Applications filed for PRN allotment
Sr. No. Name Address Submission Date
1 249 WORLD TECHNOLOGY COMPANY PROFESSOR COLONY , STREET NO.-5 PO.- THANESER DISTT- KURUKSHETRA STATE-HARYANA 23-2-2016
2 24X7 TECHSUPPORT SERVICES PRIVATE LIMITED 2ND FLOOR, EDIGA COMPLEX, OPP. BUS STAND, BELLARY 23-4-2015
3 4 G SKILLS EDUCATION SOCIETY K.C. PLAZA, 1ST FLOWER,ABOVE EYE Q HOSPITAL,ATLAS ROAD, NEAR STATE BANK OF INDIA,SONIPAT, HARYANA- 131001. 19-10-2016
4 AAA AAA 8-5-2014
5 AAA BBB JABBALPUR, KATHMANDU, 18-9-2015
6 AAA SOCIETY A AA AAAAAAAAAAAAAA 29-4-2015
7 AACHARAY JEE MAHA SAMATHI DOOR NO 34/ XX APARTMENT 5-4-2016
8 AADARSH NURSING INSTITUTE PRIVATE LIMITED AADARSH NURSING INSTITUTE VILLAGE-DATRENGA SEJBAHAR D/C 9-2-2016
9 AA EDUTECH PRIVATE LIMITED ARYAA 378 KAPALEESWAR NAGAR NEELANGARAI CHENNAI 19-11-2014
10 AAGAZ SOCIETY BY THE PEOPLE FOR THE PEOPLE 109,AMARKOT,RAILWAY CROSSING 22,ISLAMABAD ROAD,OPP KHALSA COLLEGE FOR WOMEN,AMRITSAR 2-6-2014
11 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW 14-3-2016
12 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW 24-2-2016
13 AAGILE BUSINESS ASSOCIATES PVT LTD 519 HARNIWAS COMPLEX DAKBANGLOW 5-2-2016
14 AA INTRADE VENTURES PRIVATE LIMITED 1/1, GROUND FLOOR, MOHAMMADPUR, NEAR AUGUST KRANTI BHAWAN, BHIKAJI CAMA PLACE, NEW DELHI 23-2-2016
15 AAJEEVIKA BUREAU TRUST 2, PANERI UPVAN, STREET NO: 3, BEDLA ROAD, UDAIPUR (OFFICE), STEP ACADEMY, AAJEEVIKA BUREAU, NEWKRISHNAPURA, PULAN, UDAIPUR (TRAINING CENTER) 21-11-2015
16 AAKASH AVIATION ACADEMYRUN BY MANORAMA EDUCATION 1ST FLOOR HOUSING BOARD BUILDING, OPPOSITE SUBHASH NAGAR RAILWAY PHATAK,OLD SUBHASH NAGAR BHOPAL 5-8-2016
17 AAKASH MULTIPURPOSE EDUCATION SOCIETY B.NO. 47, THE MALL ROAD, CANTONMENT, KAMPTEE, TH-KAMPTEE, DISTT-NAGPUR (MH)-441001 17-8-2015
18 A AND D SOLARIS SYSTEMS PRIVATE LIMITED 187,17TH STREET,CHOWDRY NAGAR VALASARVAKKAM CHENNAI 20-5-2016
19 A AND D SOLARIS SYSTEMS PRIVATE LIMITED #187,17TH STREET CHOWDRY NAGAR VALASARAVAKKAM CHENNAI 20-5-2016
20 AANTRISHTI SKILL NETWORK PRIVATE LIMITED 205, ANUPAMA ARCADE, SECOND FLOOR, DDA LSC MAYUR VIHAR PHASE I EXTENSION, DELHI 29-1-2015
21 AARK INDIA EDUCATIONAL TRUST AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103G2 VANNARPETTAI, TIRUNELVELI, TAMIL NADU 22-2-2016
22 AARK INDIA EDUCATIONAL TRUST FRANCIS XAVIER ENGINEERING COLLEGE CAMPUS 103 G/Z VANNARPETTAI, TIRUNELVELI, TAMIL NADU 16-2-2016
23 AAROH SOCIETIES 204,NAHAR ROAD , RUSTAMPUR 23-6-2016
24 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY, KASTURABADHAM (TRAMBA), RAJKOT 5-12-2016
25 AARSH VIDHYA PRASARAN SANSHTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT 14-12-2016
26 AARSH VIDHYA PRASARAN SANTHAN RAJKOT-BHAVNAGAR HIGHWAY KASTURBADHAM (TRAMBA) BLOCK & DISTRICT: RAJKOT 30-8-2016
27 AARSH VIDHYA PRASARAN SANTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT 5-8-2016
28 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR HIGHWAY, KASTURBADHAM (TRAMBDA) RAJKOT - GUJARAT 22-11-2016
29 AARSH VIDYA PRASARAN SANSTHAN RAJKOT - BHAVNAGAR STATE HIGHWAY, KASTURABADHAM (TRAMBA) BLOCK: RAJKOT, DISTRICT: RAJKOT 28-10-2016
30 AARUTHAL FOUNDATION FORMERLY AARUTHAL TRUST NO. 139A, MAHATHMA GANDHI PURAM, BHAVANI, ERODE DISTRICT, TAMIL NADU 5-11-2013
31 AASHARA FOUNDATION B/302, AALEKH, LAD SOCIETY ROAD, VASTRAPUR, AHMEDABAD, GUJARAT 8-9-2016
32 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD 17-8-2015
33 AASHKA INFOCOM PRIVATE LIMITED A-61, KARMACHARI NAGAR PART-2 NR. PARASMANI FLAT RANNA PARK GHTLODIA AHMEDABAD 16-9-2015
34 AASHRAY JAN KALYAN SAMITI 70, SARAYPURA, LALITPUR UTTAR PRADESH 18-3-2015
35 AAWAHAN 252-E, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI- 6-4-2016
36 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELHI 16-5-2016
37 AAWAHAN E-252, AAWAHAN CHAMBER, LFG, SANT NAGAR, EAST OF KAILASH, NEW DELH 23-6-2016
38 AAZAD HIND SEVABHAVI SANSTHA SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH) 9-6-2016
39 AAZAD HIND SEVABHAVI SANSTHA 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH) 23-5-2016
