN KENDRA B-455, STREAT NO. 30, MAHAVIR ENCLAVE PART-II, NEAR SEC-2, DWARKA NEW DELHI
4984 SWASTIKA MAHILA VIKAS SANSTHAN SWASTIKA MAHILA VIKAS SANSTHAN, GALI NO-3, NEW KAREHRA COLONY, MOHAHNNAGAR, GHAZIABAD, U.P
4985 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
4986 SWATANTRA EDUCATIONAL WELFARE SOCIETY BINDRA COMPLEX, NEAR STATE BANK OF INDIA, BAKSHI KA TALAB, SITAPUR ROAD, LUCKNOW
4987 SWATANTRA EDUCATIONAL WELFARE SOCIETY BINDRA COMPLEX, INFRONT STATE BANK OF INDIA, BAKSHI KA TALAB, SITAPUR ROAD, LUCKNOW
4988 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
4989 SWATANTRYAVIR SAVARKAR BAHUUDDESHIYA SEVABHAVI SANSTHA 1137/2, JOSHI INFOTECH, ASHOK NAGAR, MUKHED
4990 SWATHI EDUCATIONAL SOCIETY H.NSAO. 17-1-380/E/9,CENTRAL EXCISE COLONY SAIDABAD, HYDERABAD
4991 SWATHI MEMORIAL EDUCATIONAL SOCIETY H.NO.16-2-754/A/23/1,APAU COLONY,ASMANGADH,DILSUKHNAGAR HYDERABAD
4992 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
4993 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
4994 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
4995 SWIFT SECURITAS PRIVATE LIMITED 2, RAJDHANI ENCLAVE, PITAMPURA, DELHI
4996 SW RAMNATH VERMA EDUCATION AND WELFARE SOCIETY OMGURU SOFTWARE PVT LTD NEELGAR CHAURAHA VISHNU MANDIR ROAD
4997 SW RAMNATH VERMA EDUCATION AND WELFARE SOCIETY OMGURU SOFTWARE PVT LTD, NEELGAR CHAURAHA, VISHNU MANDIR ROAD.
4998 SW RAMNATH VERMA EDUCATION AND WELFARE SOCITY OMGURU SOFTWARE PVT LTD, NEELGAR CHAURAHA, VISHNU MANDIR ROAD.
4999 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
5000 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E- 261 AMAR COLONY, LAJPAT NAGAR- IV NEW DELHI
5001 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
5002 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
5003 SYMBIOSIS INSTITUTE OF COMPUTER APPLICATIONS FORTE INSTITUTE OF TECHNOLOGY, VILLAGE KASERU BUXER , OPPOSITE VIJAYLOK COLONY, GREEN PARK , MAWANA ROAD , MEERUT
5004 SYNCHRONIZED TECHNOSOFT PRIVATE LIMITED D201, OYSTER GRANDE, SECTOR-102/102 (A), GURGAON, HARYANA-122001
5005 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
5006 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
5007 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
5008 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
5009 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
5010 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
5011 TALE INTERNATIONAL PRIVATE LIMITED A-22, 2ND FLOOR, SECTOR-4, NOIDA, UTTAR PRADESH-201301
5012 TALE INTERNATIONAL PRIVATE LIMITED A-22,2ND FLOOR, SECTOR-4, NOIDA, UTTAR PRADESH
5013 TALISMA TEST TALISMA TEST, TALISMA TEST
5014 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
5015 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
5016 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
5017 TARAMATHI EDUCATION SOCIETY BHOPAL 1, SAJJAN SINGH NAGAR, OPP PATEL NAGAR, RAISEN ROAD, BHOPAL, MADHYA PRADESH
5018 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
5019 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
5020 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
5021 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
5022 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
5023 TARUN CREATIONS PRIVATE LIMITED KHASRA NO 115 SHITLAMATA WALI GALI ALIPUR DELHI
5024 TARUN SHEET GRIH PRIVATE LIMITED TARUN SHEETGRAH VILLAGE AND POST BISANA
5025 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
5026 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
5027 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
5028 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
5029 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
5030 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET, BAIROON KOTLA DEOBAND
5031 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
5032 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
5033 TECH MECH INTERNATIONAL P LTD 92 CIVIL LINES S M KUTEER MEERUT
5034 TECH MECH INTERNATIONAL P LTD 208 II FLOOR,AGARWAL CHAMBERSIV,VEER SAVARKAR BLOCK,SHAKAPUR,DELHI
5035 TECH MECH INTERNATIONAL PVT LTD "S.M." KUTEER, MANDIR MARG, 92-CIVIL LINES, MEERUT - 250001(UP)
5036 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKATESH CITY SHIRUL NAGPUR 441108
5037 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKHTESH CITY HINGNA NAGPUR 441110
5038 TECHNICAL EDUCATION SOCIETY NAGPUR RAJESH REWADE 122 KACHORE LAY OUT WAED NO 06 BUTI BORI NAGPUR 441108
5039 TECHNICAL EDUCATION SOCIETY NAGPUR 4-9F VYANKATESH CITY SHIRUL NAGPUR
5040 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
5041 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
5042 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
5043 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
5044 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
5045 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, ALIGANJ, NEAR ENGG COLLEGE CROSSING
5046 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
