Rejected Applications
Sr. No. Name Address
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA
2 AAA AAA
3 AAA BBB JABBALPUR, KATHMANDU,
4 AAA SOCIETY A AA AAAAAAAAAAAAAA
5 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT
6 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
7 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW
8 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI
9 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL
10 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001
11 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI
12 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU
13 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR
14 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT
15 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT
16 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
17 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT
18 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT
19 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT
20 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
21 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD
22 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI-
23 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI
24 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
25 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
26 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH
27 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH)
28 ABC JHSDJHDFKLJDFKJHJKGD
29 ABC KALARA BURDWAN
30 ABC BHOPAL
31 ABCD ABCD
32 ABCD ABCDEFGHIJKLMNOP
33 ABC FIRM LTD PATNA
34 ABC PVT LTD PUNE
35 ABD PVT LTD XYZ
36 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR
37 ABDUL WAHEED AND CHARITABLE EDUCATIONAL TRUST NEW BHAGAT SINGH COLONY,BAJORIA ROAD,SAHARANPUR,UTTAR-PRADESH
38 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH
39 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH
40 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
41 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE
42 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM.
43 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
44 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW
45 ACADEMY OF MANAGEMENT AND INFORMATION TECHNOLOGY IS AN UNIT OF ORDC 67/68,VIDYA VIHAR,IID CENTER,BARUNEI HILLS,KHURDA
46 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078
47 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK).
48 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI
49 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL
50 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE
51 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS)
52 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND
53 ACS TECHNOLOGIES LIMITED #39-11-17/1/1, MURALINAGAR VISAKHAPATNAM, ANDHRA PRADESH.
54 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU
55 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA.
56 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI
57 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI
58 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON
59 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR
60 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD
61 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD
62 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303
63 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
64 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
65 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM
66 ADARSH FOODS CITY STATION ROAD KHURJA
67 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM
68 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI
69 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI
70 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT.
71 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001
72 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
73 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
74 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE
75 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE
76 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR
77 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA)
78 ADIVASI KALA SANVARDHAN AND VIKAS SANSTHA MUKANA COLONY, AMBIKA CHOWK, AT POST AND TALUQA JAWAHAR, DIST. PALGHAR
79 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD
80 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD
81 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK
82 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA
83 ADVENT MULTISERVICES PRIVATE LIMITED 11, KENDUA MAIN ROAD, KOLKATA
84 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM
85 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA
86 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR
87 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM
88 AGNI SOFTWARES SRI MANGALAGANAPATHY TOWERS, M.G.ROAD,PALACODE,DHARMAPURI DT.
89 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR
90 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH
91 A G S MANAGEMENT SERVICES PVT LTD DNO.1-36-98, PLOT NO-27, PHASE -2, PAIGAH HOUSE. SP ROAD, SECUNDERABAD
92 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK
93 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012
94 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR)
95 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
96 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD
97 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE
98 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE
99 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI
100 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P
101 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD
102 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR
103 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR.
104 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR
105 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA
106 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD
107 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI
108 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR
109 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT
110 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI
111 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL
112 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW
113 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301
114 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
115 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA
116 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD
117 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673
118 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72
119 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN
120 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN
121 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI
122 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD
123 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325
124 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
125 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
126 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325
127 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD
128 ALL J AND K PASMADKA TABKA DEVELOPMENT WELFARE SOCIETY LANE NO. 19, FIRDOUSA ABAD, TANGPORA, BYPASS, BATMALOO SRINAGAR
129 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE
130 ALL PEOPLES DEVELOPMENT AND WELFARE SOCIETY DIVYAVANI, 75-76/3/1, HANUMAN NAGAR, JATKHEDI, P.O. MISROD, BHOPAL
131 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE
132 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA
133 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA
134 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH
135 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661
136 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR
137 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI
138 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA
139 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR
140 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR
141 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
142 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU
143 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI.
144 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA
145 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001
146 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI
147 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL
148 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL
149 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL
150 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA
151 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD
152 AMUTHASURABI WOMEN DEVELOPMENT SOCIETY 16-D1 CHELLANDIYAMMAN KOVIL STREET MALAIAMMALPURAM K K PATTY ROAD CUMBUM
153 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD
154 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH
155 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK
156 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED
157 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED
158 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092
159 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION)
160 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI
161 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi
162 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030
163 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD
164 ANDIMUTHU CHINNAPILLAI CHARITABLE TRUST 71, DOLPHIN TOWER, OLD LIC BUILDING, VENKATESAPURAM, PERAMBALUR
165 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW
166 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR,
167 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR
168 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7
169 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN.
170 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI.
171 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI
172 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL
173 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA
174 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR
175 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR
176 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR
177 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA.
178 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE
179 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM
180 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU
181 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU.
182 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR
183 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
184 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR
185 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT
186 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K
187 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU.
188 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK
189 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA.
190 ANNAMALAI ASDJFKL ADF ASDF AS F
191 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR
192 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030
193 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW
194 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE
195 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA.
196 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA .
197 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA
198 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP
199 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
200 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA
201 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI
202 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP)
203 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA
204 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE
205 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI
206 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064
207 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI.
208 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN
209 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA
210 APTDWS H/O L NO 19 TANGPORA BYE PASS BATMULLO SRINAGAR
211 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY
212 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH
213 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040
214 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA
215 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI.
216 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI
217 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI
218 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI
219 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN
220 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU
221 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA
222 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
223 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA
224 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI
225 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
226 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
227 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI
228 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI
229 ARMLET EDUCATION SOLUTION PRIVATE LIMITED MARWARI MUHALLA INFRONT OF GIRLS HIGH SCHOOL CHATRA JHARKHAND
230 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL
231 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR
232 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL
233 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108
234 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
235 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
236 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
237 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108
238 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA
239 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB
240 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053
241 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK
242 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK
243 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL
244 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST
245 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI
246 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI
247 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG
248 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH
249 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P
250 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296
251 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL
252 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD
253 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA
254 ASFSDA ASDF
255 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA
256 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD
257 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI
258 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW
259 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
260 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD
261 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON
262 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP)
263 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL
264 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA
265 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092
266 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA
267 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY
268 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR
269 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
270 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063
271 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA
272 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL
273 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL
274 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM
275 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P.
276 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P.
277 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG
278 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM
279 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005
280 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
281 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA
282 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD
283 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI
284 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM
285 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103
286 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD.
287 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT
288 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI
289 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001
290 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR
291 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM
292 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM
293 ATGHARA JYOTO MOHILA UDYOG ATGHARA EAST, PO R / GOPALPUR, KOLKATA 700136
294 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456
295 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252.
296 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT
297 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI
298 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI
299 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI.
300 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143
301 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP
302 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758
303 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
304 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA
305 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
306 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136
307 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW
308 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW
309 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH
310 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI
311 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP)
312 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW
313 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI
314 BABA MARINE INSTITUTE TRUST ULLASH NADI BRDGE,BADLAPUR GAON ROAD, BADLAPUR
315 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018
316 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018
317 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU
318 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.)
319 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI
320 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST
321 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
322 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR
323 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI
324 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B
325 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI
326 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL
327 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.)
328 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY
329 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL
330 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH
331 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048
332 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI
333 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI,
334 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR,
335 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA
336 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
337 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH
338 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR
339 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23
340 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR
341 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091
342 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL
343 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR
344 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR
345 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR
346 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH
347 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN,
348 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104
349 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301
350 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301
351 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR
352 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR
353 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE
354 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR
355 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL
356 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219
357 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219.
358 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086
359 BASE OFFICE EQUIPMENT CO PVT LTD RACHNA TOWERS,J.V. JAIN DEGREE COLLEGE ROAD,SAHARANPUR-247001,UTTAR PRADESH
360 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE
361 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE
362 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU
363 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA
364 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD
365 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA)
366 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW
367 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP
368 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH
369 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL
370 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI
371 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
372 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI
373 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR
374 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM.
375 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH
376 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL
377 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA
378 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT SR. NO. 149, NEAR E-SPACE, VIP ROAD, BHARTHANA, VESU, SURAT, GUJARAT 395017
379 BHAGWAN MAHAVIR EDUCATION FOUNDATION SURAT BHAGWAN MAHAVIR EDUCATION FOUNDATION SR. NO. 149, VIP ROAD, BHARTHANA, VESU SURAT 395 017 GUJARAT, INDIA
380 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
381 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
382 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA
383 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR
384 BHARATA MATA COLLEGE THRIKKAKARA BHARATA MATA COLLEGE THRIKKAKARA, KOCHI
385 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN
386 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN
387 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA
388 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU.
389 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903
390 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA
391 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN
392 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE
393 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD
394 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA
395 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073
396 BHARATIYA JANA SEVA MISSION 36, K.N.C. ROAD, UDAYACHAL, PO & PS - BARASAT, DISTRICT – NORTH 24 PARGANAS , KOLKATA-700124 ,WEST BENGAL , INDIA.
397 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
398 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH)
399 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI
400 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI
401 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR
402 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR,
403 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA
404 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019
405 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD
406 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA
407 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA
408 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA
409 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA
410 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001
411 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001
412 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT
413 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH
414 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA
415 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA
416 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI
417 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI
418 BHOOMIKA GARMENTS PRIVATE LIMITED BHOOMIKA GARMENTS PRIVATE LIMITED A-47,SECTOR-64,NOIDA
419 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
420 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
421 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW
422 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW
423 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR
424 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004
425 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND.
426 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL
427 BISWAAS BAHARANA.NIALI,CUTTACK
428 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI
429 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI
430 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD
431 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD
432 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA
433 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
434 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029
435 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA
436 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ)
437 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.)
438 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR
439 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B
440 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
441 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B)
442 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
443 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075
444 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA
445 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA
446 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
447 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI
448 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN
449 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR
450 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP
451 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE
452 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA
453 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA
454 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI
455 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT
456 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL,
457 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL,
458 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN
459 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN
460 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE
461 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD
462 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW
463 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P
464 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP
465 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI.
466 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI
467 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI
468 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE
469 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA
470 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI
471 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009.
472 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI
473 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP)
474 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA
475 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
476 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW
477 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU
478 CAREER POINT ONLINE SERVICE PRIVATE LIMITED CAREER POINT ONLINE SERVICES PRIVATE LIMITED P.O. BANGAON, KIDNGIPAR ROAD, AAMGAON - 441902, MAHARASHTRA, INDIA
479 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA
480 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI
481 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI,
482 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE
483 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA,
484 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA
485 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ
486 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
487 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
488 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA
489 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE
490 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
491 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA
492 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE.
493 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE.
494 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH
495 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU.
496 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
497 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI.
498 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301
499 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN
500 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL
501 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI
502 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND
503 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN
504 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA
505 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA
506 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA
507 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG
508 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT.
509 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR
510 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD
511 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA
512 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA
513 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
514 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703
515 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705
516 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH
517 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR
518 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH
519 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT
520 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
521 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT
522 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE
523 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P
524 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND
525 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317
526 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI
527 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI
528 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G.
529 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH
530 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
531 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH
532 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH.
533 CHIKMAGALUR MULTIPURPOSE SOCIAL SERVICE SOCIETY CMSSS SEVA SAMSTHE B KATIHALLI ARSIKERE ROAD HASSAN
534 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
535 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM
536 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI
537 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL
538 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303
539 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR-
540 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940
541 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI
542 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI
543 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE
544 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR
545 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
546 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP)
547 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD
548 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094
549 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA
550 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI
551 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384
552 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA
553 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
554 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI
555 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
556 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI
557 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH.
558 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR
559 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018.
560 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
561 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD
562 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001
563 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,
564 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA
565 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579
566 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT
567 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE.
568 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1
569 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3
570 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD
571 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA
572 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
573 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
574 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR
575 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
576 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA
577 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH
578 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
579 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI
580 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
581 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA
582 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA
583 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA
584 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
585 CONSORTIUM MINORITIES ASSOCIATION 2ND FLOOR, M.G.TOWER, KHADE BAZAR, BELAGAVI
586 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA
587 CONTACT BRIDGE IT ENABLED SERVICES PVT LTD PLOT NO.227, PHASE-IX INDUSTRIAL AREA MOHALI - 160062 PUNJAB
588 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101
589 COODU TRUST H.83.R M.COLONY DINDIGUL
590 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA
591 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT
592 COREMAGE INFOTECH 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR
593 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH
594 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3
595 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043.
596 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI
597 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL
598 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL
599 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE
600 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ
601 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI
602 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308
603 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH
604 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE
605 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE
606 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
607 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
608 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
609 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE
610 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI
611 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104
612 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI.
613 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN
614 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR
615 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW
616 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA
617 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI
618 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47, OLD INDUSTRIAL AREA, BAGARU, JAIPUR
619 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR
620 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P.
621 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH
622 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049
623 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
624 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
625 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
626 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI
627 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI
628 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI
629 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP
630 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI
631 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075
632 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI
633 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH
634 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD
635 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA
636 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
637 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
638 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK
639 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA
640 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR
641 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE
642 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA
643 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK.
644 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL
645 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM
646 DDUGKY MORD C TEST ALJBSDFLQJHF
647 DDUGKY MORD C TEST1 LJHWDF
648 DDUGKY MORD INC TEST2 NEW DELHI
649 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
650 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP)
651 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP)
652 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P.
653 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP)
654 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP)
655 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP)
656 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA)
657 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA
658 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG
659 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK,
660 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT
661 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT
662 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR
663 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
664 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR
665 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH
666 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI
667 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI
668 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
669 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE
670 DEMBLA EDUCATIONAL INSTITUTIONS PRIVATE LIMITED D.NO.44-14-13, SRI NAMMALVAR NILAYAM, BACKSIDE KANAKADURGA QRTRS, PADAVALAREVU, VIJAYAWADA, KRISHNA, ANDHRA PRADESH
671 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR
672 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122
673 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR
674 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD
675 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD
676 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN
677 DFHDFHFH KJDVNMDV,M DV
678 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059
679 DHAHWANTRI SEVABHAVI SANSTHA LOHA GAIKWAD NAGAR, LOHA TQ.LOHA DIST NANDED
680 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
681 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE
682 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
683 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
684 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
685 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU
686 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG
687 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM
688 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121
689 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR
690 DIAMETRIKS CONSULTING PRIVATE LIMITED C-14, 2ND FLOOR, SOUTH EXTN-2
691 DIAMETRIKS CONSULTING PVY LTD C-14, 2ND FLOOR, SOUTH EXTN-2
692 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU.
693 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016
694 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR
695 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR
696 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA
697 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL.
698 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD
699 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL
700 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD
701 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD
702 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI
703 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI
704 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP
705 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029
706 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT
707 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239
708 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM
709 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR
710 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
711 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND
712 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL
713 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI
714 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU
715 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL
716 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI
717 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE
718 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE
719 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE
720 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA
721 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA
722 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA
723 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA,
724 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR
725 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA
726 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW
727 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW
728 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH
729 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA
730 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR
731 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA
732 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
733 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
734 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP
735 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH
736 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST
737 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH
738 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH
739 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA
740 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE
741 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA
742 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
743 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN)
744 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
745 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH.
746 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD.
747 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR
748 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU
749 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE
750 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD
751 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR
752 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR.
753 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH
754 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS
755 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
756 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065
757 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065
758 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
759 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065
760 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL
761 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR
762 DURGASOFT INDIA PRIVATE LIMITED H NO 1-101/8, PLOT NO.56, 3RD FLOOR,, SRINIVASA NILAYAM, HARSHA CHAMBERS, MADHAPUR, HYDERABAD TELANGANA, INDIA
763 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY
764 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD
765 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD,
766 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE
767 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI,
768 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI
769 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI
770 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA
771 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL
772 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084.
773 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT
774 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR
775 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI
776 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI.
777 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI
778 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD
779 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA
780 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT
781 ECOLOGICAL CONSERVATION ORGANIZATION D.NO. 2-1-200, OPP. RAMALAYAM TEMPLE, GADDALAGUNTA,ONGOLE –523 002
782 ECO RECYCLING LIMITED 422, THE SUMMIT BUSINESS BAY, NEAR WEH METRO STATION, ANDHERI-KURLA ROAD, ANDHERI (EAST),
783 EDEN DAY SOCIETY H. NO 1365 SECTOR-13
784 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA
785 EDS GADEPAN KOTA
786 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU
787 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD
788 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB
789 EDU INSTITUTE ADDRESS
790 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI
791 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022
792 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD
793 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD
794 EKALAVYA FOUNDATION #308,SRI SAI GAYATRI TOWERS,ABOVE SBI BANK,NANAKRAMA GUDA,SERILINGAMPALLI,RR DIST
795 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI
796 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA
797 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR
798 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR)
799 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068
800 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068
801 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103
802 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD,NEAR BANK OF BARODA, PANIPAT-132103
803 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR
804 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081
805 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI
806 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
807 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON
808 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P
809 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL
810 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026
811 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME
812 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI
813 ENVIRONMENT CONSERVATION SOCIETY 1A DL KHAN ROAD, JAJU BHAWAN, KOLKATA
814 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI
815 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401
816 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
817 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
818 ERODE ACADEMY 29 THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011
819 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA
820 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA.
821 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI
822 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD
823 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD
824 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL
825 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL
826 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI
827 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE
828 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE
829 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB)
830 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU
831 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K
832 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU
833 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU
834 EVERGREEN INSTITUTE OF COMPUTER AND TECHNICAL EDUCATION NEAR GREEN MODEL HIGH SCHOOL KISHTWAR J&K
835 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR
836 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72
837 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604
838 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA
839 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD.
840 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR
841 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI
842 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P.
843 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.)
844 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
845 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
846 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET.
847 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE.
848 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE
849 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT
850 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM
851 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED
852 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR
853 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR
854 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR
855 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM
856 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
857 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM
858 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM
859 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY
860 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY
861 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA
862 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K
863 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K
864 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD
865 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH.
866 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
867 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P
868 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR
869 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR
870 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK
871 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA
872 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA
873 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI
874 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI
875 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH
876 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048
877 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI
878 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI
879 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301
880 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P.
881 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23
882 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR
883 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD,
884 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA
885 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA
886 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH
887 FUTURE SECURE EDUSOLUTIONS PVT LTD FLAT NO 104,GANGA 2,JALALPUR CITY,OFF BALLEY ROAD,PATNA
888 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON
889 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR
890 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA
891 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
892 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
893 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR
894 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784
895 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA
896 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441
897 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND
898 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
899 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406
900 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI
901 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL
902 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
903 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
904 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
905 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI
906 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200
907 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
908 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR
909 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK
910 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI
911 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204
912 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA
913 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204
914 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA)
915 GANDHIJI SEVA PARISAD AT PO KUDUMULUGUMA VIA KHAIRPUT DIST MALKANGIRI
916 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH
917 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA
918 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD
919 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR
920 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA
921 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA
922 GAYATRI COLLEGE BHATA CHOUK GARIA DIH
923 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN
924 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT
925 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL
926 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD
927 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG
928 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, DURG BLOCK & DISTRICT - DURG
929 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH
930 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA
931 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3
932 GENUINESOFT ST.HINDUCOLLEGE ROAD
933 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002
934 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA
935 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002
936 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR
937 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012
938 GFEN SERVICES PRIVATE LIMITED H.O - A-19, THIRD FLOOR, ANAND VIHAR, UTTAM NAGAR, WEST DELHI - 110059 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA
939 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA
940 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001
941 GFHDYHDBAH VSGYCGDHFGSDY
942 GFHDYHDBAH QSDWEFWE
943 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124
944 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W
945 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150
946 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051
947 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU.
948 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
949 G K EDUCATIONAL TRUST TOLL POST NAGROTA
950 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
951 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA
952 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU
953 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL
954 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU
955 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA
956 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA
957 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD
958 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
959 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA
960 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI
961 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM
962 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI
963 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
964 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA
965 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR
966 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA
967 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL
968 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001
969 GLOBALREACH SKILL TRAINING INDIA PVT LTD UNITED PRIDE COMPLEX, NEAR MIT COLLEGE, BEED BYPASS ROAD
970 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY
971 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ
972 GLOBAL SOCIAL WELFARE FOUNDATION REGD.OFFICEP- DAKHIN MUHALL, MIRGANJ, GOPALGANJ WORKING OFFICE- BHADA MORE, NEAR SUTA FACTORY, MIARWA ROAD, SIWNA
973 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
974 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI
975 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
976 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR
977 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR
978 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON
979 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
980 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA
981 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD
982 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD
983 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD
984 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA
985 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI
986 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA
987 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR
988 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI
989 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA
990 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI
991 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA)
992 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151
993 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI
994 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085.
995 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635
996 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P
997 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR
998 GOURNAGAR KALYAN SAMITY VILL-GOURNAGAR,P.O. SRI MAYAPUR, NADIA
999 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5
1000 GOVINDAMMAL SINGARAM EDUCATIONAL TRUST NO. 14 UPPALANKUTTAI STREET, SEVILIMEDU, KANCHEEPURAM - 631502 KANCHEEPURAM DISTRICT TAMILNADU STATE
1001 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA
1002 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM
1003 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH
1004 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1005 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI.
1006 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT
1007 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP)
1008 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331
1009 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH
1010 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW
1011 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P)
1012 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR
1013 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH
1014 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G.
1015 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112
1016 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR
1017 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1018 GRAMIN YUVA AUR NARI SAHAYTA SAMITI 83, NRIPENDRA SANYAL ROAD, BHAISE KI MASJID NEAR ODIAN CINEMA, LUCKNOW
1019 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI
1020 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH
1021 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI
1022 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT
1023 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH
1024 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA
1025 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD
1026 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501
1027 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL
1028 GRAMYA SANJYOG TECHNOLOGIES PVT LTD PANJABARI ROAD, SIXMILE, HOUSE NO 3, BYLANE 1A, GUWAHATI
1029 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH
1030 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405
1031 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL.
1032 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA
1033 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU
1034 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU
1035 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI
1036 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA
1037 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM
1038 G T TRUST 693 BAZAR STREET, ATTUR,SALEM
1039 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU
1040 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT
1041 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD
1042 GUJARAT INFOTECH LIMITED JAMSAB, A/1, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR CROSS ROAD, NARANPURA, AHMEDABAD - 380013.
1043 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD
1044 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT
1045 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL
1046 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL
1047 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL
1048 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL
1049 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI
1050 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL
1051 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD
1052 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA
1053 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT
1054 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT
1055 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI
1056 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026
1057 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH
1058 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106
1059 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1060 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1061 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW
1062 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI
1063 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL
1064 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE
1065 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM
1066 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA
1067 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP
1068 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL
1069 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI,
1070 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR,
1071 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR
1072 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL
1073 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI
1074 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW
1075 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD
1076 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD,
1077 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU
1078 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA.
1079 HARILEELA EDUCATIONAL SOCIETY TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA.
1080 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.-MANDIRBAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1081 HARIPUR AMRA SABAI UNNAYAN SAMITI VILL+P.O.-BIJOYGUNJ BAZAR, P.S.+BLOCK-MANDIR BAZAR, DIST.-SOUTH 24 PARGANAS, PIN-743343, WEST BENGAL
1082 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001.
1083 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001.