40 AAZAD HIND SEVABHAVI SANSTHA SHOP NO 31 SHASTRI MARKET , NANDURBAR, TAL & DIST NANDURBAR 425412 MH 22-11-2016
41 AAZAD HIND SEVABHAVI SANSTHA NANDURBAR 31 SHASTRI MARKET, NANDURBAR, TAL & DIST NANDURBAR 425412 (MH) 30-6-2016
42 ABBEY WEST SERVICES PRIVATE LIMITED GANAPATIPUR, KODANDAPUR, JAJPUR, ODISHA 25-11-2013
43 ABC KALARA BURDWAN 12-9-2016
44 ABC BHOPAL 4-3-2016
45 ABC JHSDJHDFKLJDFKJHJKGD 24-10-2014
46 ABCD ABCDEFGHIJKLMNOP 7-2-2014
47 ABCD ABCD 14-3-2016
48 ABC FIRM LTD PATNA 2-3-2016
49 ABC PVT LTD PUNE 6-4-2016
50 ABD PVT LTD XYZ 20-1-2015
51 ABDUL MAJEED CENTRAL EDUCATION SOCIETY 502, AMAR SAJJAN TOWER,NAGPUR 27-11-2015
52 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D.A.V.INTER COLLEGE G.T.ROAD ALIGARH 28-9-2015
53 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND NEAR D A V INTER COLLEGE G T ROAD ALIGARH 14-10-2015
54 A BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH 4-1-2016
55 ABHINAV VISHNU VIHAR JANSATH ROAD MUZAFFARNAGAR 16-9-2015
56 ABHINAV MANAVHITWADI SANSTHA PLOT NO. 51 GURUKRUPA HOUSING SOCIETY SHAHUNAGAR SATARA DISTRICT MAHARASHTRA STATE 21-6-2016
57 ABINI TECHNOLOGY CE AND HM IS OF EDUCATIONAL TRUST 594/62,NIRANJAN COMPLEX,2ND FLOOR,NEAR PERIYAR ARCH, TRICHY MAIN ROAD,GUGAI,SALEM. 26-7-2016
58 ABM KNOWLEDGEWARE LIMITED ABM HOUSE,PLOT NO.268, LINKING ROAD,BANDRA (WEST) 28-9-2016
59 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D 39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW 23-6-2016
60 ABSOLUT PRO MARKETIG PRIVATE LIMITED PLOT NO D-39 SEC C PRIYEDARSHINI COLONY SITAPUR ROAD LUCKNOW 25-7-2016
61 ACADEMY FOR COMPUTER TRAINING PRIVATE LIMITED 2ND FLOOR, PARTH EMPIRE, NEXT TO FIRE STATION, RAMBAUG, MANINAGAR, AHMEDABAD 30-1-2014
62 ACADEMY SUBURBIA 3 NO , HOSPITAL ROAD , FIRST LANE ,P.O-DHAKURIA,P.S.-GORFA ,KOLKATA-700078(NEAR HDFC BANK) 12-9-2016
63 ACADEMY SUBURBIA 3 NO., HOSPITAL ROAD , FIRST LANE , P.S.-GORFA,KOLKATA-700078 5-4-2016
64 ACADEMY SUBURBIA 3 NO, HOSPITAL ROAD, FIRST LANE, P.S.-GORFA , KOLKATA-700078 (NEAR HDFC BANK). 16-3-2016
65 ACCEL IT RESOURCES LIMITED 75,NELSON MANICKAM ROAD, AMINJIKARAI, CHENNAI 3-3-2016
66 ACCESS EDUTECH PVT LTD 96 VIRNDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL 19-1-2017
67 ACCESS EDUTECH PVT LTD 96 VRINDAVAN NAGAR AYODHYA BY PASS ROAD BHOPAL 13-12-2016
68 ACCESS LIVELIHOODS CONSULTING INDIA LIMITED PLOT NO - 4, MATRUNILAYAM, TELEPHONE OFFICE LANE, SAI NAGAR COLONY, PICKET, SECUNDERABAD, ANDHRA PRADESH - 500009 17-7-2014
69 ACCOUNTANTS TRAINING INSTITUTE 2ND FLOOR, ZAMZAM BUILDING, MAVOOR ROAD, KOZHIKODE 22-6-2015
70 ACCUSTER TECHNOLOGIES PVT LTD PLOT NO. 41, SECTOR 8, IMT MANESAR, GURGAON 25-10-2013
71 ACE EDUTREND LIMITED A-7/6,JHILMIL INDUSTRIAL AREA SHAHDARA NEW DELHI 11-3-2015
72 ACE EXPERIENCES ASIA P LTD FLAT NO: 101, 6-3-1219/6/1, NCR'S SUBBAMMA TOWERS, UMA NAGAR, STREET NO. 1, BEGUMPET, HYDERABAD 23-4-2015
73 ACE SKILL DEVELOPMENT PRIVATE LIMITED H.NO. 8B, SIVA'S BHAGGYAM, OKKIYAM FOUNDRY ROAD, THORAIPAKKAM, CHENNAI. 4-10-2013
74 ACHARIYA TECHNOLOGIES PRIVATE LIMITED DSS 126 OLD COURT COMPLEX,RAJGARH ROAD, HISAR HARYANA 15-1-2015
75 ACHARYA NARENDRADEV SOCIAL ECO DEV RES PROJ KRANTI NAGAR, GANGAKHED ROAD, IN FRONT OF ANUSAYA THEATER, PARBHANI (MS) 4-1-2016
76 ACME EDUCATION SOLUTION PVT LTD MAIN ROAD CHATRA,NEAR MARWARI SCHOOL,CHATRA-JHARKHAND 17-4-2014
77 ACME EXCELLENT MANAGEMENT PRIVATE LIMITED E-5, UPPER GROUND FLOOR, LSC DDA MARKET, NEW RAJINDER NAGAR, NEW DELHI 2-6-2014
78 ACME INDIA MICROSYS PVT LTD 1ST FLOOR, GORE BLDG., SAHJANAND CHOWCK, SANTOSHI MATA ROAD, KALYAN(W) DIST : THANE, MAHARASHTRA-INDIA 7-1-2015
79 ACROON CONSULTANCY SERVICES 1, D. L. ROAD, GUJRAL TOWERS DEHRADUN UTTRAKHAND 11-7-2016
80 ACT INTERNATIONAL 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM, CUDDALORE DT., TAMILNADU 2-7-2014
81 ACT INTERNATIONAL UNIT OF ACT NATIONAL TRUST ACTI, LCC CAMPUS, 99-100 & 56/117, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU, INDIA. 13-9-2015
82 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI 29-12-2016