5047 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
5048 TECHNOPAK SKILLS FOUNDATION 2ND FLOOR, BAANI ADDRESS ONE, 1 GOLF COURSE ROAD (NEAR HOTEL DOUBLETREE BY HILTON), SECTOR 56, GURGAON, HARYANA 122 011
5049 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
5050 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
5051 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
5052 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
5053 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
5054 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
5055 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
5056 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
5057 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
5058 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
5059 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
5060 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
5061 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
5062 TELEONE CONSUMERS PVT LTD 180, PITAMPURA VILLAGE, NEAR GOVT. SCHOOL & CHAUPAL, PITAMPURA
5063 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
5064 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
5065 TENNEX CONSULTING PRIVATE LIMITED 2/514A, RIVER ENCLAVE, MANAPAKKAM, CHENNAI
5066 TERNA PUBLIC CHARITABLE TRUST SOLAPUR ROAD, OSMANABAD 413501
5067 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
5068 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
5069 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
5070 TEST GZB
5071 TEST GUWAHATI METRO
5072 TEST TEST
5073 TEST123 QLJLFHLJQ
5074 TEST1234TEST TEST
5075 TEST22 JLGADOUF
5076 TEST44666 CVC
5077 TEST ABCD 5678 TESTABCD5678
5078 TEST CHARVI CRF 6 SACSA
5079 TEST CRF 6 GZB
5080 TEST CRF 6 MAIL JAN DFFD
5081 TESTDATA TEMP DELHI
5082 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
5083 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
5084 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
5085 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
5086 TEST FOR MAIL JADGSJAS
5087 TESTING TEST
5088 TESTM2 ASDWDDV
5089 TEZ ENGINEERING AND INFRASTRUCTURE PRIVATE LIMITED SHEELAM COLONY GALI NO.-3 OPP. DIHILONG PETROL PUMP
5090 TEZ ENGINEERING AND INFRASTRUCTURE PRIVATE LIMITEO SHEELAM COLONY STREET NO-03, OPPOSITE DIHILLONG PETROL PUMP, PUNJAB
5091 TEZ ENGINEERING AND INFRASTRUCTURES PRIVATE LIMITED SHIVAM COLONY GALI NO-3 OPP DHILLON PETROL PUMP SANGRUR
5092 TEZ ENGINEERING PRIVATE LIMITED SHEELAM COLONY GALI NO.3 OPP DIHILLONG PETROL PUMP
5093 THAKUR KARAM SINGH CHARITABLE TRUST H/O LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
5094 THAKUR KARAM SINGH CHARITABLE TRUST V.P.O. LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP
5095 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
5096 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
5097 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET,PODATUR PET,PALLIPET TALUK,
5098 THANDAVA VENKATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR,1ST STREET, PODATUR PET PALLIPET TALUK, TIRUVALLUR DISTRICT
5099 THANDAVA VENKATESA MUTHALIYAR EDUCATIONAL TRUST 63,EST NAGART,1ST STREET, PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT, TAMILNADU
5100 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
5101 THE ASHOKA HANDLOOM AND HANDICRAFTS SCOIETY BUILDING NO.918 WARD NO. 11 PANIPAT
5102 THE ASHOKA HANDLOOM AND HANDICRAFTS SOCIETY BLDG NO- 918,WARD NO-11, PANIPAT,HARIYANA
5103 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
5104 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
5105 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
5106 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
5107 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
5108 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
5109 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
5110 THE ASSOCIATION OF VOLUNTARY AGENCIES FOR RURAL DEVELOPMENT MANIPUR MATA LAMBULANE VILLAGE BPO TOLPHEI PO CHURACHANDPUR CHURACHANDPUR DISTRICT
5111 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
5112 THE CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI
5113 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
5114 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
5115 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
5116 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
5117 THE HIGHRANGE RURAL DEVELOPMENT SOCIETY DOOR NO: XIV/273, NEAR POST OFFICE,CHANDRANAGAR, PALAKKAD,KERALA
5118 THE HISAR HR CSC VLE COOPERATIVE MULTI PURPOSE SOCIETY LIMITED VPO MATLODA HISAR
5119 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
5120 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
5121 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
5122 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
5123 THENI SOCIAL REHABILITATION AND DEVELOPMENT TRUST 8 3 8 MIDDLE STREET VAYALPATTI VEERAPANDI POST THENI DT TAMILNADU SOUTH INDIA PIN 625534