1084 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK
1085 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD
1086 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR
1087 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR
1088 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001
1089 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA
1090 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI
1091 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA
1092 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD
1093 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM
1094 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM
1095 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA
1096 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU
1097 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA
1098 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU
1099 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA
1100 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA
1101 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA
1102 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA
1103 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050
1104 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050
1105 HGXDNG CBGNCBNMCNFMHXFVM
1106 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH
1107 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA
1108 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND
1109 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL
1110 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL
1111 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA
1112 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD
1113 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH
1114 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP
1115 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301
1116 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA
1117 HIPPOCAMPUS INFOTECH PVT LTD #2,HB COMPLEX,3RD FLOOR,100 FEET ROAD, BTM LAYOUT,1ST STAGE, BANGALORE-560068
1118 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA
1119 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI
1120 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107
1121 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT
1122 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY
1123 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL
1124 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL
1125 HOLY CHARITABLE TRUST H NO 30-2-496, MADIKONDA, KAZIPET, HANAMKONDA,WARANGAL.
1126 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI
1127 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA
1128 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT)
1129 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU
1130 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD
1131 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN
1132 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI
1133 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1134 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI
1135 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD
1136 HSADALO FFSE
1137 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL
1138 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM)
1139 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD
1140 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306.
1141 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD
1142 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775
1143 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775
1144 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU.
1145 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR
1146 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN
1147 HUMA POWER AND TOWER PRIVATE LIMITED ATHGAON KABRISTAN MASJID COMPOUND, OPPOSITE GLASS FACTORY,N S ROAD GUWAHATI ASSAM
1148 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1149 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD
1150 I3 KONZEPTS INDIA PVT LTD #50, NEW BALAJI COLONY, SVU POST, TIRUPATI
1151 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092.
1152 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI
1153 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA
1154 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA
1155 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR
1156 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM.
1157 ICTPMU DDUGKY TEST NEW DELHI
1158 ICTPMU TEST11 NEW DELHI110001
1159 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL
1160 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA
1161 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA
1162 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR
1163 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA
1164 IFA EDUCATION SERVICES PVT LTD A-1/20, SECOND FLOOR, ABOVE UCO BANK, PRASHANT VIHAR, ROHINI SECTOR-14
1165 IFA EDUCATION SERVICES PVT LTD A - 1/20, PRASHANT VIHAR, ROHINI, SECTOR-14, DELHI
1166 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI
1167 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA
1168 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA
1169 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL
1170 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI
1171 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1172 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA
1173 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY
1174 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1175 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA
1176 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR
1177 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1178 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1179 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI
1180 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI
1181 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM
1182 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1183 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI
1184 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI
1185 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA
1186 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027
1187 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201
1188 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1189 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1190 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1191 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1192 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1193 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI
1194 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI
1195 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657
1196 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA
1197 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI
1198 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI,
1199 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29
1200 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1201 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI
1202 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI
1203 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA
1204 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE.
1205 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT
1206 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR
1207 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR
1208 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM
1209 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA
1210 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI
1211 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1212 INDOVISION SERVICES PRIVATE LIMITED INDOVISION SERVICES PRIVATE LIMITED 3RD FLOOR, CENTRUM MALL,SULTANPUR NEW DELHI - 110030
1213 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111
1214 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT
1215 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SECTOR 63 NOIDA (U.P)
1216 INDRAPRASTHA SKILL INITIATIVE PRIVATE LIMITED G-72 SEC-62 NOIDA
1217 INDRAPRASTHA SKILL INITIATIVE PVT LTD G-72 SECTOR 63 NOIDA (U.P)
1218 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA
1219 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE
1220 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA
1221 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE
1222 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE,
1223 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI
1224 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM
1225 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR
1226 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON
1227 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM
1228 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI
1229 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, 1ST FLOOR, 1ST CROSS, 10TH A MAIN, INDIANAGAR, BANGALORE - 560038
1230 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1231 INNOVENT ENGINEERING SOLUTIONS PVT LTD NO. 5, FLAT NO 003 AND 004, PARAMOUNT REGENCY,, HENNUR MAIN ROAD, KACHARAKANAHALLI, BANGALORE - 560084, KARNATAKA, INDIA
1232 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1233 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI
1234 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA
1235 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI
1236 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT
1237 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA
1238 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD
1239 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082
1240 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR
1241 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL
1242 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL
1243 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP
1244 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309
1245 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD
1246 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR
1247 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA
1248 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH
1249 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH
1250 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA
1251 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI
1252 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI
1253 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI
1254 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202
1255 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202
1256 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA
1257 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202
1258 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM
1259 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022
1260 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1261 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022
1262 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001
1263 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001
1264 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM
1265 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661
1266 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP
1267 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK
1268 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET,
1269 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA
1270 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM
1271 ISTTM BUSINESS PVT LTD TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD - 500081, INDIA. MOBILE : +91 9010156000, +91 8978669666 EMAIL : INFO@ISTTM.COM
1272 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL
1273 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA
1274 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL
1275 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL
1276 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY
1277 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA
1278 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA
1279 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE
1280 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA
1281 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL
1282 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR
1283 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA
1284 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI
1285 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN
1286 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA
1287 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA)
1288 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND
1289 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN
1290 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA
1291 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK
1292 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA
1293 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI
1294 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT
1295 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1296 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI
1297 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI
1298 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR
1299 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA
1300 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P)
1301 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123
1302 JAN KALYAN SAMITI JAIN
1303 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024
1304 JAN KALYAN SHIKSHA SAMITI A-1413/3
1305 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR
1306 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA
1307 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD
1308 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG
1309 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI
1310 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1311 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA
1312 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT
1313 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK
1314 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA
1315 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.)
1316 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG
1317 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519
1318 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR
1319 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0
1320 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA
1321 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU
1322 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI
1323 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1324 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD
1325 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD
1326 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT
1327 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068
1328 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208
1329 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR
1330 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM
1331 JEET KUNE DO MARTIAL ART ASSOCIATION OF INDIA E- 50/3, JASOLA, NEW DELHI-
1332 JEEVANDHARA BAHUUDDESHIY SANSTHA PANDHARKAWADA OFFICE AT.PO. PANDHARKAWADA MANGALMURTI LAYOUT TAH.KELAPUR DIST. YAVATMAL
1333 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN
1334 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA
1335 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP)
1336 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP
1337 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD
1338 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH
1339 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH)
1340 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA
1341 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU
1342 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN
1343 JITM SKILLS PVT LTD 217 RAM VIHAR NEAR BHARAT NATIONAL SCHOOL DELHI
1344 JITM SKILLS PVT LTD 217 RAM VIHAR DELHI
1345 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR
1346 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR
1347 JK INDUSTRIAL AND TECHNICAL CONSULTANCY ORGANIZATION DIC COMPLEX EXHIBITION GROUND JAMMU
1348 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR
1349 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL
1350 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI
1351 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1352 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND
1353 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA
1354 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1355 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111
1356 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA
1357 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1358 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR
1359 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA
1360 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI
1361 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR
1362 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH
1363 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR
1364 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR
1365 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR
1366 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN
1367 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR,
1368 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1369 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1370 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1371 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1372 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1373 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT
1374 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT.
1375 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR
1376 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB
1377 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD
1378 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL
1379 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA .
1380 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR
1381 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA
1382 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1383 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR
1384 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL
1385 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA.
1386 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE
1387 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE
1388 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1389 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015
1390 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE
1391 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA
1392 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, SWAMY AIYYAPPA SOCIETY, RPAD NO 36 SANVI TOWERS, MADHAPUR HYDERABAD
1393 KAMAKSHI EDUCATION SOCIETY PLOT NO 705, ROAD NO 36 SANVI TOWERS AYYEPPA SOCIETY MADHAPUR
1394 KAMALAKANTA ENGINEERING AND CONSTRUCTION COMPANY PRIVATE LIMITED H-15,PLOT NO-1149,BOMIKHAL , GOVINDVIHAR, BHUBANESWAR
1395 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK
1396 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN
1397 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD
1398 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001
1399 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR
1400 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD
1401 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT
1402 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA
1403 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR
1404 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR
1405 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT)
1406 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD
1407 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD
1408 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA
1409 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani
1410 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551
1411 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI
1412 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO,320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI- 625020, TAMILNADU
1413 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU.
1414 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM, ANNA NAGAR, MADURAI
1415 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE
1416 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601
1417 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR)
1418 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI
1419 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601.
1420 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR
1421 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4
1422 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE
1423 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE
1424 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE
1425 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE
1426 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006
1427 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA.
1428 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST 174/5,PRJ SRIDEVI AVENUE,OPPOSITE THENI DISTRICT COURT,LAKSHMIPURAM-625523 TAMILNADU,INDIA
1429 KAVITHALAYA SARAVANAN EDUCATIONAL AND CHARITABLE TRUST HEAD OFFICE 174/5,PRJ SRIDEVI AVENUE,OPP TO DISTRICT COURT,LAKSHMIPURAM-625523,PERIYAKULAM. ADMIN OFFICE NO 11,POST OFFICE ODAI STREET,THENI-625531
1430 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH
1431 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI
1432 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL, JAMMU
1433 KAWA EDUCATIONAL AND WELFARE SOCIETY KAWA TOWER NH BYE PASS ROAD NARWAL JAMMU
1434 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR
1435 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT
1436 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI
1437 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR
1438 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA
1439 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE
1440 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND
1441 KGVK NEORI VIKAS RUKKA RANCHI
1442 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT
1443 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat
1444 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE
1445 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL
1446 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE
1447 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD
1448 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD
1449 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL
1450 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA
1451 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI,
1452 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA
1453 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1454 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD
1455 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA
1456 KIPS EDUCATIONAL CHARITABLE TRUST SCF 90-91,2ND FLOOR,2ND PHASE,MODEL TOWN,BATHINDA (PUNJAB)-151001
1457 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001
1458 KIRAN DEEP NGO ADD:- KASHIPUR, T.E. ROAD, NEAR, VALLAB BHAI PATEL HIGH SCHOOL. PO:- NUTAN DAYAPUR. PIN:- 788009. DIST:- CACHAR, ASSAM. CONT:- 08134835421/09613964519/03841-257057
1459 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI
1460 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA
1461 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA
1462 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA
1463 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM
1464 KITEX GARMENTS LIMITED P.B NO. 5, KIZHAKKAMBALAM ALWAYE, ERNAKULAM- 683562 KERALA
1465 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH.
1466 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH
1467 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL
1468 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA.
1469 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999
1470 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032
1471 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI,
1472 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI
1473 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND
1474 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL
1475 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD
1476 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P.
1477 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT
1478 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM
1479 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT
1480 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T
1481 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR
1482 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR
1483 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR
1484 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103
1485 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH
1486 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA
1487 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA
1488 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON
1489 KULIA PATH GREEN SAVE CULTIVATORS WELFARE SOCIETY A.K. GOPALAN NAGAR, KULIA ROAD, KULIPATH THAKUR BARI, P.O.- NSS, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL, PIN-741250
1490 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO
1491 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI
1492 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI
1493 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI
1494 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR
1495 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR
1496 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA
1497 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1498 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010
1499 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU
1500 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI
1501 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1502 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI
1503 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT
1504 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR
1505 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD
1506 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL
1507 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA
1508 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA
1509 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL
1510 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012
1511 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL
1512 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA
1513 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.)
1514 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL
1515 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR
1516 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025
1517 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1518 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR
1519 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR
1520 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR
1521 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244
1522 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1523 LAURUS EDUTECH LIFE SKILLS PRIVATE LIMITED DP-110, F-19, SECOND PHASE,INDUSTRIAL ESTATE, AMBATTUR ,CHENNAI-600 058, TAMILNADU
1524 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN
1525 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026
1526 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD
1527 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA
1528 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON
1529 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA
1530 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
1531 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM
1532 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL
1533 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT)
1534 L G TECHNOLOGIES 7-4-412, 2ND FLOOR, MAIN ROAD, OPP: LIBRARY, MAIN ROAD, MUKARAMPURA, KARIMNAGAR
1535 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL
1536 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD
1537 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE)
1538 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD
1539 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD
1540 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD
1541 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001
1542 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI
1543 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA
1544 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1545 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.)
1546 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA
1547 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1548 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI
1549 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070
1550 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070
1551 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047
1552 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI
1553 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR
1554 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL
1555 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI
1556 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT
1557 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD
1558 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT
1559 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR.
1560 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW
1561 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE
1562 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA.
1563 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA
1564 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI
1565 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI
1566 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI
1567 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI
1568 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1569 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1570 MAA BHAGWATI SAMITI MAA BHAGWATI SAMITI, TASIMO, DISTRICT- DHOLPUR (RAJASTHAN)- 328027
1571 MAA BHAGWATI SHIKSHA SAMITI MAA BHAGWATI SHIKSHA SAMITI, TASIMO, DISTRICT- DHOLPUR, (RAJASTHAN)- 328027
1572 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1573 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM
1574 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006
1575 MAA MANORATH POORANI SHIKSHA AVAM SAMAJIK KALYAN SAMITI GWALIOR 51 INDRAMANI NAGAR GOLA KA MANDIR GWALIOR
1576 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143)
1577 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR
1578 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT.
1579 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA
1580 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR
1581 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR
1582 MAA SATYAWATI SHIKHSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1583 MAA SATYAWATI SHIKSHA SAMITI K 92 TATYA TOPE NAGAR KANPUR NAGAR
1584 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR
1585 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA
1586 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR
1587 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP
1588 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL
1589 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA
1590 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT
1591 MAGASVARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1592 MAGASWARGIYA EDUCATION SOCIETY GUJARI CHOWK, PUSAD, YAVATMAL
1593 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA
1594 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA
1595 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI
1596 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI.
1597 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1598 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL
1599 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH
1600 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL
1601 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR
1602 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR
1603 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR
1604 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA
1605 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR
1606 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR.
1607 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1608 MAHARASHTRA TANTRA SHIKSHAN PRASHIKSHAN SANSTHA 349/2 MAHARASHTRA GANDHI SMARAK NIDHI, KASTURBA GANDHI BHAVAN, BAJAJ NAGAR, NAGPUR
1609 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA
1610 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU
1611 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD
1612 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT)
1613 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT)
1614 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1
1615 MAHATMA PHULE VIDYA PRASARAK MANDAL GANESH CHOWK, NEAR GANPATI MANDIR, MANJARLI, BADLAPUR (WEST) TALUQA AMBERNATH, DIST. THANE
1616 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1617 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD
1618 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT
1619 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM
1620 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1621 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM
1622 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK
1623 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE.
1624 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI,
1625 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P.
1626 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM
1627 MAHIRSE SHUKDEV DUTT SHIKSHA SANSTHAN 314 SHEKHOOPURA COLONY, VIKAS NAGAR, LUCKNOW
1628 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G.
1629 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068
1630 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA
1631 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE
1632 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS)
1633 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI
1634 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1635 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR
1636 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD
1637 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072
1638 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
1639 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072
1640 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR
1641 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR
1642 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER
1643 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR
1644 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004
1645 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE
1646 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G
1647 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI -
1648 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI
1649 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE
1650 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH
1651 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091
1652 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091
1653 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI
1654 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI
1655 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHRAM, NEW DELHI
1656 MANTHAN FOUNDATION OF INDIA 65/2, HARI NAGAR, ASHARAM, NEW DELHI
1657 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH
1658 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU
1659 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR
1660 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED.
1661 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH
1662 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW
1663 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH
1664 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
1665 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019
1666 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON.
1667 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA
1668 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM
1669 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND
1670 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM.
1671 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY.
1672 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA.
1673 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE
1674 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK
1675 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514
1676 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514
1677 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL
1678 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793
1679 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081
1680 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
1681 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD
1682 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA
1683 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA
1684 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD
1685 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE.
1686 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD
1687 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM
1688 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL
1689 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE
1690 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA
1691 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD
1692 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR
1693 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI
1694 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA
1695 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA
1696 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092
1697 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335
1698 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
1699 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335
1700 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI
1701 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI
1702 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI
1703 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI
1704 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005
1705 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI
1706 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005.
1707 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035
1708 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712
1709 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT)
1710 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU.
1711 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
1712 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI
1713 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI
1714 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
1715 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN
1716 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901
1717 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR
1718 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA
1719 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH
1720 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W)
1721 MILLENNIUM SOFTWARE SOLUTIONS PRIVATE LIMITED 2ND FLOOR, REDNAM ESTATES, BESIDE SAROVAR HOTEL, 1ST LANE, DWARAKANAGAR, VISAKHAPATNAM
1722 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI
1723 MIND INDIA MIND INDIA, 187 MANIRAM DEWAN ROAD CHANDMARI, GUWAHATI
1724 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI
1725 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136
1726 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P
1727 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169
1728 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL
1729 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg
1730 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN
1731 M M EDUCATIONAL AND CHARITABLE TRUST 2/258 CANARA BANK UPSTAIRS, KULUMANI MAIN ROAD, TRICHY, TAMILNADU
1732 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA
1733 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
1734 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016
1735 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
1736 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016
1737 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016
1738 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016
1739 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI
1740 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI
1741 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144
1742 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX
1743 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU
1744 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR
1745 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR
1746 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM
1747 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE
1748 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE
1749 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE
1750 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST
1751 MORD TEST ND
1752 MORD TEST NEW DELHI ND
1753 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE
1754 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD
1755 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE
1756 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
1757 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON
1758 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001
1759 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH
1760 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP
1761 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT
1762 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL.
1763 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY
1764 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104
1765 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104
1766 MOUNVITHA EDUCATIONAL SOCIETY 15-1002, VEMSOOR ROAD, SATHUPALLI
1767 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4
1768 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1769 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1770 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA
1771 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA
1772 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA
1773 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664
1774 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL.
1775 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR
1776 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL
1777 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN
1778 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP
1779 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR
1780 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR
1781 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA
1782 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA
1783 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI
1784 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI
1785 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX
1786 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA
1787 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR
1788 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024
1789 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET
1790 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR
1791 NAINCY CONVENT EDUCATIONAL AND SOCIAL WELFARE SOCIETY NAINCY CAMPUS VILLAGE SHYALIKHET JEOLIKOTE NAINITAL
1792 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI
1793 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG
1794 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN
1795 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD
1796 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA
1797 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
1798 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001
1799 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET
1800 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE
1801 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA
1802 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL
1803 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI
1804 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN
1805 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL
1806 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL.
1807 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD
1808 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL
1809 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI,
1810 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
1811 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR
1812 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA
1813 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH
1814 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR)
1815 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR
1816 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU
1817 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD
1818 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K
1819 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI
1820 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN)
1821 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR
1822 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA
1823 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL.
1824 NATIONAL SECURITY SERVICES NATIONAL SECURITY SERVICES BHAVANI CHAMBERS, OPP : MEHTA PETROL PUMP DHEBAR ROAD, RAJKOT - 360002 (GUJARAT) INDIA
1825 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070
1826 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515
1827 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
1828 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515.
1829 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM
1830 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD
1831 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU
1832 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G.
1833 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
1834 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI
1835 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211
1836 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA
1837 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA
1838 NAVACHETHANA MALLAPPALLY INSTITUTE
1839 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI
1840 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA)
1841 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR
1842 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA)
1843 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001
1844 NAVKAR BUSINESS CONSULTANT LLP C/O VIJAY HUDAGE COMPLEX, NANDED ROAD, UDGIR
1845 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR
1846 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI
1847 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH.
1848 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH
1849 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1850 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1851 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA
1852 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA
1853 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI
1854 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI
1855 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND
1856 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL
1857 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G)
1858 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD
1859 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143
1860 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P
1861 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM
1862 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI
1863 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA
1864 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN
1865 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT
1866 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR
1867 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028
1868 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038
1869 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT
1870 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072
1871 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002
1872 NETKING INSTITUTE ABOVE OBC BANK NEAR SALWAN CHOWK KARNAL ROAD ASSANDH
1873 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI
1874 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI
1875 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN
1876 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM
1877 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST.
1878 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P
1879 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY
1880 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI
1881 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH
1882 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH
1883 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur
1884 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD
1885 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD
1886 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401
1887 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA
1888 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
1889 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY)
1890 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA
1891 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA
1892 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
1893 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
1894 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR
1895 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK
1896 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK
1897 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI.
1898 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD
1899 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU
1900 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU
1901 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR
1902 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI
1903 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH
1904 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA.
1905 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE
1906 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE)
1907 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
1908 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
1909 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA
1910 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK
1911 NILIMA EDUCATION SOCIETY SATARA PLOAT NO 6. SOMESHWAR NAGAR GANGASAGAR COLONY GENDAMAL
1912 NIM SOFT TECH PRIVATE LIMITED 11-2-51/1, VIGNESH NILLAYAM, FLAT NO 302, MYLARGADDA, SECUNDERABAD
1913 NIMT B SCHOOLS FOUNDATION F3, CSC2, DDA MARKET, G BLOCK PREET VIHAR
1914 NIMT B SCHOOLS FOUNDATION NIMT I CENTER, F3, CSC2, DDA MARKET, G BLOCK, PREET VIHAR, DELHI
1915 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121.
1916 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR,
1917 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI
1918 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR
1919 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI
1920 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR
1921 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR
1922 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI
1923 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN
1924 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE
1925 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
1926 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG
1927 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321.
1928 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA)
1929 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA
1930 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
1931 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019
1932 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA
1933 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA
1934 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA
1935 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI.
1936 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI
1937 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI
1938 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI
1939 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL
1940 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM)
1941 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM)
1942 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI
1943 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE
1944 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN
1945 N RACHAIAH FOUNDATION NO.865,OPPOSITE DR.MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE,BASAVESHWARANAGAR,BANGALORE
1946 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA
1947 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN
1948 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN
1949 NRACHAIAH FOUNDATION NO.865,OPP DR.MODI EYE HOSPITAL,WEST OF CHORD ROAD, BASAVESHWARANAGAR, BANGALORE-560079
1950 NRLM SKILLS SAMRAT,CHANKYAPURI
1951 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
1952 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
1953 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD
1954 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
1955 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE
1956 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
1957 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005
1958 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE
1959 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE
1960 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE.
1961 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH
1962 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD.
1963 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.)
1964 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN
1965 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND
1966 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN
1967 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL
1968 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR
1969 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
1970 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA
1971 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
1972 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN
1973 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE
1974 OMEGA CHARITABLE TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 630606
1975 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA.
1976 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA
1977 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA.
1978 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH
1979 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226
1980 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED
1981 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI.
1982 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI.
1983 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA
1984 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR
1985 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR.
1986 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH
1987 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR
1988 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79
1989 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU
1990 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL
1991 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P.
1992 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024
1993 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
1994 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
1995 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085
1996 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
1997 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55.
1998 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA
1999 ORION TRUST SAGOLBAND THINGOM LEIKAI
2000 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR
2001 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2002 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA
2003 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA
2004 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA
2005 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA
2006 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2007 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR
2008 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2009 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET) PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWAR INDUSTRIAL ESTATE
2010 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA
2011 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR
2012 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568
2013 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR
2014 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE
2015 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043
2016 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI
2017 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE
2018 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE
2019 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE
2020 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI
2021 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2022 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM
2023 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA.
2024 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR
2025 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR
2026 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM
2027 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU
2028 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM
2029 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT
2030 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2031 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR
2032 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA
2033 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA
2034 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR
2035 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD
2036 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA
2037 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA
2038 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN
2039 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN)
2040 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI
2041 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI
2042 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR
2043 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.)