83 ACTIONAID ASSOCIATION R-7, HAUZ KHAS ENCLAVE, NEW DELHI 23-12-2016
84 ACTION FOR ADVANCEMENT OF SOCIETY UNIT NO 331, VARDHAMAN STAR CITI MALL, LSC-III, SECTOR-7, DWARKA, NEW DELHI 15-3-2016
85 ACTION FOR COMMUNITY EMPOWERMENT 01, RENUKA COLONY, PUNGAON ROAD, PACHORA, DIST. JALGAON 25-7-2016
86 ACTION FOR GUIDANCE IN EDUCATIONAL AND SOCIAL SERVICES SANKARANKOVIL MAIN ROAD KANARPATTI MANUR TIRUNELVELI 14-9-2015
87 ACTION POINT SAMITI A 1451/7, INDIRA NAGAR, LUCKNOW, UP 18-8-2016
88 ACTIVE SOCIETY FOR INTEGRATED DEV AND MANAGEMENT HIG 137 K SECTOR AYODHYA NAGAR,BHOPAL 15-9-2015
89 ACTIVE SOCIETY FOR URBAN RURAL AND INTEGRATED DEV S.B.TOWER, KUCHAINI PARISAR, NEAR METRO HOSPITAL, DAMOH NAKA, JABALPUR 11-1-2016
90 A C T NATIONAL TRUST 99-100 & 117/56, SOUTH CAR STREET, CHIDAMBARAM & TALUCK, CUDDALORE DISTRICT, TAMILNADU 14-10-2015
91 ADAIKALAMATHA ANNAI EDUCATION AND CHARITABLE TRUST NEW BUS STAND UPSTAIRS, NEXT TO TRAFFIC POLICE STATION, COVAI MAIN ROAD, KARUR. 1-12-2014
92 ADARASH BHAGOYADAY SOCIETY 305A RAJAPUR ALLAHABAD 29-12-2016
93 ADARSHA SAMAJ KALYAN SAMITY BELOGURI NATUN BAZAR PO SOLMARI VIA HAIBORGAON DIST NAGAON ASSAM 14-9-2015
94 ADARSH BHAGYODAY SOCIETY 14A/6 RAJAPUR ALLAHABAD 28-10-2016
95 ADARSH CONVENT SCHOOL SAMITI VILL & POST- MALLAWAN, DISTT. HARDOI(U.P) PIN 241303 14-10-2015
96 ADARSH EDUCATIONAL AND CHARITABLE TRUST DESHMUKH VIDYA BHAVAN,BANGALORE ROAD, INDIRA NAGAR SHAHAPUR, DISTRICT: YADGIR, STATE: KARNATAKA 8-12-2015
97 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM 14-10-2015
98 ADARSH EPRD FOUNDATION OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM 12-1-2016
99 ADARSH EPRD FOUNDATION RAMDURG OPP TO HEAD POST OLD SYNDICATE BANK BUILDING BELGAUM ROAD RAMDURG TQ : RAMDURG DIST : BELGAUM 15-9-2015
100 ADARSH FOODS CITY STATION ROAD KHURJA 17-1-2017
101 ADARSH FOUNDATION RAMDURG NEAR HEAD POST OFFICE R G NAYAK BUILDING RAMDURG DIST:-BELGAUM 21-9-2016
102 ADARSH RASHTRIYA AUDYOGIK PRASHIKSHAN KENDRA CHOLAPUR, VARANASI 25-7-2016
103 ADARSH VIDYALAYA CHOLAPUR VARANASI CHOLAPUR, VARANASI 12-8-2016
104 ADAYANA LEARNING SOLUTIONS PRIVATE LIMITED 2Q4-A3, SECOND FLOOR, CYBER TOWERS, HITECH CITY, MADHAPUR, HYDERABAD. 1-10-2013
105 ADECCO INDIA PVT LTD NO 2, NAL WIND TUNNEL ROAD, MURUGESHPALYA, BANGALORE 11-11-2014
106 ADEPTO GEO INFORMATICS PRIVATE LIMITED 8-2-686/K/21, S-1, 3RD FLOOR, ASHOK ASHA ABODE, BEHIND FORTUNE HOTEL, ROAD NO.12, BANJARA HILLS, HYDERABAD 11-3-2015
107 ADHARSHILA SAMAJIK EVAM SANSKRITIK VIKAS SANSTHAN E -214 RAVI KHAND ELDICO-I BANGLA BAZAR LUCKNOW 5-1-2017
108 ADHARSHILA SHIKSHAN SANGH PROMOTER OF PLATINUM COLLEGE OF PROF STUDIES ADHARSHILA SHIKSHAN SANGH PROMOTER OF PLATINUM COLLEGE OF PROFESSIONAL STUDIES, 3RD FLOOR ASHIRWAD TOWERS G.E. ROAD RAIPUR CHHATTISGARH 6-11-2013
109 ADHIITA LEARNING AND SOFTWARE SOLUTIONS PVT LTD 231/4, II FLOOR, RASHTRAKAVI KUVEMPU NAGAR, BTM LAYOUT, II STAGE, 9-4-2015
110 ADHIKAR PLOT NO. 77/180/970, SUBUDHIPUR, TOMANDO, BHUBANESWAR, KHORDHA 2-2-2015
111 ADHYASHAKTI DATA MANAGEMENT PVT LTD C-1273, OPP. SAGWADI GATE, KALIYABID, BHAVNAGAR, GUJARAT. 16-5-2016
112 ADITHYA INSTITUTE OF FASHION DESIGNING GARMENT NTACT DETAIL ADDRESS * ADITHYA INSTITUTE OF FASHION DESIGNING & GARMENT TECHNOLOGY, KOZHENCHERY, KERALA, PIN 671001 30-11-2016
113 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTER PRIVATE LIMITED, ACCPL TRAINING DIVISION, #88/1, SUBH ARCHADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, BANGALORE 22-4-2016
114 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAA CALL CENTRE PRIVATE LIMITED, ACCPL-TRAINING DIVISION, 1ST FLOOR, #88/1, SHUBH ARCADE, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE 2-3-2016
115 ADITYAA CALL CENTRE PRIVATE LIMITED ADITYAACALL CENTRE PRIVATE LIMITED, ACCPL TRAINING DIVISION, SHUBH ARCADE, #881, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE 22-4-2016
116 ADITYAA CALL CENTRE PRIVATE LIMITED #88/1,SUBH ARCADE, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESSWARAM, BANGALORE 22-4-2016