5124 THE RAMACHANDRAPURAM EDUCATION SOCIETY D.NO: 19-1-70/23,VSM COLLEGE,MAIN ROAD, RAMACHANDRAPURAM, EAST GODAVARI DISTRICT, PIN: 533255. 9000504742
5125 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
5126 THE SHELTERS THE SHELTERS , KHAJURI GATE , BATALA
5127 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
5128 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
5129 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
5130 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI NEAR DEPUTY COMMISSIONER COMPLEX.THOUBAL
5131 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI
5132 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
5133 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO/PS THOUBAL, MANIPUR
5134 THE URALUNGAL LABOUR CONTRACT COOPERATIVE SOCIETY LTD MADAPPALLY COLLEGE P.O, VATAKARA, KOZHIKODE, KERALA
5135 THE VILLAGE FOUNDATION SITE NO 32,DOOR NO :4/192,TKS NAGAR,PULIYANDAMPALAYAM,NATCHIPALAYAM POST,KANKEYAM ROAD,TIRUPUR DT
5136 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
5137 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
5138 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
5139 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
5140 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
5141 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
5142 THOMAS IYADURAI INFRASTRUCTURE PRIVATE LIMITED NO. 1/2, M.D. SAMY NAGAR, ARUL NAGAR,, 1ST STREET, MADHAVARAM MILK COLONY,, MADHAVARAM
5143 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
5144 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
5145 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
5146 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
5147 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
5148 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
5149 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
5150 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
5151 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
5152 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
5153 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
5154 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
5155 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
5156 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
5157 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
5158 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
5159 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
5160 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
5161 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
5162 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY (PO), TIRUPPUTTUR (TK), SIVAGANGAI (DIST), TAMIL NADU
5163 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
5164 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
5165 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
5166 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
5167 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
5168 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
5169 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
5170 TNR SAINIK ACADEMY SOCIETY SURVEY NO.108, BAHADURPALLY VILLAGE, QUTHBULLAPUR, MEDCHAL
5171 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
5172 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
5173 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
5174 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
5175 TOUCH IN ASSOCIATES PLOT NO. 1132, NEAR BANK OF INDIA, HANSPAL CHHAK, BHUBANESWAR, ODISHA, KHORDHA, INDIA, PIN - 752101
5176 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
5177 TRANSKILL TRAINING AND CONSULTANCY SERVICES PVT LTD 2ND FLOOR OFFICE NO. 237, KOHINOOR MAJESTIC THERMAX CHOWK CHINCHWAD, PUNE
5178 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
5179 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
5180 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
5181 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
5182 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
5183 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
5184 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR DIST.CHHOTAUDEPUR.GUJARAT
5185 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
5186 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR
5187 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
5188 TRIMURTI WELDMESH PRIVATE LIMITED B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
5189 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
5190 TRIMURTI WELDMESH PVT LTD B-241, OKHLA INDUSTRIAL AREA, NEW DELHI – 110020
5191 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
5192 TRIOS DEVELOPMENT SUPPORT PRIVATE LIMITED T-33, MANISH GLOBAL MALL, PLOT NO-2, OPP. MOUNT CARMEL SCHOOL, SECTOR-22
5193 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
5194 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