2044 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA
2045 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA
2046 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU
2047 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI
2048 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND)
2049 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE
2050 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE
2051 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD
2052 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA
2053 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN
2054 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR
2055 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR
2056 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102
2057 PEARL OUTSOURCE PVT LTD SEAPORT- AIRPORT ROAD ,VALLATHOL JUNCTION ,THRIKKAKARA,ERNAKULAM
2058 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP
2059 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS
2060 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK.
2061 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU
2062 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU
2063 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
2064 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT
2065 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA
2066 PEOPLEWELFARESOCIETY 40-15-9/2 F3 ABILASHAPERTMENTS, NEAR GREENLAND .LABBIPETA. VIJAYAWADA 10
2067 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA.
2068 PEOPLEWELFARESOCIETY 40-15-9/2, F3 ,ABILASH APPERTMENTS ,NEAR GREENLAND ,LABBIPETA , VIJAYAWADA . AP
2069 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT
2070 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON
2071 PHOOLEEN MAHILA CHETANA VIKAS KENDRA REGD:HANTHIA PATHER FARM, VILL-BHOGTACHORANT, PO:RAMCHANDRAPUR, VIA :MADHUPUR ADMN:52, BIGHAS, MADHUPUR DIST: DEOGHAR
2072 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL.
2073 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD
2074 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT
2075 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE
2076 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE
2077 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM
2078 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR
2079 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA
2080 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA
2081 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA
2082 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.)
2083 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD
2084 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD
2085 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD
2086 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE
2087 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA
2088 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043
2089 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore
2090 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI
2091 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER
2092 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP
2093 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP
2094 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056
2095 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA
2096 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK
2097 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA
2098 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2099 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD
2100 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON
2101 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA
2102 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033
2103 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA
2104 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA
2105 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.)
2106 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2107 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2108 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH
2109 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW
2110 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP
2111 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2112 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2113 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD
2114 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP)
2115 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD
2116 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT
2117 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR
2118 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA
2119 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR
2120 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA
2121 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI
2122 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN
2123 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR
2124 PRERANA RUGUDIPARA BALANGIR ODISHA
2125 PRERANA RUGUDIPARA BALANGIR
2126 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12
2127 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2128 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA
2129 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2130 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2131 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE.
2132 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU
2133 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE
2134 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE
2135 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL
2136 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD,
2137 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU
2138 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2139 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA
2140 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL.
2141 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA
2142 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2
2143 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH
2144 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2145 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI.
2146 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM
2147 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI
2148 PS EDUCATIONAL AND SOCIAL WELFARE SOCIETY BEHIND VETERINARY COLLEGE,GRAM BORKHEDI, A.B.ROAD,TEHSIL MHOW, INDORE
2149 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE
2150 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE
2151 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA
2152 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA
2153 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA
2154 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD
2155 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA
2156 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA
2157 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI
2158 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU
2159 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU
2160 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU
2161 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU
2162 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY(PRESS) 21,T.V.PERUMAL KOVIL.STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2163 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2164 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU
2165 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR
2166 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI,
2167 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA
2168 QED INDIA QED INDIA,PORVORUIM PANJIM GOA
2169 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2170 QUALITY CATALYST PRIVATE LIMITED 109,110,111, 1ST FLOOR, EMERALD, 7 JEWELS COMPLEX RAILWAY STATION ROAD
2171 QUALITY CATALYST PRIVATE LIMITED 109,110,111, EMERALD, 1 ST FLOOR, SEVEN JEWELS COMPLEX, STATION ROAD, VAPI EAST
2172 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI
2173 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424
2174 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA
2175 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA
2176 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA
2177 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231
2178 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA
2179 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA
2180 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040
2181 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2182 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW
2183 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2184 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI
2185 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV
2186 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA
2187 RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED RAIMONDO FACILITY MANAGEMENT PRIVATE LIMITED # 1-2-597/22-A, NEAR SNOW WORLD,, LOWER TANKBUND ROAD, HYDERABAD - 500001, ANDHRA PRADESH, INDIA
2188 RAIMONDO FACILITY MANAGEMENT PVT LTD NO.1-2-593/4/A/6, FLAT NO.203 VIJAY COURT, DOMALGUDA HYDERABAD - 500 029
2189 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001
2190 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2191 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2192 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI
2193 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI
2194 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR
2195 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR
2196 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL
2197 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI
2198 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW
2199 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS
2200 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA
2201 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P.
2202 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA
2203 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA
2204 RAJ SHREE 787
2205 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR
2206 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI
2207 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN
2208 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA
2209 RAM MORADABAD
2210 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM.
2211 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD
2212 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR
2213 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31
2214 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY
2215 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK
2216 RAMASWAMY EDUCATIONAL AND CHARITABLE TRUST 22 (A)4 THANNEERPANDHAL COLONY, 15-VELAMPALYAM,AVINASHI ROAD, TIRUPUR-641652
2217 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI
2218 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI
2219 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED
2220 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED.
2221 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED
2222 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2223 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED.
2224 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG
2225 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA
2226 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG
2227 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA
2228 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND
2229 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203
2230 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK
2231 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR
2232 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR
2233 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL
2234 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST)
2235 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT
2236 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM
2237 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2238 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661
2239 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA
2240 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661
2241 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA
2242 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2243 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA
2244 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA
2245 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH
2246 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH
2247 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL
2248 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU
2249 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD
2250 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71
2251 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE
2252 REKHA SOCIETY DGGHDGHSH
2253 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA
2254 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA
2255 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL
2256 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI
2257 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI
2258 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD
2259 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD
2260 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST
2261 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI
2262 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018
2263 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR
2264 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM
2265 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM
2266 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR
2267 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.)
2268 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA
2269 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR
2270 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA
2271 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001
2272 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA
2273 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA
2274 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301
2275 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR
2276 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG
2277 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR
2278 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR
2279 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2
2280 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR
2281 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2282 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI
2283 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002
2284 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT
2285 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM
2286 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA
2287 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR
2288 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI
2289 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB
2290 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01
2291 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB
2292 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.)
2293 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI
2294 RSESK SOCIETY MAHENDRU
2295 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP
2296 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP
2297 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001
2298 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM
2299 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR
2300 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR
2301 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI
2302 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR
2303 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2304 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401
2305 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR
2306 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401
2307 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR
2308 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035
2309 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2310 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT
2311 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2312 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET
2313 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801
2314 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU
2315 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU
2316 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD
2317 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA.
2318 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU,
2319 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU
2320 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR
2321 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR
2322 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997,
2323 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2324 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM
2325 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009
2326 SADGUNA TECHNOLOGIES NAIMNAGAR
2327 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND.
2328 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI
2329 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91
2330 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI
2331 SAFDSF SADFASD
2332 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE.
2333 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220
2334 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220
2335 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157
2336 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA
2337 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA
2338 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED
2339 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN
2340 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR.
2341 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR
2342 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR
2343 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114
2344 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR
2345 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA
2346 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA
2347 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA
2348 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA
2349 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA
2350 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR
2351 SAI HARIKA MS COMPUTER EDUCATION H.NO. 15-150, BEHIND OLD VIDYABHARATHI COLLEGE, VEMSOOR ROAD, SATHUPALLI
2352 SAI HARIKA MS COMPUTER EDUCATION H.NO 15-150 BEHIND OLD VIDYABHARATHI VEMSOOR ROAD
2353 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153
2354 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI
2355 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR
2356 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM
2357 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD
2358 SAI SADGURU ADS PVT LTD FLAT NO 301, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2359 SAI SADGURU POWER PROJECTS AND INFRASTRUCTURE PVT LTD FLAT NO 302, SUBHADRA ENCLAVE, PLOT NO 139, HNO 8-3-1109/2, OPP STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2360 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD
2361 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062
2362 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI
2363 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR
2364 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL.
2365 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ
2366 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI
2367 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW
2368 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2369 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA
2370 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2371 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091
2372 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR
2373 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA
2374 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA
2375 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775
2376 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR
2377 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2378 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR
2379 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2380 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL
2381 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL
2382 SAMARITANS ASSEMBLY 37A, HOSSAIN SHAH ROAD, (MOMINPORE), KOLKATA - 700 023, WEST BENGAL. CONTACT DETAILS: LANDLINE: 033 2449 1085 MOBILE: 9830226318
2383 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P.
2384 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH)
2385 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL
2386 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL
2387 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2388 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI
2389 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI
2390 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH
2391 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH
2392 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003
2393 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA.
2394 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003
2395 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR.
2396 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR
2397 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR
2398 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI
2399 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR
2400 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P..
2401 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR
2402 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA
2403 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA
2404 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17
2405 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU.
2406 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2407 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE
2408 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA
2409 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT
2410 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR
2411 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR
2412 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE
2413 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL
2414 SANDEEP TEST ASDASDASD
2415 SANDESH MNGO INDIA INDIA 1 INDORE
2416 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT
2417 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR.
2418 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH.
2419 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2420 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101
2421 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101
2422 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI
2423 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE
2424 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE
2425 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA
2426 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.)
2427 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.)
2428 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA
2429 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA
2430 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR
2431 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA
2432 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P.
2433 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, 3RD FLOOR, ANGEL MEGA MALL, SEC-14, KAUSHAMBI
2434 SARAH JAHAN INITIATIVE PRIVATE LIMITED 327, ANGEL MEGA MALL, KAUSHAMBI, SEC-14
2435 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR
2436 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM.
2437 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT.
2438 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI
2439 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI
2440 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661
2441 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA
2442 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED
2443 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR
2444 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH
2445 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT.
2446 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA
2447 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P)
2448 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA
2449 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT
2450 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD
2451 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT
2452 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516
2453 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR
2454 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND
2455 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR
2456 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR
2457 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR
2458 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU
2459 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI
2460 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
2461 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI
2462 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR
2463 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP)
2464 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL
2465 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001
2466 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002
2467 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002
2468 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
2469 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA
2470 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR
2471 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2472 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2473 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2474 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA
2475 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA
2476 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY
2477 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR
2478 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001
2479 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA
2480 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR
2481 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH
2482 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514
2483 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.)
2484 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.)
2485 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.)
2486 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR
2487 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
2488 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR
2489 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA
2490 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL
2491 SATYA INSTITUTE OF MANAGEMENT STUDIES 2-308, VIJAYAWADA CRDA LIMITS, NUGONDAPALLI VILLAGE, AGIRIPALLI MANDAL, KRISHNA DIST
2492 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI
2493 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2494 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2495 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2496 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI
2497 SATYAM SKILLS CENTER VISHAKAPATNAM
2498 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD
2499 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD
2500 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG
2501 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA
2502 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI
2503 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI
2504 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN
2505 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI
2506 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD
2507 SBDA AT-GVBBGFHGFBFGB
2508 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA
2509 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA
2510 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR
2511 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121
2512 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA
2513 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
2514 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA
2515 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK
2516 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001,
2517 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT.
2518 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM
2519 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2520 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2521 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2522 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM
2523 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI
2524 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066
2525 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP)
2526 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP)
2527 SCP FOUNDATION 1010/121, MADANPUR KHADAR, SARITA VIHAR, NEW DELHI
2528 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
2529 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI
2530 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084
2531 SECURED SECURITY SOLUTIONS PVT LTD 3RD FLOOR RAVI BHAWAN JAISTAMBH RAIPUR CHHATTISGARH INDIA
2532 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY
2533 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR
2534 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA
2535 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA
2536 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA
2537 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST
2538 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT,
2539 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT.
2540 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU.
2541 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST CHINNASALEM PO & TK, VILLUPURAM DT. TN.
2542 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT, TAMILNADU.
2543 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI
2544 SERICULTURE RESEARCH AND DEVELOPMENT COUNCIL SERICULTURE RESEARCH & DEVELOPMENT COUNCIL 66, 3RD FLOOR,RAJ HOSPITAL,SEWAK PARK, NEAR DWARKA MORE METRO STATION,OPP.METRO PILLOR NO.-779, NEW DELHI-110059
2545 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE
2546 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA
2547 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501
2548 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN
2549 SFS FOUNDATION INDA, RABINDRAPALLY, DIST.-PASCHIM MIDNAPUR
2550 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI
2551 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI
2552 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075
2553 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA)
2554 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA
2555 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
2556 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602
2557 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN
2558 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD
2559 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH
2560 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA
2561 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA
2562 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH
2563 SHANTI NIKETAN VIKAS SAMITI BHILAI GYANODAY SCHOOL, INFRONT OF SBI KIOSK, 18 NO ROAD, MOTHER TERESSA NAGAR, CAMP-01, W-20,BHILAI
2564 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA
2565 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR
2566 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE
2567 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE
2568 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI
2569 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA
2570 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR.
2571 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA
2572 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W).
2573 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W)
2574 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA
2575 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR
2576 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR
2577 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR
2578 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142
2579 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001
2580 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
2581 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008
2582 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002
2583 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA
2584 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P)
2585 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P)
2586 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P)
2587 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA
2588 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2589 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2590 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET
2591 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA.
2592 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA
2593 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA
2594 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR
2595 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA)
2596 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503
2597 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503
2598 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
2599 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR
2600 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G
2601 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI
2602 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036
2603 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036
2604 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI
2605 SHODH 180/22, ZAKIR NAGAR, OKHLA
2606 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL
2607 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP
2608 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016
2609 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2610 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2611 SHREE AMAR SANSKAR KALYAN KENDRA PRASAD BHAWAN,BHUCHUNGDIH ROAD,JAINA MORE,BOKARO
2612 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR
2613 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR
2614 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR.
2615 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR
2616 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA
2617 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303
2618 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD
2619 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL
2620 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD
2621 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL.
2622 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE
2623 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI,
2624 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND
2625 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT
2626 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT
2627 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005
2628 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP
2629 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P)
2630 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH
2631 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI
2632 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR
2633 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA.
2634 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029
2635 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
2636 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA
2637 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL
2638 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE
2639 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE
2640 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU
2641 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
2642 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON
2643 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT
2644 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH
2645 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON
2646 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI
2647 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP
2648 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR
2649 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL
2650 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
2651 SHRI HANS TRADERS PRIVATE LIMITED 28/99, NEEL WALI GALI, KANPUR - 208001, UTTAR PRADESH, INDIA
2652 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL
2653 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN
2654 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG
2655 SHRI KRISHNA GRAMOTTHAN SAMITI VILL- SARBJEET KA PURA, POST- SURJAMA, TEHSIL- KAILARASH, DISTT- MORENA- MP-476001
2656 SHRI KRISHN GRAMOUTTHAN SAMITI VILLAGE SABAJIT KA PURA TH KAILARAS DISTT MORENA MP
2657 SHRI KRUPA SERVICES PRIVATE LIMITED PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE 411035
2658 SHRI KRUPA SERVICES PRIVATE LIMITED SKSPL FACILITIES - PRESTIGE PLAZA II,MUMBAI-PUNE ROAD,AKURDI,PUNE
2659 SHRI MAHARAJA AGRASEN CHARITABLE TRUST SHRI MAHARAJA AGRASEN INTERNATIONAL COLLEGE SAMTA COLONY RAIPUR
2660 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW.
2661 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW
2662 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH
2663 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD
2664 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD
2665 SHRI RADHEY EDUCATIONAL WELFARE SOCIETY GOROTA, TEH- HODAL , DIST- PALWAL HARYANA
2666 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005
2667 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
2668 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
2669 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK
2670 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP
2671 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR
2672 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2673 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2674 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2675 SHRIRAM TRANSPORT FINANCE COMPANY LIMITED SHRIRAM TRANSPORT FINANCE CO. LTD. CORPORATE OFFICE: WOCKHARDT TOWERS, 3RD FLOOR, WEST WING, G BLOCK, BANDRA-KURLA COMPLEX, BANDRA (EAST), MUMBAI
2676 SHRI SAIKRUPA KISAN EDUCATION SOCIETY P- 16 MIDC BUTIBORI NAGPUR
2677 SHRI SHAYAM SUNDER GUPTA MEMORIAL SEWA SANSTHAN 35/2,CHANDRA SHEKHAR AZAD, NEAR INDRA PARK CITY JHANSI
2678 SHRI SIDDHI VINAYAK SHIKSHAN SAMITI CIT CAMPUS, NEAR PARRI NALA GE ROAD KANHARPURI RAJNANDGAON (CG)
2679 SHRI SIKHYA BHARATI AT-KOMAND, PO-ODAGAON, DT-NAYAGARH
2680 SHRI VINAYAK CREATIVE FASHIONS PVT LTD 404, SUKH SHEETAL APTS 16/1 SOUTH TUKOGANJ INDORE – 452001
2681 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA GUJARAT, INDIA
2682 SHROFFS FOUNDATION TRUST AT & POST: KALALI, TALUKA & DISTRICT: VADODARA.
2683 SHROFFS FOUNDATION TRUST AT & POST - KALALI, TALUKA & DISTRICT - VADODARA, GUJARAT, INDIA
2684 SHROFFS FOUNDATION TRUST AT & POST KALALI, TAL & DIST : VADODARA GUJARAT, INDIA 390012
2685 SIDDESHWAR GRAMEEN ABHIVRUDDI SANGHA MAIN ROAD YADAWAD
2686 SIDDHI E TECHNO PVT LTD AT CHANDRA BANSHI NAGAR BEHIND SHERSAH HOTEL SASARAM DIST- ROHTAS BIHAR CONTACT- DHARMENDRA KUMAR 9122716650
2687 SIDH TRADING PRIVATE LIMITED FARM NO. 16, KHASRA NO. 24, 8TH AVENUE, BANDH ROAD, JONAPUR, NEW DELHI
2688 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANIPLAZA,NEAR BSNL OFFICE, MARUTHINAGAR,VIJAYAWADA.
2689 SIERRA DATA PROJECTS INDIA PVT LTD #31-23-1/4,2ND FLOOR,BHAVANI PLAZA,NEAR BSNL OFFICE,MARUTHI NAGAR,VIJAYAWADA
2690 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN, 5TH FLOOR FLAT NO. 7,
2691 SIGMA WEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
2692 SIGMA WEB SOLUTIONS PVT LTD 26 PRASANNA KUMAR TAGORE STREET MATHURA SADAN 5TH FLOOR FLAT NO 7 KOLKATA
2693 SIGMAWEB SOLUTIONS PVT LTD FLAT NO. 7, 5TH FLOOR, MATHURA SADAN, 26, P K TAGORE STREET, KOLKATA
2694 SIIT EDUCATIONAL AND CHARITABLE TRUST SIIT BUILDIND,MAIN ROAD, THALAYOLAPARAMBU , KOTTAYAM DISTRICT, KERALA
2695 SIKSHA O ANUSANDHAN J-15, KHANDAGIRI SQUARE, KHANDAGIRI, BHUBANESWAR, ODISHA
2696 SIKSHA TRUST AT- TARAPUR, PO-LAXMINAGAR JAJPUR ROAD
2697 SILICON VALLEY CORPORATION PRIVATE LIMITED 3RD FLOOR, VITTHAL CHARANI SANKUL, OPP. BIG BAZZAR, COLLEGE ROAD, NASHIK
2698 SILIGURI GLOBAL ENGINEERING INSTITUTE PLOT NO-94/180, MOUZA - THIKNIKATA P.S - MATIGARA, P.O-SUSHRUTNAGAR, SILIGURI, DIST: DARJEELING, WEST BENGAL
2699 SIMANCHAL TECHNICAL AND EDUCATIONAL DEVELOPMENT INSTITUTION PRABHAT COLONY , PURNEA
2700 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2701 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2702 SIMOCO EDUCATIONAL TRUST GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2703 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2704 SIMOCO SYSTEMS AND INFRASTRUCTURE SOLUTIONS LTD GODREJ GENESIS BUILDING (2ND FLOOR), BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2705 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2706 SIMOCO TELECOMMUNICATIONS SOUTH ASIA LIMITED GODREJ GENESIS BUILDING (2ND FLOOR),BLOCK EP & GP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA-700 091
2707 SIMRAN HOLIDAYS PVT LTD F-310 TO 316, 3RD FLOOR, ADITYA COMPLEX,R.B.C, JANAKPURI, D-BLOCK, NANGAL RAYA, NEW DELHI.
2708 SINAI SKILLMAX PVT LTD PLOT NO. 270-L; ROAD NO. 10; JUBILEE HILLS; HYDERABAD
2709 SINDHUDURG DIOCESAN DEVELOPMENT SOCIETY E/288/E, NAVSARNI CAMPUS, NEW- KHASKILWADA, SAWANTWADI
2710 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
2711 SINESOFT EDUCATIONAL TRUST DR. NOHRIA'S STREET, GURU KASHI MARG, POWER HOUSE ROAD, STREET NO. 1 BATHINDA, PUNJAB
2712 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2713 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2714 SINTHEE SIKHA WELFARE SOCEITY 168, SOUTH SINTHEE ROAD, KOLKATA
2715 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA - 700050, PS - SINTHI, PO - SOUTH SINTHEE
2716 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD, KOLKATA
2717 SINTHEE SIKHA WELFARE SOCIETY 168, SOUTH SINTHEE ROAD, KOLKATA
2718 SINTHEE SIKHA WELFARE SOCIETY 168 SOUTH SINTHEE ROAD
2719 SINTHEE SIKHA WELFARE SOCIETY 168,SOUTH SINTHEE ROAD, KOLKATA
2720 SIRAGUGAL EDUCATIONAL AND CHARITABLE TRUST NO.6 REDHILLS ROAD,KOLATHUR CHNNAI-99 TAMILNADU
2721 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN, BHIWADI DIST.ALWAR
2722 SIR SYED TRUST M-05,4/20 ASHIYANA ANGAN , BHIWADI DIST.ALWAR, RAJASTHAN
2723 SIR SYED TRUST M-05,4/20, ASHIYANA ANGAN, BHIWADI DIST.ALWAR, RAJASTHAN
2724 SISHUKALYANA SWADHIKARA KENDRA AT- ITACHAITI PO- MIRCHANDPUR VIA- DEVIDWAR DIST- JAJPUR-755007
2725 SIVAKAMI WOMEN DEVELOPMENT TRUST 119,PANCHAYATH UNION OFFICE STREET,CHINNAMANUR.
2726 SIVASAKTHI DRIVING SCHOOL JODUKUNDAPALLAM, PETTHAMELUPALLI POST, COLLECTORATE BACK SIDE, KRISHNAGIRI
2727 SIZZLING BEVERAGES PRIVATE LIMITED 43, DHOLKI MAUHALLA, SADAR, MEERUT
2728 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
2729 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL RAIPUR
2730 SJAIN VENTURES LIMITED SJAIN VENTURES LIMITED C-246, VALLABH NAGAR, NEAR SANT GYANESHWAR SCHOOL, RAIPUR
2731 S K EDUCATION TRUST S K EDUCATION TRUST'S DR MANOJ A SHETE COLLEGE OF ENGINEERING & TECHNOLOGY (POLYTECHNIC) MOKHAWANE-KASARA ,MUMBAI-NASIK HIGHWAY (NH-3).KASARA BY PASS ROAD,TAL SHAHPUR DIST -THANE
2732 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA
2733 SKILLED INDIA SOCIETY 97/5 MANU VIHAR COLONY BEHIND ELITE CINEMA JHANSI
2734 SKILL EMPLOYMENT AND ENTREPRENEURSHIP DEVELOPMENT SOCIETY H. NO: 2-2-8, MAIN ROAD, NAIMNAGAR, HANMAKONDA, DIST: WARANGAL,TELANGANA PIN: 506001
2735 SKILLINGTECH EDUCATION AND SERVICES PVT LTD SALUA MUSLIM PARA, NEAR SALUA KABARISTAN. KOLKATA - 700136
2736 SKILL KRAFT 29,SIDCO INDUSTRIAL ESTATE MATHUR
2737 SKILLS INDIA FOUNDATION NO-130, R.M.P NAGAR, KOOTHANUR ROAD, SATHYAMANGALAM- 638402, ERODE DISTRICT TAMIL NADU. PHONE: 04295 233579 E.MAIL: MURALI.SKILLSINDIA@GMAIL.COM WEB-ADDRESS: WWW.SKILLSINDIA.ORG
2738 SKILLS NAVIGATOR 1735,GALI NO-10A, LAXMAN VIHAR, PH-2, GURGAON
2739 SKILLS NAVIGATOR 1735,GALI NO-10A,LUXMAN VIHAR,PH-2, GURGAON
2740 SKILLSOURCE LEARNING AND TECHNOLOGIES PVT LTD OFFICE NO. 123, BUILDING 2A-3, SECTOR 1, MILLENNIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI, INDIA 400 701.