117 ADITYA CALL CENTRE PVT LTD ADITYA CALL CENTER PVT. LTD, ACCPL TRAINING DIVISION, SHUBH ARCADE, #88/1, 1ST FLOOR, 16TH CROSS, MARGOSA ROAD, MALLESWARAM, BANGALORE 5-2-2016
118 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D NO. 32, 1ST FLOOR, BUDDHA MARG, ADV. RAMAKRISHNA GOWDA BUILDING, GOWRIKOPPALU ARALIKATTE CIRCLE, VIDYANAGAR 14-3-2016
119 ADITYA EDUCATIONAL AND SOCIETAL DEVELOPMENT K.NO. 51, D.NO. 32, 1ST FLOOR, GOWRI KOPPALU ARALIKATTE CIRCLE, BUDDHA MARG, VIDYANAGAR, HASSAN – 573201, KARNATAKA. 16-3-2016
120 ADITYA INTEGRATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA) 9-12-2016
121 ADITYA INTEGREATED EDUCATIONAL AND SOCIAL DEVELOPMENT TRUST LALITA BHAWAN, NICHLI KILA, GARHPAR, BIHAR SHARIF (NALANDA) 16-12-2016
122 ADOPIRE HEALTHCARE PVT LTD D.NO: 6-3-348/9/1, S A RESIDENCY, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD 11-3-2016
123 ADS SKILLS PRIVATE LIMITED H.NO 2B, MAIN ROAD, SHIVA RAMA KRISHNA COLONY, WEST MARREDPALLY, SECUNDERABAD 14-10-2016
124 ADS SKILLS PRIVATE LIMITED H No.2-B, MAIN ROAD SHIVA RAMA KRISHNA COLONY WEST MARREDPALLY, SECUNDERABAD 28-9-2016
125 ADSSOFTEK NO 2A, SRK COLONY, WEST MARREDPALLY, SECUNDERABAD, OPPT TO HDFC BANK 25-8-2015
126 ADS SOFTEK PRIVATE LIMITED HOUSE NO 2B, SIVARAMAKRISHNA COLONY, WEST MARREDPALLY, SECUNDERABAD - 26 AP 9-9-2015
127 ADVAIT DEVELOPMENTAL SOCIETY E-7/MIG 53, ARERA COLONY, BHOPAL 25-11-2014
128 ADVANCED EDUCARE TRAINING PVT LTD PLOT NUMBER A40, ITHUM TOWER A, OFFICE NUMBER 1121, SECTOR 62, NOIDA 26-4-2016
129 ADVI SIDDESHWAR RURAL DEVELOPMENT SOCIETY A/P: VINAYAK NAGAR, BEHIND COURT, BAILHONGAL, DIST: BELGAUM 17-8-2015
130 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA 9-9-2016
131 ADWINGS CONSULTANCY AND SOLUTIONS PVT LTD N 353, FLAT G33, BAISHNAVGHATA PATULI, PATULI, KOLKATA 6-10-2016
132 AEGIS SKILLS EDGE PVT LTD 406 DIAMOND TOWER AJMER ROAD 29-1-2016
133 AEGIS SKILLS EDGE PVT LTD 406, DIAMOND TOWER, AJMER ROAD, JAIPUR 12-1-2016
134 AELIS ENTERPRISE LEARNING AND IMPLEMENTATION SOLUTIONS PRIVATE LIMITED AC 124-125, PRAFULLA KANAN, KESHTOPUR, KOLKATA 700101 3-4-2014
135 AEROSOFT HEALTHCARE PRIVATE LIMITED OPP. SBI BANK GALI KOKER,DURGAPURI,KOKAR,RANCHI,JHARKHAND 5-2-2016
136 AGA KHAN RURAL SUPPORT PROGRAMME INDIA 9TH & 10TH FLOOR, CORPORATE HOUSE, NEAR DINESH HALL, OFF. ASHRAM ROAD, AHMEDABAD 16-10-2013
137 AGI INFRA LIMITED JALANDHAR HEIGHTS, 66FT. ROAD, NEAR URBAN ESTATE PHASE-II JALANDHAR (PUNJAB) 1-9-2014
138 AGILE SECURITY FORCE AND SYSTEMS PVT LTD 341/342, LAXMI PLAZA, LAXMI INDUSTRIAL ESTATE, LINK ROAD, ANDHERI (WEST), MUMBAI 14-9-2015
139 AGILE SECURITY FORCE PVT LTD 3RD FLOOR, UMA ENCLAVE ROAD NO-9 BANJARA HILLS, HYDERABAD -500034. 14-9-2015
140 AGNI SIRAGUGAL CHARITABLE TRUST 4,ASTABUJAM SANNATHI STREET, KANCHIPURAM 30-10-2015
141 AGNI SIRAGUGAL CHARITABLE TRUST 13B,THIRUVALLUVAR STREET, KANCHIPURAM 4-3-2016
142 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D NO 13-3-150/5 NEAR ESWARA SAI PETROL BUNK CHILAKALURIPET ROAD NARASARAOPET GUNTUR DISTRICT ANDHRA PRADESH 12-9-2016
143 AGNUS GANJA BOJEXIO SOCIAL SERVICE SOCIETY D.NO.13-3-154/3 MOHIDIN NAGAR NARASARAOPET GUNTUR 22-6-2016
144 AGRADUT POLLY UNNAYAN SAMITY VILL+PO- GAZA, PS- UDAYNARAYANPUR, DIST- HOWRAH, WEST BENGAL 21-9-2016
145 AGRICULTURAL FINANCE CORPORATION LIMITED B-1/9, COMMUNITY CENTRE, JANAKPURI, NEW DELHI 4-10-2013
146 AHILYABAI BACHHAV SHRAMVIKAS BAHHUDDESHIYA SANSATHA BACHHAV COMPUTERS BEHIND MOUNGIRI GIFT HOUSE ,MAIN ROAD MALI COLONY,SHRAMIK NAGAR SATPUR NASHIK 23-11-2016
147 AHILYABAI BACHHAV SHRAMVIKASH BAHUUDESHIYA SANSTHA BEHIND MOUNGIRI GIFT HOUSE MALI COLONY MAIN ROAD SHRAMIK NAGAR SATPUR NASHIK-422012 4-11-2016
148 AHSAAS EK PRAYAS 1ST FLOOR, RAJDHANI DRY CLEANER, CHANDMARI ROAD MORE, KANKARBAGH MAIN ROAD, PATNA (BIHAR) 14-10-2015
149 AIDE ET ACTION INDIA NO. 16/20, GILCHRIST AVENUE, HARRINGTON ROAD, CHETPET, CHENNAI 13-1-2014
150 AIM EDUCATION AND RESEARCH SOCIETY 208, SAKINA COMPLEX, ABOVE MAHARAJA SWEETS MEHDIPATNAM, HYDERABAD AP 21-10-2014
151 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD 13-1-2017