5195 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
5196 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
5197 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
5198 TRIVEDI AND ASSOCIATE TECKNICAL SERVICE PRIVATE LIMITED 102, SIDCUP TOWER, RACE COURSE, VADODARA
5199 TRIWE TRIBES RURAL ICLUDING WOMEN AND EDUCATION ABOVE PNB ATM, CIRCUIT HOUSE ROAD, JAGDALPUR, BASTAR, CHHATTISGARH
5200 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
5201 TRP HUI NAGAR
5202 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
5203 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
5204 TULJABHAVNI GRAM VIKAS SEVABHAVI SANSTHA C/O TOTE R G AT POST TQ PATODA DIST BEED
5205 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
5206 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
5207 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
5208 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
5209 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
5210 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
5211 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
5212 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
5213 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
5214 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
5215 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
5216 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
5217 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
5218 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
5219 UDHAYAM TRUST 187,RAJA MILL ROAD, POLLACHI
5220 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI,COIMBATORE
5221 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
5222 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
5223 UDHAYAM TRUST 187 RAJA MILL ROAD POLLACHI
5224 UDYOG VIKAS SANSTHAN N11/106 LANE NO.2 SRI RAM NAGARA COLONY KAKKARMATTA
5225 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
5226 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
5227 ULTIMATUM INFORMATICS PRIVATE LIMITED SUMANGAL APARTMENT, 99 BT. ROAD, IST FLOOR P.O-KHARDAH KOLKATA KOLKATA WB 700117
5228 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
5229 UMRAO SINGH ARYA SIKSHA SANSTHAN KHESRA NO. 380, SINGHANA ROAD, PACHERI KALAN, BUHANA, JHUNJHUNU
5230 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
5231 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
5232 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
5233 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
5234 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
5235 UNIQUE EDUCATIONAL TRUST VILLAGE PARWAH, PO SANGRAMPUR JAMMU
5236 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
5237 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
5238 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI
5239 UNIQUE SOCIAL ASSOCIATION GANGA NAGAR ,NEAR BAPU PVT.JUNIOR HIGH SCHOOL AROGYA MANDIR ,GORAKHPUR,U.P.
5240 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
5241 UNIQUE VIKAS SANSTHAN 2/94-B, VIJAY KHAND, GOMTI NAGAR, LUCKNOW
5242 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
5243 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
5244 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
5245 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
5246 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
5247 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
5248 UNIVERSAL EDUCATIONAL SOCIETY VILLAGE BALLOPUR, P.O- LALRU, DISTT: DERABASSI
5249 UNIVERSAL ENGINEERING EQUIPMENT CORPORATION 146, SECTOR-9, AWAS VIKAS COLONY, SIKANDRA BODLA, AGRA
5250 UNIVERSAL IDEAL SEWA SAMITI VILL AND POST MAHULI, PS- WYNDHAMGANJ, SONBHADRA (U.P.), 231208
5251 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
5252 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
5253 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
5254 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLE, SARADA BABU LANE, LINE TANK ROAD, RANCHI
5255 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
5256 UNIWIDE CONSULTANCY AND SERVICES PVT LTD SDF BUILDING, 3RD FLOOR, MODULE 415-418, BLOCK GP, SECTOR V, SALTLAKE CITY
5257 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
5258 UNWIND LEARNING LABS AND CAREER PRIVATE LIMITED 8/25, KAMBAR STREET, ALANDUR, CHENNAI-16
5259 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
5260 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
5261 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
5262 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
5263 UPKAAR DR PASUPULETI NIRMALA HANUMANTHA RAO CHARITABLE TRUST UPKAAR COMPLEX, UPKAAR JUNCTION, OPPOSITE: JBS, SECUNDERABAD
5264 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
5265 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK BHOTIA PAROW HALDWANI
5266 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
5267 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
5268 UPPADA SAREES PVT LTD 8-2