2741 SKILLS ROOT EDU TECH CONSULTING INDIA PVT LTD READERS CLUB BUILDING, 26/1 NEW PALASIA, INDORE M.P.
2742 SKILLTECH OPP. HP GAS, B-13, F-1, VIGNANPURI, VIDYA NAGAR EXTENSION, NEAR SVS SCHOOL, HYDERABAD
2743 SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC BAHADURGARH HARYANA INDIA
2744 SKILYTICS INDIA PRIVATE LIMITED SKILYTICS INDIA PRIVATE LIMITED PLOT 301 SECTOR 17 FOOTWEAR PARK HSIIDC
2745 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
2746 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI
2747 SKY FOUNDATION NO.2/42, KEELA STREET, AATHIKUDI, AATHIGUDI POST, LALGUDI TALUK, TRICHIRAPPALLI.
2748 SKYMTRIX TECHNOLOGIES PRIVATE LIMITED VILL-JANGAL RASOOLPUR NO 2, POST-NAI BAZAR, DISTT-GORAKHPUR
2749 SKYNET FOUNDATION SKYNET FOUNDATION, C/O. SKYNET TRAINING & PLACEMENT ACADEMY, EDUCATION OFFICE, NR. SAHAKAR HALL, AMBAWADI, HIMATNAGAR
2750 SMARTBRAINS ENGINEERS AND TECHNOLOGIST PVT LTD H-86, SECTOR- 63, NOIDA, GAUTAM BUDDHA NAGAR, UTTAR PRADESH
2751 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2752 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2753 SMART BRIDGE INFOTECH 16-1-655, 3RD FLOOR, LR SHINE TOWERS, JN ROAD, VRC CENTER, NELLORE
2754 SMART CHOICE LEARNING PRIVATE LIMITED 12A, MAHALAXMI METRO TOWER, SECTOR 4, VAISHALI, GHAZIABAD
2755 SMARTSTEPS CONSULTING PRIVATE LIMITED 501 & 502, TOPAZ BUILDING, NEXT TO TANISHQ JEWELLERS, PUNJAGUTTA, HYDERABAD
2756 SMART ZONE GUNJABARI
2757 SME MANPOWER SERVICES PRIVATE LIMITED SME MANPOWER SERVICES PRIVATE LIMITED, SME MANPOWER SERVICES PRIVATE LIMITED71/2, 1ST CROSS,8TH MAIN, MSR MAIN ROAD MATHEKERE, BANGALORE 560054
2758 SMT BASAVATARAKA RAMA RAO MEMORIAL CANCER FOUNDATION RESEARCH CENTRE ROAD NO 10, BANJARA HILLS, HYDERABAD, 500034 TELANGANA, INDIA
2759 SMT MATHADA NEELAMMA BASAPPAYYA SWAMY VIDYAVARDHAKA TRUST SNG 19TH WARD JADAR STREET BUS STAND ROAD GANGAVATI
2760 SMT SNEHLATABEN UMAT EDUCATION TRUST SHREE RAMWAY PLAZA, GPO ROAD, DANDIA BAZAR BARODA 390001
2761 SNEHA MAHILA VIKAS SANSTHA TULI EDUCITY NEAR KORADI OCTROI POST BOKHARA ROAD NAGPUR
2762 SNEHA MAHILA VIKAS SANSTHA TULI COLLEGE OF HOTEL MANAGEMENT NEAR KORADI NAKA BOKHARA ROAD
2763 SNIPER INFOTECH 112 2ND FLOOR, 5 TH STREET EXTN, NEAR KALYAN JEWELLERY, 100 FEET ROAD, GANDHIPURAM, COIMBATORE
2764 SOCIAL AGENCY FOR PEOPLE EMPOWERMENT FLAT NO.301, SUBHADRA ENCLAVE, PLOT NO.139, HNO 8-3-1109/2, OPP. STATE BANK OF INDIA, YELLAREDDYGUDA BRANCH, KESHAV NAGAR COLONY, HYDERABAD
2765 SOCIAL AGRICULTURE CHILDREN EDUCATION AND WOMEN DEVELOPMENT TRUST SACEWD TRUST, SURACKADU & POST, KARAMBAKKUDI TALUK, PUDUKKOTTAI DISTRICT.
2766 SOCIAL EDUCATIONAL ECONOMIC DEVELOPMENT SOCIETY 1-10-64, BHAGATH SINGH NAGAR , KAMAREDDY, NIZAMABAD DIST , TELANGANA STATE
2767 SOCIAL ORGANIZATION FOR LITERACY HOSHANGABAD BISIDE AVIRAT GAS AGENCY, MORCHALLI CHOUK HOSHANGABAD
2768 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SHRI GANGANAGAR ROAD, TEHSIL ABOHAR, DISTT FAZILKA, PUNJAB
2769 SOCIAL SERVICE WELFARE SOCIETY VILLAGE ALAMGARH, SRI GANGANAGAR ROAD,TEHSIL ABOAHR, DISTT FAZILKA, PUNJAB
2770 SOCIAL WELFARE EDUCATIONAL ECONOMIC TRUST SWEET 5/149 SCHOOL STREET AYILAMPUDUR VILLAGE ARUNGUNDRAM POST VELLORE DISTRICT TAMILNADU INDIA
2771 SOCIAL WELFARE IMPROVEMENT SOCIETY NO 1531 KANJI ROAD VENGIKKAL AND POST TIRUVANNAMALAI TK AND DIST TAMIL NADU INDIA
2772 SOCIAL WELFARE ORGANIZATION OF INDIA 21B PATLIPUTRA GOLAMBAR
2773 SOCIETY INSTITUTE FOR CAREER DEVELOPMENT LUCKNOW 551/KA/135, SBI ROAD, CHANDER NAGAR, ALAMBAGH,LUCKNOW
2774 SOCIETY REGD. OFFICE- VILL- KHARIJA SONARI, PO- BAIKUNTHA PUR, PS- KOTWALI, COOCHBEHAR,WB,736156, BRANCH- RRN ROAD, WORD NO- 19, COOCHBEHAR,WEST BENGAL,736101
2775 SOCIETY FOR AGRICULTURE AND RURAL DEVELOPMENT # 2188/1,5TH MAIN, 5TH CROSS, MCC A BLOCK DAVANGERE, KARNATAKA
2776 SOCIETY FOR COMMUNICATION AND SOCIAL RESEARCH C-108, PALACE ORCHID, PHASE III, KOLAR ROAD BHOPAL -462042
2777 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION #7, PHASE-1, VENKATADRI TOWNSHIP, CHOWDERGUDA, NARAPALLY, GHATKESAR MANDAL, TELANGANA
2778 SOCIETY FOR COMMUNITY EDUCATION AND PARTICIPATION 7, VENKATADRI TOWNSHIP, PHASE - 1, CHOWDERGUDA, NARAPALLY, GHATKESAR
2779 SOCIETY FOR COMPUTER EDUCATION RESEARCH AND TRAINING WELFARE E-GURUKUL COLLEGE, VIJAY NAGAR, NEAR SISHU MANDIR, BUDAUN-243601
2780 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX NAGRI ROAD BEHIND NEW SABZI MANDI KATHUA
2781 SOCIETY FOR DEVELOPMENT AND TRAINING LOTUS COMPLEX, NAGRI COURT ROAD BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA J&K
2782 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI COURT ROAD, LOTUS COMPLEX, BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
2783 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI W.NO.2 LOWER KATHUA
2784 SOCIETY FOR DEVELOPMENT AND TRAINING NAGRI ROAD, LOTUS COMPLEX BEHIND NEW SABZI MANDI KATHUA W.NO. 2 LOWER KATHUA
2785 SOCIETY FOR ECONOMIC DEVELOPMENT 504, SAHITHI ARCADE, SR NAGAR, HYDERABAD
2786 SOCIETY FOR ECONOMIC DEVELOPMENT 504 SAHITHI ARCADE, SR NAGAR NEAR SR NAGAR POLICE STATION HYD
2787 SOCIETY FOR EDUCATION AND ECONOMIC DEVELOPMENT 1/40, MAIN ROAD, ATHINAKUDI, THIRUMARUGAL, NAGAPATTINAM
2788 SOCIETY FOR EDUCATION AND ENVIRONMENTAL TRAINING F-19 A, SUSHANT LOK-2, SECTOR 56, GURGAON
2789 SOCIETY FOR EDUCATION AND RURAL ECONOMIC DEV VILLAGE & P.O: KANISHAIL P.S & DISTRICT- KARIMGANJ
2790 SOCIETY FOR EDUCATION AND WELFARE ACTIVITIES SEWA NEAR POWER HOUSE, CHOUDHANI, VPO NANGAL CHOUDHARY, TEHSIL NARNAUL DISTRICT MAHENDERGARH (HARYANA)
2791 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, NEAR KAMARAJAR STATUE, TIRUVALLUR.TK & DT
2792 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 3/125,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR-602001
2793 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDU SALAI, C/O,SHEEBA DRIVING SCHOOL TIRUVALLUR-602001
2794 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/3,C.V.NAIDUSALAI, C/O,SHEEBA DRIVING SCHOOL, TIRUVALLUR TALUK & DISTRICT.602001
2795 SOCIETY FOR IMPROVEMENT AND SOCIAL INNOVATION SISI 210/03,C.V.NAIDU SALAI, C/O SHEEBA DRIVING SCHOOL COMPLEX TIRUVALLUR
2796 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
2797 SOCIETY FOR INFORMATION TECHNOLOGY DEVELOPMENT BHOPAL S-201, IIND FLOOR, RAKSHA TOWER, CHUNABHATTI, KOLAR ROAD, BHOPAL
2798 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S NAGAR, KURINJIPADI, CUDDALORE DISTRICT, TAMILNADU STATE PIN.607302
2799 SOCIETY FOR PEOPLE EDUCATION AND ECONOMIC DEVELOPMENT NO. 20 S.K.S. NAGAR, KURINJIPADI CUDDALORE DISTRICT, TAMILNADU PIN.607302.
2800 SOCIETY FOR PEOPLES ACTION THROUGH COMMUNITY EMPOWERMENT SPACE 3/16 VINAY KHAND GOMTI NAGAR LUCKNOW.226010. UTTAR PRADESH
2801 SOCIETY FOR PROMOTION OF WASTELANDS DEVELOPMENT 14-A, VISHNU DIGAMBER MARG (ROUSE AVENUE LANE), NEW DELHI
2802 SOCIETY FOR RURAL AND ECO DEVELOPMENT SRED H NO 80 98 2 ABBAS NAGAR KRISHNANAR MAIN ROAD KURNOOL KURNOOL DIST ANDHRA PRADESH STATE PIN 518002
2803 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A-594, AZAD NAGAR, BHILWARA
2804 SOCIETY FOR SOCIAL ACTION AND MOBILIZATION FOR BETTER HUMAN AMENITIES AND AWARENESS A 594 AZAD NAGAR BHILWARA
2805 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, CUSAT ROAD, COCHIN UNIVERSITY P.O, KALAMASSERY
2806 SOCIETY FOR VIDYABHARATHI GROUP OF INSTITUTIONS V B TOWERS CUSAT ROAD CUSAT P.O KALAMASSERY
2807 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION ,ROMESH MARKET SHASTRI NAGAR JAMMU
2808 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU 180004
2809 SOCIETY FOR WORLD EDUCATION AND AWARENESS 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
2810 SOCIETY OF DEVELOPERS INSTITUTE OF COMPUTER TECHNOLOGY 11,MAHAKAUSHAL COLONY, ADHARTAL, JABALPUR
2811 SOCIETY OF PEOPLE FOR DEVELOPMENT B-4, SECTOR-2
2812 SOCIETY OF PHILANTHROPY AT-CHHAGHARIA, P.O- BAGADA, VIA- BALADEVJEW P.S.- KENDRAPARA SADAR DIST-KENDRAPARA
2813 SOCIETY OF SISTERS OF ST JOSEPH OF TARBES SIS.ALEXINA, DIRECTOR, KGF COMMUNITY COLLEGE, ST.SEBASTIAN SCHOOL PREMISES, COROMANDEL PO, KGF-563118, KARNATAKA STATE
2814 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON, P.O- SOLMARI, P.S- NAGAON SADAR, DIST- NAGAON (ASSAM), PIN- 782002
2815 SOCIO ECONOMIC AND ENVIRONMENTAL DEVELOPMENT ORG LAOGAON P.O- SOLMARI P.S- NAGAON SADAR
2816 SOCIOECONOMICDEVELOPMENTASSOCIATION ATHOKPAM AWANG LEIKAI, THOUBAL MANIPUR
2817 SOCIO ECONOMIC DEVELOPMENT PROGRAMME SEDP,65A,M.G ROAD KOLKATA
2818 SOFTECH COMPUTERS DOOR NO 24-01-35,NEAR OLD BUS STAND RAJEEV MARG PARVATHIPURAM VIZIANAGARAM DISTRCT ANDHRAPRADESH
2819 SOFTECH COMPUTERS 3RD FLOOR GMR & GS COMPLEX,OPP: POLICE HEAD QUARTERS,KISHANPURA,HANAMKONDA ,WARANGAL,TELANGANA
2820 SOFTECH COMPUTERS OLD BUS STAND RAJEEV MARG OPP MUNICIPAL COMPLEX
2821 SOFTEK INSTITUTE OF IT 7TH EXTENSION,2ND FLOOR,ROMESH MARKET SHASTRI NAGAR JAMMU
2822 SOMASUNDARAM INDUSTRIAL TRAINING INSTITUTE 214/B SADAYAMPATTI SATTUR VIRUDHUNAGAR DISTRICT
2823 SOM FOUNDATION NGO A-15,AMAR COLONY,SURKHA,BAREILLY,UP
2824 SOMOY FOUNDATION 1ST FLOOR,257/D, PRATAP BAGAN. P.O & DIST- BANKURA, PIN- 722101, WEST BENGAL
2825 SOMOY INFOSYS 257/D, PRATAP BAGAN, P.O. & DIST. - BANKURA, WEST BENGAL.
2826 SONI HOSPITAL PVT LTD 38, KANOTA BAGH , JLN MARG JAIPUR
2827 SONI HOSPITALS PRIVATE LIMITED REGISTERED OFFICE : 11, CHETAK MARG, NEAR POLICE MEMORIAL, JAIPUR HEAD OFFICE : 38, KANOTA BAGH , NEAR POLICE MEMORIAL, JAIPUR
2828 SONY BAHUDDESHIYA SEVABHAVI SANSTHA NANDED AT-PEER BURHAN NAGAR,NANDED (MAHARASHTRA)
2829 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
2830 SONY BAHUUDESHIYA SEVABHAVI SANSTHA 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
2831 SONY BAHU UDESHIY SEVA BHAVI SANSTH 1-13-509,PIRBURHAN NAGAR,NANDED.TQ.DIST.NANDED(MAHARASTRA)
2832 SORNAMMAL EDUCATIONAL TRUST 78, SOLAI STREET, AYANAVARAM, CHENNAI
2833 SOS CHILDRENS VILLAGES OF INDIA A 7, NIZAMUDDIN WEST,NIZAMUDDIN, NEW DELHI
2834 SOS CV INDIA AIRPORT ROAD, MANA CAMP, RAIPUR
2835 SOUNDARYARURALANDURBANDEVELOPMENTASSOCIATION NEAR WATER TANK TANK BOND ROAD WEST CHINTAMANI,CHIKKABALAPURA DIST,KARNATAKA STATE.
2836 SOUTH INDIA TRUST NO.9A, RAMALINGANAR STREET, 10TH STREET, TIRUVANNAMALAI - 606 601, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
2837 SOUTH INDIA TRUST NO 9A RAMALINGANAR STREET, 10TH STREET TIRUVANNAMALAI - 606 601 TAMIL NADU, INDIA
2838 SOUTH KOLKATA INSTITUTE OF TOURISM AND HOTEL MANAGEMENT 3, KALI BARI LANE, DHAKURIA, KOLKATA, WEST BENGAL
2839 SOUTH SUNDARBAN JANAKALYAN SANGHA VILL-RAGHUNATHPUR, P.O.- MADHABNAGAR, P.S. & BLOCK- KAKDWIP, DISTRICT- SOUTH 24 PARGANAS, WEST BENGAL
2840 SPACE SHIKSHAN SAMITI NAVYA TOWER 178 DISTRICT SHOPPING CENTER KAMALA NEHRU NAGAR FIRST EXTENSION NEAR PRATAP NAGAR BUS STAND JODHPUR(RAJASTHAN)
2841 SPARSH SPARSH JK PAPERMILL CAMPUS JK PUR,RAYAGADA
2842 SPB TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN
2843 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
2844 SPEAKWELL ENTERPRISES PVT LTD UNIT NO.10/11, 5TH FLOOR RATAN CHS LTD, OPP PANTALOON, S.V.ROAD, BORIVALI WEST, MUMBAI - 400092
2845 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
2846 SPECTRA CRYOGENIC SYSTEMS PVT LTD H-326(E), ROAD NO. 6, IPIA
2847 SPENTEX INDUSTRIES LIMITED 51 - A SECTOR III PITHAMPUR DISTT DHAR MP
2848 S P MEMORIAL EDUCATIONAL TRUST 2 ELGIN ROAD CIVIL LINES ALLAHABAD
2849 SREE ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILL, MALAPAMBADI POST, TIRUVANNAMALAI TALUK, TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA.
2850 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
2851 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH C CROSS, 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE
2852 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, GEETHA COLONY, JAYANAGAR, 4TH BLOCK, BANGALORE
2853 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11 MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH CROSS, BANGALORE
2854 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS,GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-
2855 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68, 29TH C CROSS, 11TH MAIN, JAYA NAGAR 4TH BLOCK, BANGALORE
2856 SREE BHAVATHARINI CHITS PRIVATE LIMITED #68,29TH 'C' CROSS 11TH MAIN ROAD, GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE.
2857 SREE BHAVATHARINI CHITS PVT LTD #68, 29TH C CROSS, 11TH MAIN GEETHA COLONY, JAYANAGAR 4TH BLOCK, BANGALORE-560011, KARNATAKA
2858 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD, TELANGANA STATE
2859 SREE GAYATRI NATURAL RESOURCES PRIVATE LIMITED D.NO. 2-5-286/9/6/1 OPP: SRI GANESH TEMPLE, GS ESTATES, NH NO 7 ROAD, ADILABAD,
2860 SREEJA EDUCATIONAL AND WELFARE SOCIETY 44-13-86, ANNAPURNAMMAPETA, RAJAHMUNDRY
2861 SREE SAI RAM EDUCATIONAL SOCIETY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAINAGAR,ANANTAPUR
2862 SREE SANKARA EDUCATIONAL TRUST ZOO ROAD TINIALI GUWAHATI
2863 SREI INFRASTRUCTURE FINANCE LIMITED VISHWAKARMA, 86C, TOPSIA ROAD (SOUTH), KOLKATA
2864 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI NAINITAL, UTTARAKHAND
2865 SRESHT FOUNDATION GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI
2866 SRESHT FOUNDATION C/O GEMS, SIJWALI TOWER, KALADHUNGI ROAD, HALDWANI, NAINITAL, UTTARAKHAND
2867 SRF DETECTIVE AND SECURITY SERVICES PVT LTD #24,2ND FLOOR, KESHAVA NIVAS, ABOVE CORPORATION BANK KALIDASA ROAD, GANDHINAGAR, BANGALORE,KARNATAKA
2868 SRI AMMAN EDUCATIONAL TRUST VELLALAR STREET, MECHERI (PO), METTUR (TK) SALEM (DT)
2869 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
2870 SRI AMMAN ITI VELLALAR STREET, MECHERI, METTUR (TK), SALEM (DT), TAMILNADU, INDIA.
2871 SRI ANJANEYA EDUCATIONAL AND RURAL DEVELOPMENT SOC SRI ANJANEYASWAMY EDUCATION AND RURAL DEVELOPMENT SOCIETY. AERDS(R),PURUSHOTHAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD,PAVAGADA.561202 TUMKUR DISTRICT. KARNATAKA.
2872 SRI ANJANEYASWAMY EDUCATIONAL AND RURAL DEVELOPME SRI ANJANEYASWAMY EDUCATIONAL & RURAL DEVELOPMENT SOCIETY (R), PURUSHOTTAM REDDY BUILDING, NEAR PETROL BUNK, BELLARY ROAD, PAVAGADA, TUMKUR - DIST, KARNATAKA
2873 SRI ANNAMALAIYAR CHARITABLE TRUST 4/124, PANDARAM STREET, THIRUCHULI - 626129, VIRUDHUNAGAR DISTRICT.
2874 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE MALAPPAMBADI POST TIRUVANNAMALAI TK & DT
2875 SRI ARUNACHALA SOCIAL AND EDUCATIONAL TRUST NO.399/2-21, THEN ARASAMPATTU VILLAGE, MALAPPAMBADI POST, TIRUVANNAMALAI - 606 611
2876 SRI AUROBINDO FOUNDATION FOR EDUCATION AND RESEARCH B-208 SHAHPURA BHOPAL
2877 SRIBALAJIEDUCATIONAL AND CHARITABLE TRUST 15A INDIAN COMPLEX MANOJIPATTI ROAD THANJAVUR
2878 SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST SRI BANGAARU MEMORIAL PUBLIC CHARITABLE AND EDUCATIONAL TRUST, NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM - 606 401, VILLUPURAM DISTRICT, TAMIL NADU, INDIA
2879 SRI BAPUJI ANGAVIKALARA SEVA SAMSTHE BAPUJI ANGAVIKALARA SEVA SAMSTHE (R) N.H.13, PILLEKERENAHALLI, CHITRADURGA-577 502
2880 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO 17, TGS LAYOUT, OPP WATER BOOSTER, GANDHINAGAR, BELLARY - KARNATAKA
2881 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
2882 SRI BASAVESWAR RURAL EDUCATION AND DEVELOPME TRUST NO. 17, TGS LAYOUT, GANDHINAGAR, BELLARY - KARNATAKA
2883 SRI CHINTHAAMANI VINAYAGAR EDUCATIONAL TRUST 3/95, VETTAMPATTI POST, NAMAKKAL (TK), NAMAKKAL DIST.
2884 SRI GANAPATHY DRIVING SCHOOL NO. 1 PARANTHUR MAIN ROAD, KARAI VILLAGE, KANCHEEPURAM TALUK, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631502
2885 SRIJA ARULJOTHI EDUCATIONAL TRUST NO.115A, KUMARANANDHAPURAM 60FEET ROAD, OPP KIDNEY CENTRE, TIRUPUR
2886 SRI JAGANNATH CULTUREAL TRUST JYOTI VIHAR COMPLEX, NEAR SBI ATM, IPICOL SQUARE JAGATPUR, CUTTACK
2887 SRIJAN IMAGICRAFT PRIVATE LIMITED 201, PRINCES CENTER, 2ND FLOOR, 6/3, NEW PALASIA, INDORE
2888 SRI KALPA TARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
2889 SRI KALPATARU GYAN JYOTI TRUST SRI KALPATARU GYAN JYOTI TRUST VIM-446,SAILASHREE VIHAR,CHANDRASEKHERPUR,BHUBANESWAR ODISHA-21
2890 SRI KALPATARU GYAN JYOTI TRUST SRI KALPA TARU GYAN JYOTI TRUST NIAT COMPUTER EDUCATION VIM-446,SAILASHREE VIHAR, CHANDRASEKHER PUR BHUBANESWAR
2891 SRI KANDULA OBUL REDDY CHARITIES KADAPA 1-397-1 COURT ROAD KADAPA
2892 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
2893 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #248/25,THUNGABHADRA BADAVANE, HUVINA HADAGALI. DIST:BELLARY 7022036227
2894 SRI KOTTURESHWARA RURAL DEVELOPMENT TRUST #148/25,"NAAGASRI NILAYA" WARD NO.8 ,THUNGABHADRA BADAVANE, HUVINA HADAGALI-583219, BELLARY DISTRICT.