152 AIM OF PEOPLE MADHAV NAGAR STREET NO 4 KAKO RD JEHANABAD 16-1-2017
153 AIMS #22,8TH MAIN,3RD CROSS,SARASWATHIPURAM,MYSORE 18-7-2014
154 AISECT SCOPE CAMPUS,NH12, NEAR MISROD,HOSHANGABAD ROAD,BHOPAL 20-9-2016
155 AISHWARIAM SOCIAL WELFARE ORGANISATION AND RESOURCE TRAINING CENTRE 1/382,KRISHNA MOORTHY 1ST STREET,WEST AVENUE, NGGO COLONY, COIMBATORE 14-9-2015
156 AISHWARIAM SOC WEL ORG AND RES TRG CEN #1/382, KRISHNA MOORTHY 1ST STREET, NGGO COLONY, COIMBATORE 28-9-2015
157 AISHWARYA SHIKSHA PRASAR AND PRASHIKSHAN SAMITI 27 NEW TOWN MAKRONIYA, SAGAR 12-8-2016
158 A J ARA UCHATAR MADHYAMIC VIDYALAY SHIKSHAN SAMITI HIRACHAK MAHULI 6-1-2016
159 AJAY AND AJAY GROUP OF INDUSTRIES PALAKONDA(MANDAL)PALAKONDA PIN:532440 SRIKAKULAM.A.P 6-1-2016
160 AJAY SHIKSHAN PRASARAK MANDAL OLD MUKUNDWADI,NEAR AVON HOTEL & MANPA SCHOOL,AURANAGABD 17-1-2017
161 AJINKAYA YUVAK MITRA MANDAL LATUR KHORI GALLI, LATUR TQ. DIST. LATUR 28-9-2015
162 AJINKYA MANAV VIKAS PRATISTHAN BASMAT KAUTHA ROAD ,JAY PRAKAS WASAHAT ,BASMAT TQ.BASMAT DIST HINGOLI(MAHARASHTRA) 23-11-2016
163 AJINKYA YUVAK MITRA MANDAL LATUR NEAR TILAK NAGAR, POST OFFICE, KHORI GALLI, LATUR. 7-9-2016
164 AJINKYA YUVAK MITRA MANDAL LATUR KHORI GALLI, NEAR TILAK NAGAR POST OFFICE, LAUR 1-1-2016
165 AJMAL FOUNDATION COLLEGE ROAD, HOJAI. DIST: NAGAON. ASSAM 14-10-2013
166 A K EDUCATION SERVICES PVT LTD VILL-BIRBHANPUR, POST-SALBONI,P.S-SALBONI, DIST-PASCHIM MEDINIPUR 28-10-2016
167 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE NH -24, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR, GHAZIABAD 22-12-2016
168 AKGEC SKILLS FOUNDATION AJAY KUMAR GARG ENGINEERING COLLEGE, 27TH KM STONE, DELHI HAPUR BYPASS ROAD, ADHYATMIK NAGAR,GHAZIABAD - 201009 UTTAR PRADESH, INDIA 16-11-2016
169 AKGEC SKILLS FOUNDATION 1. AJAY KUMAR GARG ENGINEERING COLLEGE 27TH KM MILESTONE NH-24 DELHI-HAPUR BYPASS ROAD ADHYATMIK NAGAR GHAZIABAD, UTTAR PRADESH 201009 29-12-2016
170 AKHAND JYOTI JAN KALYAN SEWA SAMITI 1003,CIVIL LINES, GPO SADAR, GONDA CORRESPONDENCE ADDRESS: MEWALAL TALAB, PURAB TOLA, BALRAMPUR 3-4-2014
171 AKHIL BHARTIYA ADARSH MAHILA EVAM BAL VIKAS SANSTHAN 92,OM VIHAR PHASE-2,UTTAM NAGAR 15-4-2014
172 AKHIL BHARTIYA MANAV CHETNA KALA SANSTHAN REGD. OFF.-LIG 338, G/F,PKT-3C, SECT-16B, DWARKA, NEW DELHI-78 CORP. OFF.-B1/23A, G/F, SEWAK PARK, DWARKA MORE, NEWDELHI 5-4-2016
173 AKHIL BHARTIYA YUVA UTTHAN EVAM SAMAJ KALYAN SANST KARSAR, NAWANAGAR, BUXAR 23-6-2016
174 A K POWER INDUSTRIES PVT LTD SHRUTINEER,23/2/1/1, BHAGABAN CHATTERJEE,LANE, HOWRAH,W.B. INDIA 8-5-2014
175 AKSHARA BUSINESS SERVICES PRIVATE LIMITED 224, NSC BOSE ROAD, PARRYS, CHENNAI. 1-11-2013
176 AKV TRAINING COLLEGE MULLAI NAGAR KANJI VILLAGE & POST CHENGAM TK TIRUVANNAMALAI DT 21-9-2016
177 ALAGAR COMPUTER EDUCATION 151H,DOWN FLOOR, CC COMPLEX, NEW ROAD, KOVILPATTI 2-2-2015
178 ALAKANANDA PHILANTHROPIC TRUST PLOT NO.561 & 562,EKAMRA VIHAR,BHUBANESWAR,ODISHA 22-4-2015
179 ALAKENDU BODH NIKETAN RESIDENTIAL VILL + PO: JEMO RAJBATI, PS + SUB DIV: KANDI, DIST: MURSHIDABAD, PIN: 742140, WEST BENGAL 8-1-2016
180 ALAMA IQBAL WELFARE TRUST LAR GANDERBAL 18-11-2016
181 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW 16-9-2015
182 ALAMBAGH INDUSTRIAL TRAINING INSTITUTE CHARITABLE BRAHMDATT PLAZA OPP HOTEL PICCADILY KANPUR ROAD BARABIRWA ALAMBAGH LUCKNOW 28-9-2015
183 ALANKAR AUTO SALES AND SERVICE PVT LTD ALANKAR MARUTI DRIVING SCHOOL TRG DIV OF ALANKAR AUTO SALES & SERVICE PVT LTD EAST BORING CANAL ROAD RAJAPUR PUL PATNA 13-1-2014
184 ALCYONE CONSULTANCY SERVICES PRIVATE LIMITED REG.OFFICE : N-76, JAMIA NAGAR NEW DELHI-110025 COPERATE OFFICE : B-5, 5TH FLOOR SHRI RAM PLACE BHOJA MARKET SEC-27, NOIDA U.P-201301 8-4-2016
185 ALCYONE CONSULTANCY SERVICES PVT LTD B-5, 5TH FLOOR, SRI RAM PLACE, SECTOR-27, NOIDA (UP) 6-5-2016
186 AL EDUCATION AND CHARITABLE TRUST AL EDUCATION AND CHARITABLE TRUST 69B, K.R.R. COMPLEX, NEAR EDAN GARDEN SCHOOL, OPP. GANDHI ROAD BUS STOP, HASTAMPATTY, SALEM-7 5-2-2015
187 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA 7-4-2016