2895 SRI KRISHNA EDUCATIONAL AND CHARITABLE TRUST 3A, PERUMAL KEELA MADAVILAGAM, NAGAPATTINAM(DIST.), TAMILNADU
2896 SRI KRISHNA EDUCATIONAL TRUST 74 WEST STREET, MAZHIYAMPATTU, TIRUVENNAINALKUR TALUK VILLUPURAM-607203
2897 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184,BRAHMIN STREET, CHITTOOR
2898 SRI LAKSHMI NARAYANA INFOTECH D.NO: 7-184, BRAHMIN STREET, CHITTOOR
2899 SRI MAHALAKSHMI DRIVING SCHOOL 3/521 PARUVAI ROAD,KARANAMPETTAI,PALLADAM,TIRUPUR
2900 SRIMANTA SANKARDEV FOUNDATION REGD OFFICE L.K BORUAH ROAD WARD NO-13, P.O/DIST-GOLAGHAT,ASSAM PROJECT OFFICE-CHANDMARI WARD NO-10 P.O/DIST-GOLAGHAT, ASSAM 785621
2901 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, KOLKATA, WEST BENGAL, INDIA
2902 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD,GROUND FLOOR, KOLKATA,
2903 SRIMATI TECHNO FOUNDATION PVT LTD 114/2B, HAZRA ROAD, GROUND FLOOR
2904 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
2905 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO : 9444457849
2906 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI DIST MOBILE NO 9444457849
2907 SRI MEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANGUDI TK MOBILE NO : 9444457849
2908 SRIMEENAKSHI AMMAN WELFARE TRUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
2909 SRIMEENAKSHIAMMAN WELFARET RUST 2/130 NAGARAKUDI KUMARAKURICHI POST ILAYANKUDI TK SIVAGANGAI MOBILE NO 9444457849
2910 SRI MUTHAIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
2911 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU
2912 SRI MUTHIAH MEMORIAL TRUST NO 149, MADHAVARAM HIGH ROAD, NEAR PERAMBUR RAILWAY STATION, PERAMBUR, CHENNAI, TAMIL NADU.
2913 SRI MUTHUMARI CHARITABLE AND EDUCATIONAL TRUST AMARAVATHIPUDUR, KARAIKUDI SIVAGANGAI - DIST TAMILNADU
2914 SR INSTITUTE NO:13/06, DR.ZAKIR HUSSAIN STREET, KARAIKUDI, SIVAGANGAI-DIST.
2915 SRI RAMAKRISHNA SARADA TRUST SRI SARADA ASHRAM, NEW EDAIKKAL, ULUNDURPET, VILLUPURAM DIST. TAMILNADU
2916 SRI RAMAKRISHNA SEVA ASHRAM TRUST SRI RAMAKRISHNA SEVA ASHRAM TRUST,ASHRAM LANE,AZAD ROAD,KALOOR,COCHIN-17,9961298312,9037358312
2917 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
2918 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
2919 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR,COCHIN
2920 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASRAMAM LANE,AZAD ROAD,KALOOR,COCHIN,ERNAKULAM DT
2921 SRI RAMAKRISHNA SEVA ASHRAM TRUST ASHRAMAM LANE,AZAD ROAD,KALOOR
2922 SRI RAM EDUCATIONAL SOCIETY ADMN. OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKSH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5-HIWAY, NEAR MPDO OFFICE, HUKUMPETA CENTER, RAJAHMUNDRY.
2923 SRI RAM EDUCATIONAL SOCIETY ADMINISTRATION OFFICE: #75-6-21, F-8, JETTI DELUX APARTMENT, OPP. INDIAN BANK, PRAKASH NAGAR, RAJAHMUNDRY. TRAINING CENTER: NH5 HIGWAY, BESIDE MPDO OFFICE, HUKUMPETA, RAJAHMUNDRY.
2924 SRIRAM EDUCATION SOCIETY PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308
2925 SRI RAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, BALLIA
2926 SRI RAM VIDYAPEETH SRI RAM TOWERS, NEAR POLICE STATION, ROUGHA, BALLIA (U.P.) -277211
2927 SRIRAM VIDYAPEETH NEAR POLICE STATION, ROUGHA, ROUGHA, BALLIA (U.P.)
2928 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO:. 17, SUNDHARAJ & CHARITABLE TRUST, SUBRAMANIYAPURAM NAGAR, TRICHY
2929 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO.17,SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY.
2930 SRI SAI EDUCATIONAL AND CHARITABLE TRUST NO: 17, SUNDHARAJ NAGAR, SUBRAMANIYAPURAM, TRICHY - 620020
2931 SRI SAI RAM EDUCATIONAL SOCEITY II FLOOR,GIRISH TOWERS,OPP:SBI MAIN BRANCH,SAI NAGAR II CROSS,ANANTAPURAM
2932 SRI SAIVENKATESHWARA INFOTECH NO 10 VINAYAGA COMPLEX BUS STAND THURAIYUR(POST),TRICHY DIST
2933 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12, B K ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
2934 SRI SANKARA EDUCATIONAL AND CHARITABLE TRUST NO.12.B.K.ROAD, BANAMALIPUR, AGARTALA, TRIPURA WEST
2935 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHI NALLAMMAI ITI, TRICHY ROAD, VELLAKOIL.
2936 SRI SENAPATHI NALLAMMAI TRUST SANKARANDAMPALAYAM POST, UTHIYUR VIA, DHARAPURAM TK, TIRUPUR.
2937 SRI SENAPATHI NALLAMMAI TRUST SRI SENAPATHY NALLAMMAI TRUST ITI, TRICHY ROAD, VELLAKOIL
2938 SRI SENAPATHY NALLAMMAI TRUST ITI SRI SENAPATHY NALLAMMAI TRUST ITI, SANKARANDAM PALAYAM, UTHIYUR VIA, DHARAPURAM TK, TAMIL NADU - 638 111.
2939 SRI SHANMUGA SOCIAL WELFARE EDUCATIONAL TRUST 12-1-4 F/2, TYSON ABRAHAM ILLAM,GEORGEPURAM,NILAKKOTTAI,DINDIGUL,TAMILNADU
2940 SRI SHANMUGHAM EDUCATIONAL TRUST S.F. NO.438/1 MORUR BIT II VILLAGE ,MORUR -637304 SANKARI TALUK,SANKARI REVENUE DIVISION,SALEM DISTRICT, TAMIL NADU
2941 SRI SHETTY SANGAPPA MEMORIAL TRUST 5TH KILOMETER SHAHABAD ROAD, KALABURGI
2942 SRISHTI EDUCATIONAL AND WELFARE ASSOCIATION BLOCK-1,M/2,CHITTOD COMPLEX MP NAGAR,ZONE-I,BHOPAL MADHYA PRADESH
2943 SRI SIRADI SAI BABA OLD AGE HOME EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY G.S.COMPLEX, OPP.KRISHNA THEATER, M.G.ROAD, TUMKUR
2944 SRISREENIVAASAR INDUSTRIAL TRAINING INSTITUTE NAGORE, PANANGUDI, NAGAPATTINAM
2945 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
2946 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
2947 SRI SRI EDUCATIONAL RURAL AND DEVELOPMENT 13864, STREET NO. 9, GANESHA BASTI , DISTRICT - BATHINDA
2948 SRI STAR TRUST 2/132 BABURAYAN STREET, MELAPULAM, ARAKONAM TK, VELLORE DT.
2949 SRI STAR TRUST 2/132, PAPURAIYAN STREET, MELAPULAM, PANAPAKKAM VIA, ARAKKONAM TK, VELLORE DT.
2950 SRI STAR TRUST 2/132 PAPURAYAN STREET MELAPULAM ARAKKONAM TK VELLORE DT
2951 SRI STAR TRUST 5/285 RAMAKRISHNAPURAM STREET, MELAPULAM, ARAKKONAM TK, VELLORE DT
2952 SRI SUBBARAYAPILLAI INDUSTRIAL TRAINING INSTITUTE 132/10, GANDHI ROAD, SALEM.
2953 SRI VANI EDUCATIONAL SOCIETY 3/4, RICE MILL NEAR, RAMANATHAPURAMPUDUR POST, SENDAMANGALAM VIA, NAMAKKAL DISTRICT.
2954 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3,NEAR AMAR PALI CIRCLE,VAISHALI NAGAR
2955 SRIVAS FOUNDATION 38,COSMO COLONY,GATE-3, NEAR AMAR PALI CIRCLE,VAISHALI NAGAR,JAIPUR
2956 SRI VENKATESHWARA CNC TRAINING CENTRE 3/5, MTH ROAD, PADI, CHENNAI
2957 SRI VENKATESHWARA MARKETING SERVICES 1-883-B, RAJAIAHA STREET, GORANTLA, ANANTAPUR
2958 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST NEAR SRI VENKATESHWARA PRIVATE ITI KALLUDI-561208 GOWRIBIDANUR(T) CHICKBALLAPUR(D) KARNATAKA STATE
2959 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL ONI ROAD, KALLUDI-561208, GOURIBIDANUR TALLUK,CHIKKABALLAPUR DISTRICT, KARNATAKA
2960 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL NEAR SRI VENKATESHWARA ITI, KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR DISTRICT, KARNATAKA
2961 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL KALLUDI-561208, GOURIBIDANUR (T), CHIKKABALLAPUR (D), KARNATAKA
2962 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL BESIDE PGB BANK, KALLUDI POST, GOURIBIDANUR TALUK, CHIKKABALLAPUR DISTRICT, KA
2963 SRI VENKATESHWARA TECHNICAL AND RURAL EDUCATIONAL TRUST ONI RASTHE, KALLUDI POST, GOURIBIDANUR TALLUK, CHIKKABALLAPUR DISTRICT, KA
2964 SRI VENKATESHWARA TECHNOLOGIES #1-4-251, NEAR BALAJI THEATRE, YAWAR ROAD, JAGTIAL - 505327, KARIMNAGAR DISTRICT, TELANGANA.
2965 SRI VENKATESWARA EDUCATIONALL TRUST SRI BALAJI IS, JAYASRI NAGAR, METTU COLONY, AYANALLUR ROAD, GUMMIDIPOONDI
2966 SRI VENKATESWARA EDUCATIONAL TRUST SRI BALAJI IS, JAYASRI NAGAR, AYANALLUR ROAD, METTU COLONY, GUMMIDIPOONDI
2967 SRI VENKATESWARA EDUCATIONAL TRUST BACK TO GH , TEACHERS COLONY, VENNAMPATTY ROAD, DHARMAPURI, TAMILNADU
2968 SRI VENKATESWARA INDUSTRIAL AND TECHNICAL DEVELOPMENT ORGANIZATION 20-3/1, NAIDU BUILDINGS, MITTOOR, CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH, INDIA.
2969 SRI VIKASHNI ENTERPRISES PRIVATE LIMITED 408,PONNIAH STREET. CROSSCUT ROAD, GANDHIPURAM. COIMBATORE. TAMILNADU
2970 SRI VINAYAGA PRIVATE ITI PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD,METTUR (TK)
2971 SRI VISVESA TIRTASWAMIJ EDN URBN AND RURL DVPT STY #1222, 1ST FLOOR SRI GURU THIPPERUDRA SWAMY NILAYA, OPP TO NEW BUS STAND, J C ROAD, NAYAKANA HATTY, CHALLAERE TALUK, CHITRADUGRA DISTRICT-577536, KARNATAKA STATE
2972 SRI YERRAMILLI NARAYANAMURTHY COLLEGE Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-
2973 SRI YERRAMILLI NARAYANAMURTHY COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA-534275
2974 SRI Y N COLLEGE NARSAPUR Y N COLLEGE LECTURERS COLONY, NARSAPUR, ANDHRA PRADESH, INDIA
2975 SRJB MEMORIAL TRUST H/O GOPAL CHANDRA SARKAR 24/82 B , NO.1 GOVT. COLONY , (WARD NO. 6 OF EBM) PO + DIST : MALDA, WEST BENGAL, INDIA. PIN : 732101
2976 SRJB MEMORIAL TRUST NO.1 GOVT.COLONI,
2977 SRK PEOPLE CONSULTANTS I PVT LTD D-17, THACKER INDUSTRIAL ESTATE, NR SITARAM MILL, CHINCHPOKALI W. MUMBAI
2978 SRM CAREER PVT LTD 370 SAHJANANDI APPT OPP KUNTA PARK SOC NR AKBARNAGAR AHMEDABAD
2979 SRM EDUCATIONAL TRUST NO.17,COLLECTOR MURUGARAJ NAGAR, MADHAKOTTAI ROAD, THANJAVUR.
2980 SRM EDUCATION AND SOCIAL WELFARE SOCIETY HOUSE NO 23, NAMAK MANDI, KATRA BAZAR, SAGAR
2981 SRM SOFTTECH 218 SAICHITRA PLAZA 1ST AGRAHARAM SALEM -1
2982 SRPM ASPIRE EDUCATION AN WELFARE SOCIETY EDU B 229, OM SAIRAM MULTIPURPOSE COMPLEX, INDIRA NAGAR MANGAL BAZAR, MANDIDEEP, DIST RAISEN (MP)
2983 SRUJANEE AT-KARADA,PO-REDHUA, DIST-JAGATSINGHPUR
2984 SRUSTI ACADEMY OF MANAGEMENT UNDER NAVODAYA TRUST 38/1 Chandaka Industrial Estate, Near Info City, P.O- Patia, Bhubaneswar
2985 SRUTHI KALA SAMSKARIKA PADANA KENDRAM EDAVANASSERY, MYNAGAPPALLY. P.O, KOLLAM, KERALA
2986 SRUTHI KALA SAMSKARIKA PADANA KENDRAM ISET, 3RD FLOOR, VANDANA TOWERS, LALAJI JN., KARUNAGAPPALLY. P.O
2987 SSC DDHGH
2988 SSG FOOD PRIVATE LIMITED 114-115, INDUSTRIAL AREA, JHOTWARA, JAIPUR, RAJASTHAN
2989 SSIPL RETAIL LIMITED SSIPLRETAIL LIMITED, 81/F4 ,MOHAN CO-OPERATIVE INDUSTRIAL AREA, MAIN MATHURA ROAD,NEW DELHI
2990 SSM POLYTECHNIC COLLEGE SSM POLYETCHNIC COLLEGE, VALAYAKARANOOR, KOMARAPALAYAM, NAMAKKAL DISTRICT
2991 SSR SERVICES SSR SERVICES, OPP: SBI, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM,-531173, AP
2992 SSR SERVICES # 17-89/4, OPP STATE BANK OF INDIA, VIZAG ROAD, PENDURTHI, VISAKHAPATNAM-531173, ANDHRAPRADESH.
2993 SSR SERVICES 17-84/9, OPP STATE BANK OF INDIA, VIZAG ROAD,NEAR GOVT HOSPITAL, PENDURTHI, VISAKHAPATNAM-531173,AP
2994 SS TECHNOLOGIES 1-759, UP STAIRS, ABOVE PRAKASAM OLDAGE HOME,NTR NAGAR, BALARAM COLONY, NEAR POTHURAJU KALUVA, ONGOLE
2995 STAR EDUCATIONAL SOCIETY VILLAGE CHOPARA POST BHOJIPURA
2996 STAR IT PARK RUNBY STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
2997 STARKING COMPUTER EDUCATION PVT LTD 42, BASANT VIHAR, NEAR AMBEDKAR CIRCLE, ALWAR, RAJASTHAN
2998 STAR MANITHANEYA SANGAMAM TRUST 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM
2999 STAR MANITHANEYA SANGAMAM TRUST NGO 912 BANADURAI THIRUMANJANA VEETHI KUMBAKONAM, THANJAVUR DT
3000 STAR SCHOOL SAMITI INDORE 88,BANK COLONY, ANNAPURNA ROAD,INDORE
3001 STAR SCHOOL SAMITI INDORE 88,BANK COLONY ANNAPURNA INDORE MADHYA PRADESH
3002 STAR SECUTECH PRIVATE LIMITED C-77, SECTOR 2, NOIDA
3003 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3004 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3005 STAR SPACE CREATORS PVT LTD ARAMWARI RAJBAGH NEAR FOOT BRIDGE, SRINAGAR KASHMIR
3006 STAR SPARK FLAMEPROOF CONTROL PVT LTD SHED NO 1 ,RIHAL COMPOUND, L.B.S MARG, BHANDUP W MUMBAI
3007 START TRUST BEHIND SHANKER CINEMA HALL SHIVPUR GODDA JHARKHAND
3008 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES PB NO 4 KOTTAKARAI ROAD KANYAKUMARI P.O KANIYAKUMARI DT TAMILNAD
3009 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES, KOVALAM ROAD ,KANNIYAKUMARI P.O,TAMIL NADU-629702
3010 STELLA MARIS INSTITUTE OF DEVELOPMENT STUDIES POST BOX NO. 4, KOTTAKARAI ROAD, KANYAKUMARI, KANYAKUMARI (DIST), TAMIL NADU, INDIA
3011 STEP AHEAD FOUNDATION E 147 SWARAN JAYANTI PURAM
3012 STEP AHEAD FOUNDATION E-147 SWARAN JAYANTI PURAM, NEAR GAUR HOMES, GOVINDPURAM, GHAZIABAD
3013 STIC EDUCATIONAL AND RESEARCH TRUST 311-F EXCHANGE ROAD, KACHI CHAWNI JAMMU.
3014 STIC INFOTECH 311-F EXCHANGE ROAD, KACHI CHAWNI CHOWK, JAMMU (J&K) INDIA
3015 ST JOSEPH EDUCATIONAL AND WELFARE SOCIETY NEAR GARD PALACE BARRAGE ROAD TIPTA KOTA
3016 ST MARY EDUCATIONAL SOCIETY H.NO:5-6-102,ROAD NO:11,VAIDEHINAGAR,VANASTHALIPURAM,HYDERABAD,RANGAREDDY,TELANGANA
3017 ST MICHEAL INDUSTRIAL SCHOOL SAYAL KUDI ROAD KALAIYAR KARISAL KULAM
3018 STUDENT PARTNERSHIP WORLDWIDE INDIA PROJECT TRUST 16/A, B-7 EXT. SAFDARJUNG ENCLAVE, NEW DELHI
3019 ST VINCENT EDUCATIONAL SOCIETY FLAT NO 102 SAI PRAGATHI RESIDENCY STREET NO S, ASHOK NAGAR , HYDERABAD
3020 SUBAS CREATIONS INDIA PRIVATE LIMITED 203 & 204, KHARVEL NAGAR. BHUBANESWAR
3021 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHAL TERWAHA GAUSGANJ HARDOI.
3022 SUBHASH EDUCATIONAL SOCIETY VILLAGE AND POST: KAHALI TERWAHA GAUSGANJ HARDOI.
3023 SUBHASH PUBLIC VIDHYALAYA PRABANDH SAMITI DANTA RAMGARH, SIKAR
3024 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI JALINDRA KI DHANI, GRAM-DANTA, PANCHAYAT SAMITI- DANTA RAMGARH, DISTRICT- SIKAR
3025 SUBHASH PUBLIC VIDYALAYA PRABANDH SAMITI RAJASTHAN ITI CAMPUS, FRONT OF RNT SCHOOL, DEEPPURA ROAD, KUCHAMAN CITY, DISTRICT NAGAUR
3026 SUDAKSHA EDUCATION ENTERPRISE SUDAKSHA EDUCATION ENTERPRISE(A UNIT OF XRG CONSULTING PVT LTD) 1ST FLOOR, MEGHANA TOWERS, H.NO. 1-102/17&18, AYYAPPA SOCIETY ROAD, MADHAPUR,
3027 SUDHAN EDUCATIONAL SOCIETY #505,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH
3028 SUKURA TRUST ANNAI SATHYA NAGAR, KONTAMANAYAKANPATTY, ANDUPATTY POST, THENI DISTRICT, TAMIL NADU, PIN CODE -625512
3029 SUMATHI AGRO INDUSTRIES SURVEY NO.676, LALGADI MALAKPET, SHAMIRPET MANDAL, RANGA REDDY DIST
3030 SUMEET FACILITIES PVT LTD SUMMIT HOUSE 1ST FLOOR, PLOT NO 64/21, D-II BLOCK ,MIDC,CHINCHWAD,PUNE-411019
3031 SUNAINA SAMRIDDHI FOUNDATION VILL. +PO: SISWA, NEAR POST OFFICE, DISTRICT GOPALGANJ 841503, BIHAR
3032 SUNALV EDUCATIONAL AND WELFARE TRUST H.NO.440, NIZAMUDDINPURA, MAUNATHBHANJAN SADAR, MAU (U.P.)
3033 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA, MAUNATHBHANJAN, MAU
3034 SUNALV EDUCATIONAL AND WELFARE TRUST H.N. 440 POWER HOUSE ROAD NIZAMUDDINPURA MAUNATH BHANJAN MAU
3035 SUNDARBAN BONOMALIPUR COMM DEV AND RESEARCH CENTRE BONOMALIPUR, P.O.: RAMLOCHANPUR, P.S.: MONDIRBAZAR, DIST. SOUTH 24 PARGANAS, PIN: 743336, WEST BENGAL, INDIA
3036 SUNITA SHANTARAM EDUCATION TRUST 2, PARSI BUILDING, BAVLA WADI, DR. B.R. AMBEDKAR ROAD, OPP VOLTAS LTD., CHINCHPOKLI (EAST),MUMBAI 400012.
3037 SUNITA SHANTARAM EDUCATION TRUST 69/104, LAXMI SADAN, M. B. RAUR ROAD, DADAR, MUMBAI
3038 SUNMARG ASSOCIATES #1,NSR COMPLEX, OPP. TO NLC ARCH GATE, GANDHINAGAR PO,KURINJIPADI TK.
3039 SUNMARG RURAL WOMEN WELFARE TRUST 1, NSR COMPLEX, OPP. TO NLC ARCH, GANDHINAGAR PO
3040 SUNRISE RURAL DEVELOPMENT SOCIETY 35 GRAM KUNDI DIST - BETUL
3041 SUNSHINE MULTIPURPOSE ASSOCIATION JAWAHAR NAGAR C/O GUPTA BUILDING RAJURA
3042 SUPPORT DVC COLONY, NEAR HANUMAN MANDIR
3043 SURABHI TRUST NO.393, ARASINAR COLONY, PYKARA, MADURAI -625004
3044 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAM PATTY (P.O) PERIYAMALLANAM PATTY (VIA) DINDIGUL
3045 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3046 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3047 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY (VIA) DINDIGUL
3048 SURABI EDUCATIONAL AND CHARITABLE TRUST PAPPANAMPATTY (P.O) PERIYAMALLANAMPATTY VIA DINDIGUL
3049 SURABI SCHOOL OF NURSING PAPPANAM PATTI (P.O) PERIYAMALLANAM PATTI DINDIGUL
3050 SURAJ EDUCATIONAL TRUST 281A,S.N.PURAM ROAD,THIRUTHANGAL
3051 SURAJ EDUCATIONAL TRUST 281-A S.N.PURAM ROAD
3052 SURAJ FOUNDATION VILLAGE AND POST JAGIR
3053 SURAJ FOUNDATION SURAJ FOUNDATION, P-61, KRISHNA VALLEY COMPLEX, MIDC, KUPWAD
3054 SUREEYA SANSTHAN MANDORE ROAD,POATA, JODHPUR (RAJ.)
3055 SUREWIN QUALITY CERTIFICATION PVT LTD M-9 , GOYAL VIHAR, 31-C , ZONE 2 , M.P. NAGAR, BHOPAL, MADHYA PRADESH
3056 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO-KAHNUWAN NEAR BUS STAND
3057 SURJIT MEMORIAL EDUCATIONAL SOCIETY VPO KAHNUWAN NEAR BUS STAND
3058 SUSHEEL MANPOWER SERVICES PRIVATE LIMITED # 8-3-219/18,SRINIVASA COLONY(W), AMEERPET, NEAR SARATHI STUDIO, HYDERABAD
3059 SUVIDE FOUNDATION RISOD SUVIDE FOUNDATION LONI ROAD RISOD DIST. WASHIM
3060 SVL TECHNOLOGIES # 2-3-504/B/7, AKASH APARTMENTS, RAGHUNATHNAGAR, AMBERPET, HYD
3061 SVS EDUCATIONAL SERVICES PRIVATE LIMITED #201, TRENDSET PYLA, ABOVE SYNDICATE BANK, VENGALRAO NAGAR, HYDERABAD.
3062 SWADESI SOCIETY CONTRACTOR PADA, PHULBANI, KANDHAMAL, ODISHA, INDIA
3063 SWADHIN GUSKARA(AUSHGRAM ROAD), PS- AUSHGRAM, BLOCK- AUSHGRAM-I, DIST.- BURDWAN, PIN-713128, WEST BENGAL
3064 SWADHIN SANTINIKETAN INSTITUTE OF POLYTECHNIC CAMPUS VILL. TATARPUR, P.O. MULUK BOLPUR, BIRBHUM WEST BENGAL
3065 SWA JAGRITI YOG SAMITI NEAR MANSHAPURAN HANUMAN TEMPLE, BARETH ROAD GANJ BASODA DISTT VIDISHA-464221
3066 SWAMI PRAGANAND JI EDUCATIONAL SOCIETY 15-GARDEN COLONY,NAKODAR,JALANDHAR
3067 SWAMI VIVEKANAND BAHU SEVABHAVI SANSTHA RIDHORA AT POST RIDHORA TQ BALAPUR DIST AKOLA
3068 SWAMI VIVEKANAND BAHUUDESHIYA SEVABHAVI SANSTHA RIDHORA A/P RIDHORA TQ BALAPUR DIST AKOLA
3069 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 BANDA
3070 SWAMI VIVEKANAND JAN JAGRATI YUWA MANDAL WARD NO 6 SHANTI NAGAR BANDA
3071 SWAMI VIVEKANAND SAMAJ SEVA SAMSTHE A/P: SUTAGATTI, TALUK: BAILHONGAL, DISTRICT: BELGAUM KARNATAKA
3072 SWAMY RAMANANDA TIRTHA RURAL INSTITUTE JALALPUR VILLAGE, BHOODAN POCHAMPALLY MANDAL, NALGONDA DISTRICT, TELANGANA STATE
3073 SWAMY VIVEKANANDA EDUCATIONAL TRUST SWAMY VIVEKANANDA EDUCATIONAL TRUST VIGNANA BHARATHI INSTITUTE OF TECHNOLOGY CAMPUS AUSHAPUR (V),GHATKESAR (M), R.R.DIST-501301. PHONE NUMBER : 9989-353-766 , 9985-148-386 FAX : 08415 – 200321
3074 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3075 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3076 SWARGIYA BHAGWATI SHIKSHAN SANSTHAN VILLAGE, POST OFFICE-BAITALPUR DISTT-DEORIA
3077 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, OLD CENTRAL BANK BUILDING CHAWDI ROAD GADARWARA
3078 SWARGIYA VASHUDHA SONI SMRATI SAMITI C/O AMBAJI COMPUTER & CAREER ACADEMY, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, OLD CENTRAL BANK BUILDING, GADARWARA
3079 SWARNABHUMI PIDIT PARIVAR SANGH 9-9-53 MAHESH NIVAS AKKAMAHADEVI COLONY BEHIND AXIS BANK BVB COLLEGE ROAD BIDAR-585403 KARNATAKA STATE
3080 SWARNGIRI ADHYATMA FOUNDATION BY PASS TIRAHA AMBAH ROAD MORENA
3081 SWASTIK COMPUTER EDUCATION PVT LTD AH - 222, SECTOR - 2, SALT LAKE , KOLKATA - 700091
3082 SWATANTRA SENANI VISHWANATH ABA KOLGE SOCIETY AT. POST. RUIBHAR TQ. & DIST. OSMANABAD
3083 SWATIKA APPAREL PRIVATE LIMITED PLOT NO- 2299, VOTAPADA MANCHESWAR BHUBANESWAR ODISHA
3084 SWATIRTHA CHARITABLE TRUST CHANDIPUR, PO. ABHIRAMPUR , PS. AUSHGRAM, DIST. BURDWAN, WEST BANGAL , PIN - 713144
3085 SWATI WELFARE SOCIETY VALEX MAIN GATE GAUSHALA BUILDING, RAILWAY ROAD UCHANA MANDI
3086 SYADWAD JAIN EDUCATIONAL AND SOCIAL TRUST E-261, AMAR COLONY,LAJPAT NAGAR-IV NEW DELHI-110024
3087 SYLPH EDUCATION SOLUTIONS LIMITED ST-4 PRESS HOUSE , PRESS COMPLEX A.B ROAD INDORE
3088 SYNERGY EDUCATIONAL SOCIETY PLOT.189 &190, SRINIVASA NAGAR, TEMPLE ALWAL, SECUNDERABAD
3089 SYNERGY EDUHOME PRIVATE LIMITED 207, RIDHI SIDHI BHAWAN, AHINSA CIRCLE, SUBHASH MARG, C-SCHEME, JAIPUR
3090 SYSWAY COMPUTER EDUCATION NO.3, III FLOOR, PERIYASAMY TOWERS, CHATHIRAM BUS STAND, TRICHY
3091 TAGEN INFOSOLUTIONS LLP OFFICE NO 408, BUILDING NO. II, LLOYDS CHAMBERS NEXT TO COCONUT GROVE HOTEL, MALDHAKKA CHOWK, 409 MANGALWAR PETH
3092 TAGORE INSTITUTE OF VOCATIONAL STUDIES H.O.- B-66 SECTOR-53 NOIDA-201301 B.O- AMARKUTIR SOCIETY, SRINIKETAN, WEST BENGAL
3093 TAGORE SHIKSHA SAMITI 7, DAYA NAGAR, VIVEKANAND WARD, YADAV COLONY, JABALPUR
3094 TALISMA TEST TALISMA TEST, TALISMA TEST
3095 TANISH SOCIAL WELFARE SOCIETY H3/210 ARVIND VIHAR BAGHMUGALIYA BHOPAL (M.P)
3096 TAPIO CREATIONS PVT LTD 115, SEC-44, GURGAON
3097 TAPIO YFM DESIGNS PRIVATE LIMITED PLOT NO 543Q, PACE CITY-2, SECTOR-37, GURGAON-122001 (HR)
3098 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.- TARAPUR, DIST.- BIRBHUM, WEST BENGAL
3099 TARAPUR SOCIAL DEVELOPMENT SOCIETY VILL. & POST.‐ TARAPUR, DIST.‐ BIRBHUM, WEST BENGAL
3100 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD, PUNE.
3101 TARGET CORPORATE SERVICES PVT LTD 3RD FLOOR, REDKAR HOUSE, SURVEY NO. 135, RAM MANDIR PREMISES, MOHAN NAGAR, CHINCHWAD,
3102 TARINI EDUCATION TRUST ADMN.OFFICE.1294,2ND FLOOR,GOURI COMPLEX,CRP,SQUARE,BHUBANESWAR-12,ODISHA
3103 TATA BUSINESS SUPPORT SERVICES GOWRA TRINITY, CHIRAN FORT LANE, BEGUMPET, HYDERABAD
3104 TATA INSTITUTE OF SOCIAL SCIENCES V.N. PURAV MARG, DEONAR, MUMBAI, MAHARASHTRA 400088
3105 TATWASHILA M BAHUUDESHIYA SEVABHAVI SANSTHA BEED C/O RAHUL JOGDAND NEAR DR.B.R.AMBEDKAR CULTURAL HALL NAGOBA GALLI IDGAH ROAD BEED
3106 T A V EDUCATIONAL AND RURAL DEVELOPMENT TRUST R.O. NO 1 NORTH STREET, NEAR KALIYAMMAN KOVIL, BARIYAL YARD ROAD, AYYAMPALAYAM POST, DINDIGUL DISTRICT, TAMIL NADU PIN CODE 624 204. A.O: NO.12,PRAKASH LODGE COMPLEX, NEAR BUS STAND, THIRUVALLUVAR SALAI. DINDIGUL DT., TAMIL NADU, INDIA, PIN -624003.
3107 TAYYAB HOSPITAL AND EDUCATIONAL TRUST ZIA UL HAQ STREET DEOBAND DISTT SHAHRANPUR
3108 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3109 TEAMYUVA TECHNO SOLUTIONS PRIVATE LIMITED D.NO : 8-2-293/82/A-89/2 1ST FLOOR, F.NO. 2, P.NO 89 OPP. CHIRANJEEVI BLOOD BANK JUBILEE HILLS HYDERABAD
3110 TECHNICAL INSTITUTE OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139 FEEDER ROAD, BELGHARIA, 24 PGS (N), WEST BENGAL, PIN-700056
3111 TECHNICAL INST OF INFO AND MAJESTIC EDU TIIME COLLEGE OF VOCATIONAL TRAINING, 139, FEEDER ROAD,BELGHARIA,24 PGS (N),WESTBENGAL,PIN-700056
3112 TECHNICO INDUSTRIES LIMITED PLOT NO. 19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE, BAWAL
3113 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21,36-38, SECTOR-6, INDUSTRIAL ESTATE BAWAL
3114 TECHNICO INDUSTRIES LIMITED PLOT NO.19-21, 36-38 SECT-6 INDUSTRIAL ESTATE BAWAL
3115 TECHNOHORIZON 2ND FLOOR, SHIVA PLAZA, NEAR ENGG.COLLEGE CROSSING, ALIGANJ, LUCKNOW
3116 TECHWORK SOLUTION 161,2ND FLOOR,PARIMALAM COMPLEX,METTUR ROAD,ERODE
3117 TECHWORLD DOOR NO: 4-1-62, PEDDARELLI STREET,PALAKONDA ROAD, SRIKAKULAM, ANDHRA PRADESH-532001
3118 TECHWORLD PEDDARELLI STREET, PALAKONDA ROAD, SRIKAKULAM ANDHRA PRADESH-532001
3119 TecKnowledge Development Pvt Ltd 201, 2ND FLOOR, LANE BESIDE PANTALOONS GALADA TOWERS, BEGUMPET
3120 TECSOUR INFOSERV PRIVATE LIMITED H.NO. - 9/1, ROAD NO.- B, ADARSH NAGAR, BAGUN NAGAR, NEAR - TOP, BARIDIH, JAMSHEDPUR-831017, JHARKHAND, INDIA
3121 TEGHORIA SHIKSHA BIKASH BHARATI SOCIAL WELFARE SO 188/07, JHAWTALA ROAD, TEGHORIA, KOLKATA-700157
3122 TEKNOCRATS CONTROL SYSTEMS INDIA PRIVATE LIMITED PLOT NO B-61, NICE AREA, MIDC, SATPUR
3123 TEKNOCRATS CONTROL SYSTEMS INDIA PVT LTD B-61, NICE AREA, MIDC, SATPUR, NASHIK, MAHARASHTRA, INDIA.
3124 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3125 TELANGANA STATE WOMEN COOP DEVELOPMENT CORPORATION #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3126 TELANGANA WOMEN COOP DEVELOPMENT CORPORATION # 1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3127 TELANGANA WOMEN COOPERATIVE DEVELOPMENT CORPORATIO #1335/H, ROAD NO.45, JUBILEE HILLS, HYDERABAD
3128 TELEMAGIC MARKETING SERVICES 1144 SADASHIV PETH, 1ST FLOOR SIDDHIVINAYAK APTS, PUNE 411030
3129 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3130 TENDRIL INSTITUTE OF INFORMATION TECHNOLOGY RAMBAGH SRINAGAR
3131 TERRIER SECURITIES SERVICES PVT LTD #583, VYALIKAVAL HBCS LAYOUT, 15TH MAIN ROAD, NAGAWARA, VEERANNAPALYA, ARABIC COLLEGE POST, BANGALORE
3132 TERRIER UTILITYSERVICES PRIVATE LIMITED SISBRO COMPLEX,GURU GOBIND SINGH NAGAR, SHERPUR CHOWK
3133 TERRIER UTILITY SERVICES PVT LTD SISBRO COMPLEX, GURU GOBIND SINGH NAGAR, SHERPUR CHOWK LUDHIANA
3134 TEST GUWAHATI METRO
3135 TEST TEST
3136 TEST1234TEST TEST
3137 TEST ABCD 5678 TESTABCD5678
3138 TESTDATA TEMP DELHI
3139 TEST FIRM TO CHEK MAIL DATED 11 06 2015 NRLM 566- HOTAL SAMRATH
3140 TEST FIRM TO CHEK MAIL DATED 11 06 2015 2ND HOTAL SAMRATH , RACE COURSE.
3141 TEST FIRM TO CHEK MAIL DATED 11 06 2015 3RD TEST MAIL DATA
3142 TEST FIRM TO CHEK MAIL DATED 11 06 2015 4RTH TESTSASA
3143 TEST FOR MAIL JADGSJAS
3144 TESTING TEST
3145 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR I ST STREET PODATUR PET
3146 THANDAVA VENGATESA MUDALIYAR EDUCATIONAL TRUST 63,EST NAGAR PODATUR PET, PALLIPET TALUK, TIRUVALLUR DISTRICT TAMIL NADU
3147 THE ASHOKA HANDLOOM AND HANDICRAFT SOCIETY 1390, NEW HOUSING BOARD COLONY, PANIPAT
3148 THE ASSEMBLY OF GOD CHURCH SCHOOL 18/1,ROYD STREET, KOLKATA, WEST BENGAL
3149 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNURE MAIN ROAD LINGARAJAPURAM BANGALORE
3150 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN OFF HANNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3151 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM BANGALORE
3152 THE ASSOCIATION OF PEOPLE WITH DISABILITY 6TH CROSS, HUTCHIN'S ROAD, ST. THOMAS TOWN, OFF HENNUR MAIN ROAD, LINGARAJAPURAM, BANGALORE
3153 THE ASSOCIATION OF PEOPLE WITH DISABILITY THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN POST OFF HENNUR MAIN ROAD LINGARAJAPURAM BANGALORE
3154 THE ASSOCIATION OF PEOPLE WITH DISABILITY APD 6TH CROSS HUTCHINS ROAD ST THOMAS TOWN LINGARAJAPURAM
3155 THE BOURNEMOUTH AND POOLE COLLEGE ROOKEYS, PLOT NO: 171, KAVURI HILLS PHASE II, MADHAPUR, HYDERABAD, TELANGANA, INDIA-500081
3156 THE COG WHEEL TRUST 135,THANDALAM,KUMINIPET POST,ARAKKONAM,VELLORE DIST,TAMIL NADU, SOUTHINDIA,PIN 631003
3157 THE EASTERN EDGE RURAL DEVELOPMENT SOCIETY HOUSE NUMBER 01, ROAD NUMBER 02, JANPATH, SHUKLA COLONY, HINOO, RANCHI, JHARKHAND
3158 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3159 THEERADESA HOUSE CONSTRUCTION COOPERATIVE SOCIETY CHANDRAPPINNI P O, SULU TOWER, THRISSUR, KERALA
3160 THE HOST MULTI EDUCATION AND RESEARCH SAMITHI NEAR JSK BANK BUS STAND SITAMAU DIST MANDSAUR
3161 THE INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT IED 5/1358, T.A.M.S. COLONY ELLAKKIAMPATTI DHARMAPURI TAMILNADU
3162 THE MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.10, SRINIVASA PILLAI STREET, PUDUPALAYAM, CUDDALORE - POST, TAMILNADU STATE
3163 THENDRAL DRIVING SCHOOL 37/4 PARAMBAI ROAD R S MANGALAM POST THIRUVADANAI TALUK RAMANATHAPURAM DIST
3164 THE RENAISSANCE EDUCATIONAL CHARITABLE TRUST NO. 23A GOGULAM STREET, LITTILE KANCHEEPURAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN - 631501
3165 THE SOCIAL ENVIRONMENTAL ECONOMIC DEVELOPMENT SOCIETY LAMDING CHERAPUR, PO- WANGJING, THOUBAL DISTRICT, MANIPUR
3166 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI
3167 THE SOCIETY OF DAUGHTERS OF MARY IMMACULATE AND COLLABORATORS DMI - AMALA BAVAN, NO.5, RUDHRA ROAD, ST. THOMAS MOUNT, CHENNAI, STATE: TAMIL NADU.
3168 THE SOCIO ECONOMIC DEVELOPMENT ASSOCIATION ATHOKPAM AWANG LEIKAI PO- THOUBAL DISTRICT- THOUBAL
3169 THE VOLUNTARY SOCIAL SERVICE FOUNDATION 115,116,NEW GANDHI NAGAR, ATHIYANDAL, TIRUVANNAMALAI.
3170 THI CHIPHI FOUNDATION 3/182 PR COMPLEX 1ST FLOOR,BANK COLONY,NARAYANAPURAM,MADURAI.
3171 THINK BIG CORPORATE CONSULTANTS RISHI RAJ PALACE, PURBANCHAL NAGAR, BYE LANE NO 1,NEAR SBI, BEHIND E.G NURSING HOME, NARENGI TINIALI, GUWAHATI, ASSAM
3172 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406 DLF CROSS POINT DLF PHASE 4 GURGAON
3173 THINKLINK SUPPLY CHAIN SERVICES PRIVATE LIMITED 405 406, DLF CROSS POINT DLF PHASE 4 GURGAON
3174 THITHOLI SAMAJIK EVAM SANSKRITIK DARPAN NAWADIH EIDGAH, AURANGABAD -824101 BIHAR INDIA
3175 THOOTHUKUDI DIST TINY AND SSI ASSOCIATION NO. 4/158, RAM NAGAR, ETTAYAPURAM ROAD, TUTICORIN
3176 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY - DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI
3177 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST, TRICHY DINDIGUL ROAD, POOLANGULATHUPATTI, TIRUCHIRAPALLI 620009
3178 THOUSU PERIYAKKAL EDUCATIONAL HEALTH AND CHARITABLE TRUST NO 5 KURUNJI SALAI, ANNAMALAI NAGAR, TRICHY
3179 TIFFINS FRESH FOODS PRIVATE LIMITED SCF 146, SECTOR 37, MAIN HUDA MARKET, DELHI BADARPUR BORDER, FARIDABAD. 121003
3180 TIFFINS FRESH FOODS PVT LTD SCF-146, SECTOR 37, MAIN HUDA MARKET, FARIDABAD, HRYANA
3181 TIGER 4 SECURITY AND DETECTIVE INDIA PVT LTD 7 LOWER GROUND FLOOR, LOCAL SHOPPING COMPLEX, B-1 BLOCK, VASANT KUNJ, NEW DELHI
3182 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3183 TIKSNA LIVELIHOOD PRIVATE LIMITED 40B, 1ST FLOOR, KAMGAR NAGAR, NEAR MUNICIPAL SCHOOL, S. G. BARVE MARG, KURLA EAST, MUMBAI
3184 TIKSNA MISSION TRUST BUNGLOW#.54B, 1ST FLOOR, KURLA KAMGAR CHS, S.G.BARVE MARG, KURLA (E), MUMBAI
3185 TIKSNA MISSION TRUST TIKSNA MISSION TRUST, 40-B, FIRST FLOOR, KAMGAR NAGAR, KURLA EAST
3186 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S.NO.455/B, 403-404, 4TH FLOOR, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3187 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST S NO.455/B, 403-404, MATOSHRI PLAZA, 4TH FLLOR, VENUS CORNER, STATION ROAD, KOLHAPUR
3188 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INST 403,404, MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3189 TIME INDUSTRIAL ENTREPRENEURSHIP DEVELOPMENT INSTI S NO 455/B, 4TH FLOOR, 403-404 MATOSHRI PLAZA, VENUS CORNER, STATION ROAD, KOLHAPUR
3190 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3191 TIMES CENTRE FOR LEARNING LIMITED GR. FLOOR, VAKRATUNDA CORPORATE PARK, VISHWESHWAR NAGAR, CTS NO 256, OFF AAREY ROAD, NEAR UDIPI VIHAR HOTEL , GOREGAON EAST, MUMBAI
3192 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3193 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, VIRAMATHY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DIST.