188 AL FATIMA HUMAN RESOURSES DEVELOPMENT SOCIETY KUMAR COMMERCIAL COMPLEX,3RD FLOOR GANDHI MAIDAN PATNA 3-3-2016
189 ALGOL UNIVERSAL TRUST ALGOL UNIVERSAL TRUST, 14/3, 1ST FLOOR, ABOVE CHEVROLET SHOWROOM, OPP.HAVELLS, MAIN MATHURA RD. FARIDABAD(HARYANA) 12-1-2016
190 ALGOL UNIVERSAL TRUST 14/3, SECOND FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY MAIN MATHURA ROAD, FARIDABAD 16-9-2015
191 AL HIBAH WOMEN CHARITABLE TRUST AL HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O, MUVATTUPUZHA ERNAKULAM DIST, KERALA - 686673 14-9-2015
192 AL HIBAH WOMEN CHARITABLE TRUST AL-HIBAH WOMEN CHARITABLE TRUST PEZHAKKAPPILLY P.O MUVATTUPUZHA 6-4-2016
193 ALLIANCE EDUCARE AND RESEARCH PVT LTD C-11, SECTOR-15, VASUNDHARA, GHAZIABAD-201012 (U.P) 25-12-2013
194 ALLIANCE INSTITUTE OF AIAPHS PVT LTD ALLIANCE INSTITUTE OF ADVANCED PHARMACEUTICAL & HEALTH SCIENCES, PLOT NO. 118/B, FLAT NO. 202, NEAR SAI BABA TEMPLE, SRI SAI NAGAR, OPP. MORE MEGA STORE KUKATPALLY HYDERABAD - 72 29-6-2016
195 ALLIANCE INSTITUTE OF APHS PVT LTD PLOT NO.118/B, FLAT NO.202, NEAR SAIBABA TEMPLE, SRI SAI NAGAR, KUKATPALLY, HYDERABAD - 72 4-8-2016
196 ALLIED RESOURCE MANAGEMENT SERVICES INDIA PVT LTD SAI VENKATESH CENTRE 2ND FLOOR PUNE-NASHIK HIGHWAY BHOSARI PUNE 28-10-2013
197 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRIAL AREA KUKAS JAIPUR RAJASTHAN 23-12-2016
198 ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION ALL INDIA AGRASEN TECHNICAL EDUCATION AND RESEARCH FOUNDATION SP 43 RIICO INDUSTRAIL AREA KUKAS JAIPUR RAJASTHAN 25-7-2016
199 ALL INDIA ASIAN EDUCATIONAL FOUNDATION 3&4, INSTITUTIONAL AREA, JASOLA,NEW DELHI 110025 PHONE NO. 011-42094800 7-10-2016
200 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C, MADHU VIHAR DWARKA SEC 3 NEW DELHI 5-4-2016
201 ALL INDIA ENVIRONMENT E S W SOCIETY A1/155C MADHU VIHAR DWARKA SEC -3 NEW DELHI 6-4-2016
202 ALL INDIA INSTITUTE OF LOCAL SELF GOVERNMENT PLOT NO.6, F-BLOCK, BANDRA KURLA COMPLEX,T.P.S. ROAD-12, BEHIND GOVERNMENT TEACHER COLONY,NEXT TO UTTAR BHARTIYA SANGH COLLEGE (UBS) BANDRA-EAST,MUMBAI, MAHARASHTRA 17-7-2014
203 ALL INDIA JAN KALYAN ORGANIZATION 32A/34, ASHISH KUTTER, NEAR SHIV PARK, JANTA COLONY, ROHTAK 18-12-2015
204 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD 16-3-2016
205 ALL INDIA MILLY FOUNDATION 6-B/4-B, LOYAL ROAD (NEAR PATRIKA HOUSE), CIVIL LINES, ALLAHABAD 2-3-2016
206 ALL INDIA SOCIETY FOR ADVANCE EDUCATION RESEARCH NORTH EXT. MATSYA INDUSTRIAL AREA, ALWAR, (RAJASTHAN) INDIA 3-1-2014
207 ALL INDIA SOCIETY OF EDUCATION AISE BHAWAN, B-1/348, SECTOR-17, ROHINI, DELHI 8-5-2014
208 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325 20-7-2016
209 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325 15-3-2016
210 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN- 713325 9-9-2016
211 ALL INDIA YOUTH COMPUTER LITERACY MISSION POST OFFICE- BURNPUR, RAMBANDH, NEAR ADARSHA VIDYALAYA, DISTRICT BURDWAN, PIN-713325 21-6-2016
212 ALLINE INTERNATIONAL NEAR RAILWAY STATION MEDICAL COLLEGE ROAD 18-3-2015
213 ALL JK PASMANDA TABAKA DEVLOPMENT WELFAR SECITY LINE NO 19 FOURDISA ABID TING POURA SIRNINGER IS HEAD OFFICE 17-1-2017
214 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 1348/5 NANDA NAGAR,INDORE 4-1-2016
215 ALL PROFESSIONAL AND EDUCATIONAL WELFARE SOCIETY 105/3 NANDA NAGAR,INDORE 10-2-2016
216 ALL SERVICES GLOBAL PRIVATE LIMITED PLOT AG-3,CAMA INDUSTRIAL ESTATE,VILLAGE PAHADI,OPP KUSUM MASAL,GOREGAON(EAST),MUMBAI 3-10-2013
217 ALLUSION CONTROLS PRIVATE LIMITED 9/562-563 INDIRA NAGAR LUCKNOW 3-2-2014
218 ALL WOMEN AND RURAL DEVELOPMENT SOCIETY NO. 350, DR. AMBEDKAR STREET, MELNALLATHUR VILLAGE AND POST, TIRUVALLUR TK TIRUVALLUR DISTRICT 13-11-2014
219 AL MEHMOOD EDUCATIONAL SOCIETY ALLAHABAD PLOT NO 442 VILLAGE TIKRI TALUKA KANJASA POST JASRA ALLAHABAD 1-7-2014
220 ALPHATECH COMPUTER CENTRE ALPHATECH COMPUTER CENTRE P K BUILDING NEAR MARGIN FREE MARKET NILAMBUR PO MALAPPURAM DIST KERALA 10-11-2014
221 ALQAMA EDUCATION AND WELFARE SOCIETY MALEGAON DIAMOND GIRLS HIGH SCHOOL, BOHRA BAUGH , BAJRANGWADI MALEGAON DIST. NASHIK 26-3-2014
222 ALT TRAINING COLLEGE FOUNDATION KAIKONDANAHALLI,SARJAPUR ROAD,NEAR BELLANDUR GATE CARMELRAM POST, BANGALORE 26-3-2014
223 AMA EDUCATIONAL TRUST SECTOR-6, PLOT NO-1290, MARKAT NAGAR, CUTTACK, ORISSA 30-11-2015
224 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH 9-2-2016
225 AMAHA SAMAJIK AWAM KSHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661 29-2-2016
226 AMAHA SAMAJIK AWAM SHIKSHAN SAMITI JAMODI SENGRAN, SIDHI, MADHYA PRADESH, 486661 14-3-2016
227 AMAN E TECH PRIVATE LIMITED 2ND FLOOR CORPORATION BANK BUILDING GOPAL GANJ SAGAR 5-1-2016
228 AMAN SOCIAL DEVELOPMENT ORGANISATION HASHIM MANZIL FIRST FLOOR BARADUARIYA POST SADAR NEAR K .B. GIRLS COLLEGE JAUNPUR UTTAR PRADESH JAUNPUR UTTAR PRADESH PIN CODE NO. 222001 18-8-2016
229 AMARAVATHI ARAKKATTALAI AMARAVATHI ARAKKATTALAI, 3/177, NORTH STREET, KODUMUDI POST, ERODE DISTRICT, TAMILNADU. 14-7-2014
230 AMARESHWAR GRAMIN ABHIVRUDDHI SHIKSAN AND KALYAN SASMTHE NH-63 MILLENNIUM CAMPUS DADEGAL KOPPAL 15-4-2014
231 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI - 110025, DELHI, INDIA 14-10-2015
232 AMA VENTURES PRIVATE LIMITED AMA VENTURES PRIVATE LIMITED 2FELEGANCE,JASOLA DISTRICT CENTRE, OLD MATHURA ROAD, NEW DELHI 16-12-2015
233 AMA VENTURES PRIVATE LIMITED 2F,ELEGANCE,JASOLA DISTRICT CENTRE,OLD MATHURA ROAD,NEW DELHI-110025 30-12-2015
234 AMAZING NETWORKS PRIVATE LIMITED A-702, MAHINDRA APARTMENTS, VIKASPURI, NEW DELHI 3-4-2014
235 AMAZING SECURITY SERVICES PRIVATE LIMITED 27-A, TRIVENI NAGAR, MEERPUR CANTT.,KANPUR NAGAR. 3-1-2014
236 AMBAJI COMPUTER AND CAREER ACADEMY OLD CENTRAL BANK, GAHOI SAMAJ BHAVAN, CHAWADI ROAD, GADARWARA DISTT- NARSINGHPUR 14-9-2015
237 AMBAJI COMPUTER AND CAREER ACADEMY GAHOI SAMAJ BHAVAN, CHAWDI ROAD, OLD CENTRAL BANK BUILDING GADARWARA, DISTT. NARSINGHPUR 21-9-2015
238 AMBATTURINDUSTRIALESTATE MANUFACTURERS ASSOSIATION ATC ROAD,AMBATTUR INDUSTRIAL ESTATE,CHENNAI 15-9-2015
239 AMBICA SHIKSHA SAMAJ KALYAN SAMITI 43-B,ANSAL PRADHAN ENCLAVE,NEAR DANA PANI RESTURANT,BAWADIYAKALA,BHOPAL 3-4-2014
240 AMBIENCE WATER SOLUTIONS AND MARKETING LTD FUTURE CHOICE HOUSE , F-433, SECTOR-63, NOIDA U.P 201301 21-12-2016
241 AMBUJA CEMENT FOUNDATION ELEGANT BUSINESS PARK, M.I.D.C OFF ANDHERI ANDHERI-KURLA ROAD,ANDHERI(EAST), MUMBAI-400059 5-2-2014
242 AMET PVT LTD BUILDING NO ; VII / 1268 /1 AMET TOWER, BEHIND KSRTC BUS STAND ADOOR,PATHANAMTHITTA KERALA 23-6-2016
243 AMIGOS IMPEX LLP NO.37-10-1/1,BALAJI NAGAR ,AYYAPPA NAGAR,SECTOR-1, MURALINAGAR,VISAKHAPATNAM 6-10-2016
244 AMIGOS SOLUTIONS PRIVATE LIMITED 862, JESSORE ROAD , LAKETOWN COMPLEX BLOCK D, NEAR CHINA MANDIR. KOLKATA-700055 17-9-2015
245 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU 16-11-2016
246 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT 23-12-2016
247 AMIRTHA EDUCATIONAL AND CHARITABLE TRUST NO.56, RVE NAGAR SOUTH 5TH STREET, KANGAYAM ROAD, TIRUPPUR 641604 TIRUPPUR DISTRICT TAMILNADU 9-12-2016
248 AMIRTHA PUBLIC CHARITABLE AND EDUCATIONAL TRUST 100,EDAMAL STREET, THENI 9-4-2015
249 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI. 23-10-2015
250 AMITY EDUCATIONAL AND CHARITABLE TRUST L-404, IST FLOOR, H.B.COLONY, POTHIGAI NAGAR, TIRUNELVELI. 14-10-2015
251 AMITY EDUCATION SERVICES PVT LTD BLOCK F2,AMITY CAMPUS,SECTOR 125, NOIDA EXPRESSWAY, NOIDA 16-3-2016
252 AMITY EDUCATION SERVICES PVT LTD F2 BLOCK, AMITY CAMPUS, SECTOR 125, NOIDA 6-4-2016
253 AMK ATHENCOTTASAN MUTHAMIZH KAZHAGAM MAN POWER SERVICES NO.41, VELLALAR COLONY WEST, ROJAVANAM AGED HOME CAMPUS, NAGERCOIL-629 001 11-11-2016
254 AMMA CHARITABLE TRUST 4-4-931, NEHRU NAGAR,BESIDE LIC, LIC ROAD, TIRUPATI 15-1-2015
255 AMMAYEES EDUCATIONAL TRUST REG OFFICE: 80/40 SANNATHI STREET, OPP TO KVB TIRUVANNAMALAI 14-9-2015
256 AMP SOLUTIONS LIMITED SCO 114-115, LEVEL-2, SECTOR 34 A, CHANDIGARH 8-9-2014
257 AMRAPALI PRASHIKSHAN SANSTHAN AMRAPALI PRASHIKSHAN SANSTHAN, WARD NO. 4, KARIGAR MOHALLA, DEOLI, TONK 30-1-2014
258 AMRITAA EDUCATIONAL TRUST 22 C 1,C K N STREET, RASIPURAM, NAMAKKAL 11-1-2016