3194 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY POST, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT
3195 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR (TALUK), SIVAGANGAI DISTRICT
3196 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY (PO), TIRUPPUTTUR (TALUK), SIVAGANGAI (DIST), TAMIL NADU
3197 TIRUPPUTTUR RURAL UPLIFT PROJECT ASSOCIATION SIRUKUDALPATTY, TIRUPPUTTUR TALUK, SIVAGANGAI DISTRICT.
3198 TNG INFRATEL PVT LTD TNG HOUSE,FIRST FLOOR, 80A, PARAM, MILAK
3199 TNG INFRATEL PVT LTD TNG HOUSE,80A, PARAM, MILAK, DISTT. - RAMPUR
3200 TNG INFRATEL PVT LTD TNG CENTER, ABOVE STATE BANK OF INDIA, DD CHOWK, NAINITAL ROAD, CIVIL LINES, RUDRAPUR
3201 TOOL ROOM AND TRAINING CENTRE GUWAHATI UNDER MINISTRY OF MSME GOVT OF INDIA AMINGAON INDUSTRIAL AREA, NORTH GUWAHATI ROAD, AMINGAON, GUWAHATI - 31
3202 TOP BLUE SUPPLY CHAINS PVT LTD NO. 84 KAVURI HILLS, PHASE 2 MADHAPUR, HYDERABAD INDIA
3203 TOPSGRUP INTERNATIONAL SECURITY ACADEMY PVT LTD 5 ROYAL PALMS ESTATE, AAREY MILK COLONY, GOREGAON EAST, MUMBAI
3204 TOUCH IN ASSOCIATES PLOT NO-1132, JAYDEV COLLEGE ROAD, NR ELETRIC SUB STATION, HANSPAL CHACK, BHUBANESWAR
3205 TRADESMEN JOBS PRIVATE LIMITED A-2, 1ST FLOOR, AURUM ENCLAVE, NEHRU ROAD, OPP.VAKOLA MASJID, VAKOLA, SANTACRUZ (EAST), MUMBAI
3206 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068, INDIA
3207 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL - 700068
3208 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK, KOLKATA, WEST BENGAL-700068
3209 TRANSTEK SOLUTIONS PRIVATE LIMITED 131, JODHPUR PARK KOLKATA WEST BENGAL
3210 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340, TOWER-B-3, SPAZE ITECH PARK, SEC-49, SOHNA ROAD, GURGAON
3211 TRENDSETTERS SERVICE PRIVATE LIMITED UNIT NO-340 TOWER-B-3 SPAZE ITECH PARK SEC-49 SOHNA ROAD GURGAON
3212 TRIBAL EDUCATION AND CHARITABLE SOCIETY B/H:-STATE BANK OF INDIA CHHOTAUDEPUR GUJARAT
3213 TRILOK YOUTH CLUB AND CHARITABLE TRUST 41/B TRILOK NAGAR, NR AYUVEDIC COLLEDGE, OUTSIDE PANIGATE, WAGHODIA ROAD, VADODARA
3214 TRINITYKTP TECHNOLOGIES PVT LTD 2ND FLOOR, NEAR S P OFFICE, AMBEJOGAI ROAD, LATUR
3215 TRIPHLA SOLUTIONS PRIVATE LIMITED G 77/2, SF, AF ENCLAVE-II, SHAHEEN BAGH, OKHLA
3216 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR
3217 TRIPURA ADIBASHI MAHILA SAMITY KRISHNA NAGAR AGARTALA WEST TRIPURA
3218 TRIPURA ADIBASHI MAHILA SAMITY 9/4 KRISHNANAGAR ROAD, AGARTALA, TRIPURA
3219 TRISOME EDUCATIONAL AND CHARITABLE TRUST M-13, IST FLOOR, H.B.COLONY, PHASE-II PERUMAL PURAM, TIRUNELVELI.
3220 TROIKA LEARNING SOLUTIONS PVT LTD 59A 1ST FLOOR MNR COMPLEX, BANASWADI MAIN ROAD, BENGALURU, KARNATAKA.
3221 TRP HUI NAGAR
3222 TRUST FOR RETAILERS AND RETAIL ASSOCIATES OF INDIA TRRAIN 304, B WING, EUREKA TOWERS, MINDSPACE LINK ROAD, MALAD WEST MUMBAI 400064
3223 TRUST IN THE AREA OF SOCIAL ACTIVITIES NO.74, OLD BAZAAR STREET, ARAKKONAM – 631 001, VELLORE DISTRICT TAMILNADU
3224 TULJABHAVNI GRAMVIKAS SEVABHAVI SANSTHA NALWANDI C/O TOTE R G A/P TQ PATODA DIST BEED
3225 TULJAI BAHUUDESHIYA SANSTHA MEHRUN JALGAON 363,NEAR TALATHI OFFICE MEHRUN JALGAON
3226 TUNGNATH EDUCATIONAL SOCIETY B-11, FIRST FLOOR, SECTOR-19, NOIDA, UTTAR PRADESH
3227 TUVALLUR DIRUVALLUR DISTRICT AGRICULTURAL LOBOUR WELFORE ASSOCIATION 25/3A2, .B.R. COMPLEX, AMMAIYARKUPPAM ROAD, R.K.PET, PALLIPET TK, TIRUVALLUR DT
3228 TUV RHEINLAND NIFE ACADEMY PRIVATE LIMITED 82/A , WEST WING , 3RD MAIN ROAD , ELECTRONIC CITY, PHASE -1 BANGALORE , KARNATAKA
3229 UAR INFO TECH PVT LTD BO S.S.COLLEGE ROAD NEAR INDANE GAS AGENCY RAMPURA PHUL DIST. BATHINDA PUNJAB
3230 UBAIDULLA A REHMAN RASHID EDU AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3231 UBEDULLAH ABDUL REHMAN RASHID EDUCATION AND CHARITABLE TRUST O/S, WANSIYA GATE, KANKA ROAD, LUNAWADA, DIST. MAHISAGAR, GUJRAT-389230
3232 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1, NEAR NEHRU PUBLIC SCHOOL, MORADABAD
3233 UDAAN HAUSLON KI SAMITI GOVIND NAGAR GALI NO.1,NEAR NEHRU PUBLIC SCHOOL, MORADABAD-244001
3234 UDAYA TECHNOLOGIES #15/4, NAGARIKA VEDIKE, VISHWAMANAVA DOUBLE ROAD, KUMEVPU NAGAR, MYSORE
3235 UDHAGAMANDALAM SOCIAL SERVICE SOCIETY 8/10 MANOS UNIDAS ANIMATION TRAINING CENTRE CHARRING CROSS UDHAGAMANDALAM THE NILGIRIS
3236 UDYOGWARDHINI SHIKSHAN SANSTHA NASHIK 3RD FLOOR,NIRMAN INSPIRE,KANHEREWADI,NEAR OLD CBS NASHIK
3237 UG HR SERVICES PRIVATE LIMITED OLD NO.4/70 NEW NO. 6/178, MANIMEDU SERVICE ROAD, KEEL MANAGAR, KOVUR, THANDALAM CHENNAI – 600122, INDIA.
3238 UMEED WELFARE FOUNDATION 18, OAKWOOD , MALIBU TOWNE ,SOHNA ROAD, SECTOR 47,GURGAON
3239 UNIFIERS SOCIAL VENTURES PVT LTD B-100, LGF SARVODAYA ENCLAVE
3240 UNIMAX SERVICES PRIVATE LIMITED HIG-13, DHARMA VIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA
3241 UNIQ DETECTIVE AND SECURITY SERVICES PVT LTD 81A 2ND CROSS GKW LAYOUT VIJAYANAGAR BANGALORE
3242 UNIQUE CREATIVE EDUCATIONAL SOCIETY STATION ROAD SINGHIA GHAT
3243 UNIQUE EDUCATIONAL SOCIETY VPO BHAMBHOLI, DISTRICT YAMUNANAGAR
3244 UNIQUE HORIZON ENGINEERS AND INFRASRUCURE DONGARGAON SHE TQ GANGAKHED DIST PARBHANI
3245 UNIQUE HORIZON ENGINEERS AND INFRASTUCTURE PVT LTD AT. DONGARGAON PO. DONGARPIMPLA TQ. GANGAKHED DIST. PARBHANI STATE. MAHARASHTRA
3246 UNIQUE TECHNICAL TRAINING AND EDUCATIONAL SOCIETY 27 NEW ROAD DWARIKA STORES CHOWK, NEAR NEW NEGI SWEET SHOP DEHRADUN, UTTRAKHAND
3247 UNITED APPAREL SOLUTIONS PLOT NO 9 TEXTILE PARK 74 UDEGOLAM VILLAGE RAYADURGA MANDAL ANANTAPURAM DISTRICT
3248 UNITED APPAREL SOLUTIONS PLOT NO 9, TEXTILE PARK, 74-UDEGOLAM, RAYADURG MANDAL, ANANTAPURAM
3249 UNITED EDUCATIONAL SOCIETY 41, KNOWLEDGE PARK 1, PARI CHOWK, GREATER NOIDA
3250 UNITED EDUCATION SOCIETY 41, KNOWLEDGE PARK 1 PARI CHOWK GREATER NOIDA
3251 UNITED TECNOLOGY INITIATIVES TRUST #221/3,BASHEER MOHAMMED LAYOUT, GANDHI NAGAR, KRISHNAGIRI, KRISHNAGIRI DISTRICT, TAMILNADU.
3252 UNITER CHRITIAN CHURCH OF INDIA 1-10/1,KARUNA HEALTH CENTRE,KETHANAKONDA,IBRAHIMPATNAM MANDAL,KRISHNA DISTRICT,ANDHRA PRADESH
3253 UNIVERSAL IDEAL SEWA SAMITI MAIN ROAD MAHULI, DUDHI-SONEBHADRA
3254 UNIVERSAL INFOTECH 401, MAHALAXMI COMPLEX, SARDA BABU LANE , LINE TANK ROAD, RANCHI, JHAKHAND
3255 UNIVERSAL INFOTECH 401,MAHALAXMI COMPLEX, SARDA BABU LANE, LINE TANK ROAD, RANCHI, JHARKHAND
3256 UNIVERSAL SKILL BUILD INDIA PRIVATE LIMITED C 21/30-A-R 3RD FLOOR, MALDAHIYA, VARANASI
3257 UNNATI MAHILA FOUNDATION "VISAWA" EKLAWYA NAGAR NEAR SUBHASHA NAGAR ARNI ROAD, WADGAON YAVATMAL - 445001
3258 UP BANKING INSTITUTION HAZRAT GANK, UTTAR PRADESH
3259 UPCLIMBING PLOT NO-33/C,MADHUSUDAN NAGAR,NEAR BDA NICCO PARK,OPP.OF SUNADEI TEMPLE, BHUBANESWAR,ODISHA
3260 UP INDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SRI RAM TOWER, HAZRATGANJ, LUCKNOW
3261 UPINDUSTRIAL CONSULTANTS LIMITED 512, 5TH FLOOR, SHRI RAM TOWER, HAZRATGANJ, LUCKNOW
3262 UPKAR KALYAN SAMITI SUBASH NAGAR CHOWK NEXT TO TAKULI GENERAL STORE HALDWANI NAINITAL
3263 UPLABDHI SAMAJIK AWAM SWAIKSHIK SAMITI SHAGUN PLAZA ,BLOCK –A , NEHRU COLONY , DEHRADUN -248001
3264 UPMANYU SHIKSHA SAMITI 2ND FLOOR, SBS PLAZA, NEAR AGGARWAL COLLOEGE TIGAON ROAD, BALLABGARH DISTRICT- FARIDABAD, HARYANA
3265 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ-33A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3266 URBO RURAL INTEGRATED DEVELOPMENT ASSOCIATION WZ 33 A,DAYALSAR ROAD,UTTAM NAGAR,NEW DELHI
3267 URJA GLOBAL LIMITED 487/63, 1ST FLOOR, NATIONAL MARKET, PEERAGARHI, NEW DELHI
3268 URMIDWAR INNOVATIVE ACTION AND RESEARCH FOUNDATION 18,DWARIKAPURAM,NEAR ASHARAM TRUST,CIRCULAR ROAD,BHARATPUR-321001
3269 USHODAYA RURAL AND URBAN DEVELOPMENT VOLUNTARY ORG O V ROAD MRO OFFICE COMPOUND BESIDE E SEVA KANDUKURU 523105 PRAKASAM DT ANDHRA PRADESH
3270 USIT INFOCOM PVT LTD A-152 GALI NO-4 SHAKARPUR DELHI
3271 USIT INFOCOM PVT LTD A-152,GROUND FLOOR,GALI NO-5,ARUNA PARK,SHAKARPUR NEW DELHI
3272 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3273 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3274 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3275 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO- COLLEGE SQUARE,CUTTACK
3276 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, POCOLLEGE SQUARE,CUTTACK
3277 UTKAL SEVAK SAMAJ OMM SRI JAGANNATH NILAYAM, NUASAHI GANDARPUR, PO COLLEGE SQUARE, CUTTACK
3278 UTL TECHNOLOGIES LIMITED NO 19 6 ASHOKPURAM SCHOOL ROAD INDUSTRIAL SUBURB YESHWANTHPUR BENGALURU
3279 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
3280 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUROLA UTTARKHASI
3281 UTTARAKHAND JAN JAGRITI SAMITI KUMOLA ROAD PUTOLA UTTARKASHI
3282 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR,OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
3283 VADODARA RAJPUT YUVA ASSOCIATION BRG COMPLEX, 2ND FLOOR, OPP. BAHURAJI MANDIR, KARELIBAG, VADODARA
3284 VAG MANAGEMENT SERVICES D-42, GROUND FLOOR, SOUTH EXTENSION PART-1, NEW DELHI
3285 VAIDYANATH SARVANGIN VIKAS SANSTHA AT BRAHMAWADI, POST -TOKWADI, PARLI-BEED STATE HIGHWAY, PARLI-V., DIST. BEED
3286 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET,TENKASI,TIRUNELVELI
3287 VAIGAI EDUCATIONAL TRUST 97 PERUMAL KOVIL STREET TENKASI TIRUNELVELI DIST TAMILNADU
3288 VAISHNAVI COMPUTER AND EDUCATION SOCIETY PATHA THANA ., CHANDANGAON CHHINDWARA
3289 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
3290 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST. YAVATMAL
3291 VAISHVIK VIKAS SANSTHA ATPOST MULAWA TA. UMARKHED DIST YAVATMAL
3292 VALEUR FABTEX PRIVATE LIMITED B-39, TRIVENI NAGAR, NEAR GOPALPURA BYPASS, JAIPUR, RAJASTHAN
3293 VALHALL EXPORTS PRIVATE LIMITED VALHALL EXPORTS PVT LTD,229,DSIDC SHEDS,OKHLA INDUSTRIAL AREA,PHASE-1,NEW DELHI-110020
3294 VALUE ADD KNOWLEDGE SERVICES PRIVATE LIMITED STILTH FLOOR, MAXIMUS 2B, RAHEJA MINDSPACE IT PARK, HITECH CITY,MADHAPUR, RANGAREDDY, TELANGANA-500081
3295 VAMANI OVERSEAS PRIVATE LIMITED 169 SECTOR 24
3296 VANDEMATRAM IDEAL PUBLIC SOCIETY GWALIOR VILL& POST BARAUA NEW BY PASS HIGHWAY TIRAHA AB ROAD VIPS COLLEGE CAMPUS GWALIOR
3297 VANI SANSTHA 126, MAHAVEER NAGAR Y, 80 FEET ROAD, NEAR ADARSH VIDYA MANDIR, SANGANER , JAIPUR, RAJASTHAN
3298 VANUSRA SOLUTIONS AND ENTERPRISES PVT LIMITED OPC REGISTERED ADDRESS: NEW NO 29/G2, N R FLATS, 6TH STREET, ALAGIRI NAGAR, VADAPALANI, CHENNAI, TAMILNADU. CORPORATE OFFICE: 11/23, 5TH FLOOR, K R BUILDING, L B ROAD, ADYAR, CHENNAI, TAMILNADU
3299 VAP TECHNOLOGY UNDER VIDYA SOCIETY SHRI GURU TEGH BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
3300 VARAIYA KRISHI BAGVANI EVAM JAN KALYAN SAMITI AMOLPATHA NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI M.P.
3301 VARAIYA VOCATIONAL TRAINING INSTITUTE NEAR RADHA RAMAN MANDIR BADA BAJAR OLD SHIVPURI
3302 VARHAD VIKAS BAHUUDDES SHIKSHAN PRASARAK MANDAL HIWARKHED VARHAD VIKAS BAHUUDDESHIYVA SHIKSHAN PRASARAK MANDAL HIWARKHED C/O MANISH V BHAMBURKAR AT/PO HIWARKHED (RUPRAO)TQ.TELHARA DST.AKOLA
3303 VASANTHAM EDUCATIONAL AND RURAL DEVELOPED SOCITY 14A,SATHIYANARAYANAN STREET, VENKATASAPURI,
3304 VASAVYA MAHILA MANDALI 40-9/1-16 VASAVYA NAGAR, BENZ CIRCLE VIJAYAWADA
3305 VAS KNOWELDGE GROWTH INITATIVES PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW
3306 VAS KNOWLEDGE GROWTH INITIATIVE PVT LTD B-73, NIRALA NAGAR
3307 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
3308 VASUDEV MODEL TRUST CAMPUS OF MAA HINGULA ITI VILL-TALBEDA,P.O-KANDHAL VIA-TALCHER DIST-ANGUL
3309 VASUNDHARA NZARAPAR JAGIROAD
3310 VASUNDHARA NIZARAPAR JAGIROAD
3311 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3312 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3313 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3314 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3315 VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEV VASUNDHARA SEVARTH SAMAJIK SANSODHAN ANI VIKAS SEVA SANSTHA AT POST NANAND TQ NILANGA DIST LATUR MAHARASHTRA PIN 413521
3316 VASUNDHARA VIDYAPRASARAK V K S V SANSTHA REG.OFFICE- AT-DWARKADHISH BHAWAN,NIWANE,TAL-KALWAN,DT-NASIK PROJECT OFFICE- PANDURANG NAGAR,MANMAD,DT-NASIK
3317 VATSALYA EDUCATION AND CHARITABLE TRUST 2ND FLOOR KRISHNA SHRUSTI APARTMENT 10JUNCTION PLOT
3318 VAYAM INFO SOLUTIONS PVT LTD B-157, LOWER GROUND FLOOR, CHITRANJAN PARK, NEW DELHI
3319 VAYAM TECHNOLOGIES LIMITED THAPAR HOUSE, 124, JANPATH, NEW DELHI
3320 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3321 VEDA ARC PROFESSIONALS LIMITED B-68, ELDECO TOWNE, IIM ROAD, LUCKNOW
3322 VEERA EDUCATIONAL SOCIETY #3-20-1/10, RAM MOHAN RAJA NAGAR, KAKINADA, KAKINADA MANDAL, EAST GODAVARI DISTRICT, AP
3323 VEER INDRA SOCILA GROUP SOCIETY ZILA PARTHMIKSHIK SHAK SHANG SIYARAMNAGAR, BHIHKHANPUR,BHAGALPUR
3324 VEE TECHNOLOGIES PVT LTD NO 71,SONA TOWERS,MILLERS ROAD,7TH FLOOR, BANGALORE
3325 VELLORE ACADEMY NO:508/A, VERSHEN COMPLEX 3RD FLOOR, MUTHURANGAM GOVT ARTS COLLEGE ROAD, OTTERI, VELLORE. TAMILNADU.
3326 VELS UNIVERSITY VELS INSTITUTE OF SCIENCE TECHNOLOGY AND ADVANCED STUDIES (VISTAS) ADDRESS : VELAN NAGAR, P V VAITHIYALINGAM ROAD, PALLAVARAM, CHENNAI - 600 117
3327 VEMULA BHASKAR FOUNDATION ELURU MINI BYPASS ROAD, GREEN CITY, PLOT NO 9.
3328 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE JONNALAGADDA(V), NARASARAOPET, GUNTUR DISTRICT
3329 VENKATA RAMANA CHARITABLE TRUST TIRUMALA ENGINEERING COLLEGE,JONNALAGADDA,NARASARAOPET,GUNTUR
3330 VENUS COMPUTER EDUCATIONAL INSTITUTION 76, ALAGAR KOIL ROAD, GORIPALAYAM BUS STOP, MADURAI
3331 VFX ANIMATION COLLEGE # 28/1 SKT COMPLEX,KAKKALUR ROAD THERADI THIRUVALLUR DIST
3332 VGENUINE SOLUTIONS PRIVATE LIMITED FIRST FLOOR BUILDING 7 SIDCO IE RANGRETH
3333 VGENUINE SOLUTIONS PRIVATE LIMITED BUILDING 7 SIDCO RANGRETH
3334 VIBHA EDUCATIONAL DEVELOPMENT SOCIETY #2-31, VIDYA NAGAR, OPP. JNTU MAIN GAYE, ANANTAPUR, ANDHRA PRADESH.
3335 VIDHARBH RURAL RECONSTRUCTION FOUNDATION KONGHARA AT.KONGHARA POST.PIMPRI TQ.KELAPUR DIST YAVATMAL
3336 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3337 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NR. MUKHTANAND SOCIETY, NARMADANAGAR, BHARUCH.
3338 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3339 VIDHYADEEP SOCIETY P.O NARMADA NAGAR, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3340 VIDHYADEEP SOCIETY VIDHYADEEP COMMUNITY COLLEGE, BEHIND GNFC TOWNSHIP, NEAR MUKTANAND SOCIETY, BHARUCH
3341 VIDIYAL MAHALIR MEBATTU SANGAM 29K-RAMNAGAR, DEVAKOTTAI, SIVAGANGAI-DIST
3342 VIDIYAL MAHARIL MEMBATTU SANGAM 29K RAMNAGAR, DEVAKOTTAI SIVAGANGAI-DIST
3343 VIDYA NR KHALSA SCHOOL SUBASH NAGAR NAINITAL ROAD HALDWANI
3344 VIDYA GURU TEG BAHADUR TOWER, NEAR KHALSA SCHOOL, THANDI SADAK, SUBHASH NAGAR
3345 VIDYA SHRI GURU TEG BAHADUR TOWER NEAR KHALSA GIRLS SCHOOL NAINITAL ROAD HALDWANI NAINITAL
3346 VIDYA VAP TECHNOLOGY SHREE GURU TEG BAHADUR TOWER NEAR KHALSA SCHOOL SUBASH NAGAR HALDWANI
3347 VIDYABHARATHI GROUP OF INSTITUTIONS V.B.TOWERS, COCHIN UNIVERSITY ROAD, CUSAT P.O, COCHIN
3348 VIDYADHIRAJA EDUCATION SOCIETY 27/3, ANAND NAGAR, KHANDELWAL MARG, MUMBAI
3349 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI 110096
3350 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HASANPUR VILLAGE PATPARGANJ EAST DELHI
3351 VIDYA FOUNDATION 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE, PATPARGANJ, EAST DELHI
3352 VIDYA NIKETAN SEVABHAVI SANSTHA DONGARGAON DONGARGAON PO. DONGARPIMPALA TQ. GANGAKHED DIST. PARBHANI
3353 VIDYASAGAR ADEVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3354 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3355 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR
3356 VIDYASAGAR ADVANCE EDUCATION SOCIETY C/O GYANSAGAR INSTITUTE TRIPURI CHOWK GARHA JABALPUR 482003
3357 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463,MISHRA COLONY KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
3358 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED 463, KHANKA ROAD, LALLU POKHAR , MUNGER
3359 VIDYOTTAMA CONSULTANCY SERVICES PRIVATE LIMITED MISHRA COLONY, KHANKA MAIN ROAD, LALLU POKHAR, MUNGER
3360 VIJAYA SOCIAL EDUCATIONAL AND CULTURAL TRUST #986, 2ND MAIN,VIDYARANYAPURAM, MYSORE - 570 008
3361 VIJAY GANGA RURAL MEDICAL AND RESEARCH FOUNDATION AT/P – BHALWANI, TAL-PARNER, DIST-AHMEDNAGAR. MAHARASHTRA
3362 VIJAY KUMAR CONTRACTOR HO. NO. - 37, MODERN SAKET COLONY, HISAR.
3363 VIKALP SEWA SAMITI 94, PASCHIMI TARAUS
3364 VIKASH D-2/7, INDUSTRIAL ESTATE RASULGARH, BHUBANESWAR
3365 VIKASH EDUCATION SOCIETY H.NO 1648 URBAN ESTATE JIND
3366 VIKASSHEEL FOUNDATION GRAM PANCHAYAT BHAVAN KE PAS, SHIVTARAI, TAHSIL-KOTA, BILASPUR, CHHATISGARH.
3367 VIKRANT EDUCATIONAL AND SOCIAL WELFARE SOCIETY 3-B ASHIRWAAD, HARIOM COLONY, 7 NO CROSSING, MORAR,GWALIOR
3368 VILLAGE DEVELOPEMNT AND ENVIRONMENTAL ORGANISATION THE SECRETARY NEAR TO INDIAN OVERSEAS BANK., KADAYAMPATTY POST, OMALUR TK., SALEM DISTRICT TAMILNADU
3369 VILLAGE DEVELOPMENT TRUST 63/25, KAMARAJ NAGAR, 3RD STREET, CHOOLAIMEDU, CHENNAI. CECIL ROGERS SALES HEAD 9884922452 9677256296
3370 VILLAGE INDIA KALYAN SANSTAHN KAUSHAL VIKAS PRASHIKSHAN KENDRA
3371 VILLAGE INDIA KALYAN SANSTAHN FRONT ON STATE BANK BINDKI(FATEHPUR)-212635
3372 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI ,FATEHPUR-212635 U.P
3373 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI (FATEHPUR)-212635
3374 VILLAGE INDIA KALYAN SANSTHAN FRONT ON STATE BANK BINDKI
3375 VILLAGE MULTIMEDIA PVT LTD NO.4, 1ST FLOOR, SUNRISE BUILDING, OPP KLE COLLEGE ,2ND STAG
3376 VIMALA DEVI SEWA SANSTHAN LOHIYA NAGAR MAHARAJGANJ
3377 VIMALAGIRI VIDYAPEETAM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 686664
3378 VINAYAGAR PERARASAR TRUST VPT 2/71 SABANAYAGAR STREET MA UAIDAYAR POST KATTUMANNARKOIL TALUK
3379 VINDHYA CONSULTANTS AND SERVICES PRIVATE LIMIITED KOTHI GULJAR BAG,OPPOSITE MULTIPURPOSE SCHOOL,BHARATPUR(RAJ.)
3380 VIRAJ GLOBAL SECURITAS PVT LTD B 156 NEW ASHOK NAGAR , NEW DELHI
3381 VIRAT VOLUNTARY ORGANIZATION FOR RURAL AGRICULTUR VILLAGE DEVARGHATA TEH- DABHRA DIST-JANJHGIR CHAMPA C G
3382 VIRAT VOLUNTARY ORG RURAL AGRI AND TECHNOLOGY 47, SUKH SAGAR PHASE 3, PIPLANI BHOPAL
3383 VIRINCHI LIMITED PLOT NO 10, SRK COLONY, WEST MAREDPALLY, SECUNDERABAD
3384 VIRTUAL COMPUTER EDUCATION SHIV NAGAR NH-1A UDHAMPUR (J&K)
3385 VIRTUAL COMPUTER EDUCATIONAL SOCIETY SHIV NAGAR NH-1A
3386 VIRTUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 TILWARA ROAD APPOSITE HP PATROL PUMP SAGRA JABALPUR
3387 VIRUDHUNAGAR S VELLAICHAMY NADAR POLYTECHNIC COLLEGE MANAGING BOARD ROSALPATTI VILLAGE VIRUDHUNAGAR POST 626 001
3388 VISHNU DAYAL SHIKSHA SAMITI 529K/197, SANT KABIR LANE, KHURRAM NAGAR, LUCKNOW
3389 VISHNU DAYAL SHIKSHA SAMITI 529K/197 SANT KABIR LANE KHURRAM NAGAR LUCKNOW 226022
3390 VISHWABHARATHI EDUCATIONAL DEVELOPMENT TRUST 117 NIZAMPET ROAD KUKATPALLY BRINDAVAN COLONY HYDERABAD
3391 VISHWA BHARATI EDUCATION AND RURAL DEVELOPMENT SOCIETY SAI BRANDAVAN, POLICE STATION ROAD, HOKARNA
3392 VISHWAGYAN BAHUDDESIA SEVABHAVI SANSTHA OPP. UMER MASJID, GAZIPURA, LATUR
3393 VISHWA HINDU EDUCATION SOCIETY NO 1-111/1 A PDA COLLEGE ROAD AIWAN E SHAHI GULBARGA KARNATAKA
3394 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA
3395 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXT., NEAR SECTOR-7, DWARKA, DELHI.
3396 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI-75.
3397 VISHWESHRAIYA EDUCATIONAL TRUST G-55/56, STREET NO-5, PALAM EXTN., SECTOR-7, DWARKA, DELHI
3398 VISION A RURAL DEVELOPMENT SOCIETY H.NO.14-8/3 RAMAYAMPET MEDAK DISTRICT TELANGANA
3399 VISION A RURAL DEVELOPMENT SOCIETY 14-8/3 SDPT RAMAYAMPET MEDAK DITRICT TELANGANA
3400 VISION SHIKSHA SAMITI DEOLI KHASRA NO. 1493/1136, NEAR JAHAZPUR CHUNGI NAKA UNCHA DISTT. BHILWARA
3401 VISION VOICE EDUCARE SOCIETY 111D/1 GARFA MAIN ROAD,JADAVPUR
3402 VISRI TECHNOLOGIES AND SOLUTIONS PLOT NO 89, VENKATESHWARA ENCLAVE, OPP:PRIYADARSHINI HOTEL, SUCHITRA X ROADS, SECUNDERABAD.AP
3403 VISWA BHARATHI TRUST HYDER NAGAR , KUKAT PALLI, HYD - 85
3404 VISWADEEPTHI EDUCATIONAL SOCIETY 20-151/A, JAILKHAN STREET, MITTOOR CHITTOOR, CHITTOOR DISTRICT, ANDHRA PRADESH
3405 VISWA SAI ADS FLAT NO 502, SIVA RESIDENCY, HINDI NAGAR, PANJAGUTTA, HYDERABAD
3406 VITRUAL CRYSTAL MULTITRADE PRIVATE LIMITED NH-7 OPP HP PERTOL PUMP TILWARA ROAD SAGRA JABALPUR
3407 VIVEKANANDA NAGAR PRAGATI VIVEKANANDA NAGAR, POST OFFICE:BABLA GOBINDAPUR PS: SANTIPUR DIST: NADIA WEST BENGAL 741404
3408 VIVEKANANDARURALANDURBANDEVELOPMENTASSOCIATION HNO 6-3-266,NEAR GEETA VIGNANA HIGH SCHOOL,RAMAGIRI,NALGONDA TELAGANA STATE
3409 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS DISTRICT, WEST BENGAL, PIN 743336
3410 VIVEKANANDA SEVAKENDRA O SISHU UDDYAN VSSU ULLON , PO RAMLOCHAN PUR , PS+BLOCK : MANDIR BAZAR, SOUTH 24 PGS , EMAIL :VSSU.IN@GMAIL.COM , WWW.VSSU.IN , PH +91 3174 277451 /9735706439
3411 VIVEKANAND TT COLLEGE WARD 07 BHADRA
3412 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD,
3413 VIVO BIO TECH LIMITED 608, LINGAPUR COMPLEX, HIMAYAT NAGAR, HYDERABAD
3414 VJ SECURITY LLP B 156, NEW ASHOK NAGAR, NEW DELHI
3415 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E),NAVI MUMBAI,MAHARASHTRA STATE
3416 VKS PROJECTS LIMITED B-507,SAI SANGAM,SECTOR-15,CBD,BELAPUR(E) NAVI MUMBAI 400614
3417 VLCC HEALTH CARE LIMITED 64, HSIDC, SECTOR-18, MARUTI INDUSTRIAL AREA, GURUGRAM
3418 VMART PLOT NO. 862,UDHYOG VIHAR INDUSTRIAL AREA PHASE V
3419 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED FLAT NO.B, OLD NO. 9, NEW NO.2, LAKSHMI COLONY, (NEAR NORTH CRESCENT ROAD), T-NAGAR, CHENNAI
3420 VM INTEGRATED SERVICE MANAGEMENT PRIVATE LIMITED WZ-22, ASALATPUR, JANAKPURI
3421 VMIT EDUCATIONAL TRUST NAVDEEP BUILDING NEAR AUCKLAND HOTEL LAKKAR BAZAAR SHIMLA
3422 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO.3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD BHOPAL
3423 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL
3424 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR. BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN ROAD, BHOPAL.
3425 VOCAL HEART INFOTECH PRIVATE LIMITED PLOT NO. 3, 3RD FLOOR BAJAJ TOWER, LALA LAJPAT RAI COLONY, ASHOKA GARDEN, RAISEN BHOPAL
3426 VOC INDUSTRIAL TRAINING INSTITUTE VOC NAGAR,PATTALAMMAN KOVIL ST CHINNAMANUR
3427 VOCMAN INDIA PRIVATE LIMITED C 326, VIKAS PURI, NEW DELHI
3428 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
3429 VOLKSGELD INFRA 154, AVAS VIKAS COLONY, BIJNOR , UP
3430 V S SHAH EDUCATION AND SOFTWARE PRIVATE LIMITED 1/14 PARUL APARTMENT, SHANTADEVI ROAD, NAVSARI
3431 V S SHAH EDUCATION AND SOFTWARE PVT LTD 1/14, PARUL APARTMENT SHANTADEVI ROAD NAVSARI. GUJARAT
3432 VVJ CHARITABLE TRUST 93G/6A/2, PALAI MAIN ROAD, OPP TVS SHOWROOM, THOOTHUKUDI-628002
3433 VYAVASAYA JANA CHAITANYA SAMITHI H.NO: 1-9-8/1/11, FLAT NO:303, B BLOCK, GIRISHIKHARA PLAZA, RAM NAGAR, HYDERABAD, TELANGANA
3434 VYUGA CONSULTING # 2905/3 & 4, HOTEL GANESH COMPLEX SRINIVASAM PILLAI ROAD, RAILADY THANJAVUR
3435 WAGONS LEARNING PRIVATE LIMITED A-8, A/7-8, 4TH FLOOR, SRUSHTI, OPPOSITE CORPORATION BANK, BANER ROAD, PUNE
3436 WAKE UP SKILLS PVT LTD VISHNU SOFTECH, 2ND FLOOR, SHRI DINESH COMPLEX, NEHRU CHOWK, AGRA ROAD, DEOPUR, DHULE
3437 WATERSHED ORGANISATION TRUST 'PRYAVARAN BUILDING' BEHIND MARKET YARD AHMEDNAGAR
3438 WATERSHED SUPPORT SERVICES AND ACTIVITIES NETWORK 12-13-452, STREET NO.1, TARNAKA, SECUNDRABAD
3439 WATRANA TRACTION COMPANY I-28,UPSIDC INDL.AREA,GREATER NOIDA-201306
3440 WATRANA TRACTION PRIVATE LIMITED G-3, SITE V, UPSIDC INDUSTRIAL AREA, GREATER NOIDA
3441 WBSCSTRDSEWA KULIANA, MALINCHA BELIABERAH
3442 WB SOFTECH 41/B/1 ASUTOSH MUKHERJEE ROAD P.S- BUDGE BUDGE P.O- BUDGE BUDGE BLOCK:- BUDGE BUDGE I KOLKATA, WEST BENGAL
3443 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR, 24 PARGANA SOUTH, 700103.
3444 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH-700103
3445 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH - 700103
3446 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR, 24 PARGANA SOUTH ,700103
3447 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA) , NARENDRAPUR , 24 PARGANA SOUTH-700103
3448 WB URBAN ACADEMY PVT LTD SD MATH (KUSUMBA), NARENDRAPUR,24 PARGANA SOUTH-700103
3449 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
3450 WE 4U HUMANITY CULTURAL SOCIETY H NO 7-1-396/2/A/3/A, EWS - 18, B K GUDA, S R NAGAR,HYDERABAD.
3451 WE ARE HUMAN FOUNDATION WE ARE HUMAN FOUNDATION WORKSHOP, C-68, MANGE RAM COMPLEX, LOWER GROUND FLOOR, MAHAVIR VIHAR, SECTOR-1, DWARKA, NEW DELHI.
3452 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3453 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3454 WEBTEK LABS PVT LTD 4, LEE ROAD, VAIBHAV BUILDING, 5TH FLOOR, NEAR RABINDRA SADAN METRO STATION, KOLKATA 700 020, WEST BENGAL.
3455 WELCOME P LTD SIVA ST, MADURAI
3456 WELFARE ORGANISATION FOR RURAL LEAGUE DEVELOPMENT VEJENDLA POST ,CHEBROLU M GUNTUR DIST
3457 WELFARE SERVICES ERNAKULAM PONNURUNNI, VYTILA, ERNAKULAM, KERALA, INDIA
3458 WENS LINK AMAN COMPLEX, 1ST & 2ND FLOOR, NH-15, KHARUPETIA
3459 WENS LINK ALHAJ COMMERCIAL COMPLEX, 1ST FLOOR, NEAR AGV BANK, NH-15, P.O.- BECHIMARI, DISTRICT.- DARRANG, STATE- ASSAM
3460 WEST BENGAL SC AND ST RURAL DEVELOPMENT AND SOCIO ECONOMICS WELFARE ASSOCIATION GOPIBALLAVPUR , PASCHIM MEDINIPUR
3461 WE THE PEOPLE ROOM NO. 102, D211, LAXMANSINGH COMPLEX I, MUNIRKA, NEW DELHI 110067
3462 WHIZZY WORLD SURTEING VB COLLEGE ROAD RAINAWARI
3463 WINGSEDUCATIONS I-II 229/7 SANGAM VIHAR NEW DELHI
3464 WISDOM EDUCATIONAL AND CHARITABLE TRUST 36 PRABHU NAGAR RAKKIYAPALAYAM PIRIVU KANGAYAM ROAD TIRUPUR 641606
3465 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.36,PRABHU NAGAR,RAKKIYAPALAYAM PIRIVU,TIRUPUR
3466 WISDOM EDUCATIONAL AND CHARITABLE TRUST NO.195,EMKAY COMPLEX, KANGAYAM ROAD,TIRUPUR
3467 WITNUT COMPUTING PRIVATE LIMITED G77/2, SF, SHAHEEN BAGH, AF ENCLAVE-II, OKHLA, NEW DELHI
3468 WOMEN AND CHILDREN WELFARE SOCIETY 15/8, BIG STREET CHEYYAR
3469 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
3470 WOMEN EMPOWERMENT AND DEVELOPMENT SOCIETY PAKKIRISAMY NAGR, KURINJIPADI, CUDDALORE
3471 WOMEN EMPOWERMENTAND DEVELOPMENT SOCIETY PAKKIRISAMY NAGAR, KURINJIPADI, CUDDALORE.
3472 WOMEN ENTERPRENEURS OF KARNATAKA ASSOCIATION #6, BESIDE ESHWAR TEMPLE, ESHWAR NAGAR, AMARGOL, OPP.APMC HUBLI
3473 WOMEN ENTREPRENEURSHIP DEVELOPMENT INSTITUTE WEDI CPK COMPLEX, NEAR ARYASAMAJ, RAM MOHAN ROAD, KOZHIKODE
3474 WOMEN INTERNATIONAL NETWORK WIN D-8/8, RIGHT SIDE, PARYAVARAN COMPLEX,SAID-UL-A-JAIB,SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
3475 WOMEN INTERNATIONAL NETWORK WIN D-8/8, PARYAVARAN COMPLEX, SAID-UL-A-JAIB, SOUTH OF SAKET, IGNOU ROAD, NEW DELHI
3476 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI, KISHAN PURA, PANIPAT
3477 WOMEN SOCIAL WELFARE SOCIETY 265/23 KABIR MANDIR WALI GALI KRISHAN PURA PANIPAT
3478 WOMENS WELFARE SOCIETY 5-9-102/3, 1ST FLOOR, PUBLIC GARDEN ROAD, NAMPALLY, HYDERABAD
3479 WORLD WIDE SECURITY ORGANIZATION B-6, VIDHYA NAGAR HOSHANGABAD ROAD BHOPAL , MADHYA PRADESH
3480 XECUTE HR SOLUTIONS PVT LTD #307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON – 122018
3481 XECUTE HR SOLUTIONS PVT LTD 307, TOWER-A, IRIS TECH PARK, SECTOR-48, SOHNA ROAD, GURGAON
3482 XI TECHNOLOGIES PVT LTD 4TH FLOOR, CHAKMIR, BUDGE BUDGE TRUNK ROAD, MAHESHTALA, KOLKATA – 700 141
3483 XYZ XYZ
3484 XYZ SSIISI SSSSF SDG SDG SG
3485 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, CTS NO-95 A, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE
3486 YASHASWI ACADEMY FOR SKILLS 07, AMIT COURT, BEHIND MANGALA THEATRE, SHIVAJI NAGAR, PUNE-411005
3487 YASH BAHU UDDESHIYE SEVA BHAVI SANSTHA TULSAI NIVAS, JALALPUR ROAD, NEAR ARUNODAYA RESIDENCY, PARLI VAIJNATH, DIST : BEED, MAHARASHTRA
3488 YASH EDUCATIONAL SOCIETY III-H/146, NEHRU NAGAR, GHAZIABAD
3489 YASHWANT SHIKSHAN SANSTHA 11, FIRST FLOOR, BACK OF SAMBHAJI NAGAR KAMAN,NEAR SHIVRAJ PETROL PUMP NH- 4 SATARA PIN- 415004.
3490 YATHARTH GURUKRUL COMPUTER SHIKSHAN SAMITI INDORE ROAD DEPALPUR
3491 YELLOW HOME HEALTH CARE PVT LTD 1-63-5-8B, KAVURI HILLS, JUBILEE HILLS POST
3492 YESH BAHUUDDESHIYA SEWABHAVI SANSTHA RAMPURI BK AT.POST.RAMPUTI BK, TQ.MANWAT DIST.PARBHANI HEAD OFFICE RAHUL NAGAR, PARBHANI
3493 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1, MOTILAL NEHRU NAGAR (EAST) BHILAI
3494 YOGENDRA PRAKASH RASTOGI MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH.
3495 YOUNGSTERS ASSOCIATION #2/489,OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL,NAGARAJPET,KADAPA -516001, CON:08562-222083,FAX:08562-222149.
3496 YOUNGSTERS ASSOCIATION YOUNGSTERS ASSOCIATION # 2/489,2ND FLOOR, OPP:ANDHRA JYOTHI LOCAL OFFICE, BEHIND BLUE DIAMOND HOTEL, NAGARAJPET, KADAPA -516001, CON: 08562-222083, FAX: 08562-222149
3497 YOUTH ACTION FOR RURAL DEVELOPMENT RANI BHASKAR NILAYAM, 6-3-668/10/20, 1ST FLOOR, NEAR VENKATESHWARA SWAMY TEMPLE, DURGANAGAR COLONY, PANJAGUTTA, HYDERABAD, TELANGANA STATE
3498 YOUTH BASE DEVELOPMENT SOCIETY C- 1087, TIGRI COLONY
3499 YOUTH EDUCATIONAL SOCIETY HARIDWAR BYPASS ROAD, NEAR RISPANA PUL OPP. AKASHWANI BHAWAN DEHRADUN UTTARAKHAND
3500 YOUTH EFFORTS FOR SOCIETY YES TRUST NO 47, 1ST FLOOR KEB COLONY UDAYAGIRI MYSORE
3501 YOUTH EMPOWERMENT SOCIETY 44 PRAHALAD COLONY, NEAR BY VISHNU GARDEN , SANGANER THANA , JAIPUR
3502 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3503 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3504 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3505 YOUTH EMPOWERMENT SOCIETY 2ND FLOOR, SAI TRIVENI CHAMBERS, NR. TELUGU ACADEMY, HIMAYAT NAGAR, HYDERABAD
3506 YOUTH INDIA SAKSHARTA MISSION BHITAR KAMTA, GOSANIMARI, DINHATA COOCH BEHAR, WEST BENGAL
3507 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
3508 YOUTH RURAL DEVELOPMENT AT- NAHARAPUR, PO- JAJPUR TOWN, DIST- JAJPUR, ODISHA
3509 YOUTH UPTURN VOLUNTARY ASSOCIATION 16-3-245, 3RD FLOOR, TRENDSET TOWERS, RAMALINGAPURAM, NELLORE.
3510 YPJ EDUCATIONAL SOCIETY D.NO.1-9-837/2 TOP OF HIND BAKERY, POCHAMMAGALLY, NIZAMABAD DISTRICT, TELANGANA STATE
3511 YPR MEMORIAL FOUNDATION 7B/1 NEHRU NAGAR (EAST) BHILAI, DIST. DURG, CHHATTISGARH
3512 YUVADESH SHIKSHA EVAM SAMAJIK KALYAN SAMITI C/O SHOURYA CONSULTANCY,GROUND FLOOR,JYOTI CINEPLEX,M P NAGAR,ZONE I BHOPAL
3513 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
3514 YUVA FOUNDATION HIG 2/53, SECTOR-4, DEEN DAYAL UPADHYAY NAGAR, RAIPUR, CHHATTISGARH
3515 YUVA JAGRUTI MANCH B-2/22, WALLFORT ENCLAVE, BEHIND RAMKRISHNA HOSPITAL, PACHPEDI NAKA, RAIPUR
3516 YUVA SANKALP BAHUUDDESHIYA SANSTHA WORD NO. 12, MOHAPA, TAL KALAMESHWAR, DIST NAGPUR
3517 YUVA SANKALP BAHUUDDESHIYA SANSTHA NAGPUR PLOT NO. 28, GOPAL NAGAR, NAGPUR
3518 YUVASHAKTI FOUNDATION 8 /4 , LAKSHA , PURNANAGAR ,BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE-411019
3519 YUVASHAKTI FOUNDATION 8/4 , LAKSHA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
3520 YUVASHAKTI FOUNDATION 8/4 , LAKSHYA , PURNANAGAR , BEHIND RTO , CHIKHALI ROAD , CHINCHWAD , PUNE
3521 YUVASHAKTI FOUNDATION 8/4 , PURNANAGAR , NEAR RTO , CHINCHWAD , PUNE
3522 YUVA TRAINING AND PLACEMENTS RAMALINGAPURAM, TRENDSET TOWERS,3RD FLOOR,NELLORE-524001
3523 YUVA VIKAS SOCIETY 26,DEENDAYAL UPADHYAY MARG,ITO,NEW DELHI
3524 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR JAMMU AND KASHMIR
3525 ZAINABIA EDUCATIONAL SOCIETY KARAN NAGAR SRINAGAR, JAMMU AND KASHMIR
3526 ZENITH CAREER WINGS 51-A,NEHRU STREET , RAMNAGAR, COIMBATORE
3527 ZENITH NEEDS MULTMEDIA T.S.NO:3074-3075, GNANA ARUL PLAZA 1ST FLOOR, RAJA RANI COMPLEX, KEELA RAJA VEETHI, PUDUKKOTTAI DISTRICT.
3528 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL
3529 ZETTABYTE IT SOLUTIONS PRIVATE LIMITED FLAT NO 402 LAHARI SUSHEELA APARTMENT BEERAPPAGADDA UPPAL HYDERABAD
http://rural.nic.in    http://aajeevika.gov.in    http://nird.org.in http://www.nabcons.com http://ddugky.gov.in