259 AMRITAA EDUCATIONAL TRUST 22 C 1CKN STREET RASIPURAM NAMAKKAL 29-1-2016
260 AMRITAA EDUCATIONAL TRUST 22C-1 CKN STREET RASIPURAM NAMAKKAL 9-2-2016
261 AMRITAA EDUCATIONAL TRUST 22 C-1 C.K.N. STREET RASIPURAM NAMAKKAL 6-1-2016
262 AMRITVARSHA EDUCATIONAL AND WELFARE TRUST SHOP NO. 21, SIGNATURE TOWER, KURJIPUL, KURJI, PATNA 14-9-2015
263 AMRO WORKFORCE PRIVATE LIMITED 304, DEVRANI COMPLEX, LALPUR, RANCHI, JHARKHNAD 11-9-2015
264 AMTA NATUN DIGANTA WELFARE SOCIETY VILL + PO - BHANDARGACHA, PS - AMTA HOWRAH 711401 11-1-2016
265 AMULETT EDUCATIONAL SERVICES PVT LTD SF-14, III FLOOR, BLOCK-C, MANSAROVAR COMPLEX, NEAR HABIB GANJ, RAILWAY STATION, BHOPAL 26-12-2016
266 AN ADVANCE SOCIETY FOR HUMAN ADVANCEMENT RIGHTS ACTIVITY B/302,AALEKH, LAD SOCIETY ROAD,VASTRAPUR, AHMEDABAD 20-9-2016
267 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK 18-9-2015
268 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH 175008 1-10-2015
269 ANAHITA FOUNDATION C/O CHADIAR COMPLEX, BEHIND STATE BANK OF PATIALA, NERCHOWK, DISTT. MANDI, HIMACHAL PRADESH 28-9-2015
270 ANAND BHAHUUDDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BHATEGAON TQ.HADGAON DIST NANDED 23-5-2016
271 ANAND BHAHUUDESHIYA SEVABHAVI SANTHA BHATEGAON AT POST BAHTEGAON QT.HADGAON DIST NANNDED 20-7-2016
272 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092 6-8-2015
273 ANAND BOOKS INTERNNATIONAL P LIMITED 301, PATPARGANJ INDUSTRIAL AREA, DELHI-110092 19-10-2016
274 ANAND MINE TOOLS PRIVATE LIMITED “ANAND”, PLOT NO. F-27,BEHIND GANESH TEMPLE, TATYA TOPE NAGAR, NAGPUR 2-12-2015
275 ANAND SKILL SOLUTIONS PRIVATE LIMITED PLOT NO 166, FLAT NO -306, DESU LANE, MAHIPLAPUR EXTENSION, NEW DELHI 4-12-2014
276 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO. 11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030 24-5-2016
277 ANANT LEARNING AND DEVELOPMENT PVT LTD KHASRA NO.258, UPPER GROUND FLOOR, BUILDING NO.A-11, LANE NO-3, WESTEND MARG, SAIDULAJAIB, NEW DELHI-110030(NEAR SAKET METRO STATION) 12-5-2016
278 ANANT LEARNING AND DEVELOPMENT PVT LTD BUILDING NO 11 KHASRA NO 258 LANE NO 3 WEST END MARG SAID-UL-AJAB NEW DELHI 26-4-2016
279 ANANT LEARNING AND DEVELOPMENT PVT LTD A-1/18 GF Panchsheel Enclave, New Delhi 14-3-2016
280 ANANT LEARNING AND DEVELOPMENT PVT LTD #11A, UG FLOOR, LANE#3, KHASRA#258, WESTEND MARG, SAIDULAJAB, NEW DELHI-110030 17-5-2016
281 ANDHRA PRADESH ELECTRONICS AND COMPUTER EDUCATION DEVELOPMENT SOCIETY 3-4-900, O U ROAD, NEAR FEVER HOSPITAL, BARKATPURA, HYDERABAD, ANDHRA PRADESH 3-4-2014
282 ANDHRA PRADESH GIRIJANA SEVAK SANGH CHANDA MAMAPET, NANDIGAMA, KRISHNA DIST, AP 3-4-2014
283 ANDHRA PRADESH VOLUNTARY HEALTH ASSOCIATION SY NO: 157/6 GUNROCK ENCLAVE WEST, STAFF ROAD, SECUNDERABAD 7-4-2016
284 ANEKANT SEVA SANSTHAN MAGAN BHAWAN SETHO KI GALI SALUMBER RAJASTHAN UDAIPUR-313027 24-8-2016
285 ANGIL CARMEL SCHOOL SAMITI SNEHI NAGAR, MOHIBULLAPUR SITAPUR ROAD LUCKNOW 11-1-2016
286 ANIKA SOCIETY FOR SOCIAL WELFARE 122/2, VALLABH NAGAR, 30-8-2016
287 ANIKA SOCIETY FOR SOCIAL WELFARE 5TH FLOOR, YASHWANT PLAZA, NEHRU PARK RD, RAILWAY STATION, INDORE, MADHYA PRADESH 452001 28-9-2016
288 ANIKET GRAM VIKAS TRUST 29 MOHAN KUNJ SOCIETY HATKESHWAR MAHADEV KHOKHARA MANINAGAR 13-5-2016
289 ANITA DEVI EDUCATIONAL AND WELFARE SOCIETY 445 BLOCK B SECTOR 7 2-12-2016
290 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64, SATHYAMOORTHY STREET, TOWN, THIRUNELVELI. 5-8-2016
291 ANJANADEVI EDUCATIONAL AND CHARITABLE TRUST 64,SATHYA MOORTHY STREET, TIRUNELVELI TOWN. 18-9-2015
292 ANJANEYA EDUCATIONAL SOCIETY 153, NEW CIVIC CENTER,BHILAI 5-12-2016
293 ANJANI INSTITUTE OF TECHNOLOGY VILLAGE AND POST BHALUKA BAZAR 6-1-2016
294 ANJANI INSTITUTE OF TECHNOLOGY VILL AND POST BHALUKA BAZAR DIST MALDA WEST BENGAL 27-11-2015
295 ANJANI INSTITUTE OF TECHNOLOGY VILL BHALUKA POST BHALUKA DIST MALDA 14-10-2015
296 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20 , NEAR MAIN BUS STAND, RAWATSAR 16-12-2016
297 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO 20, NEAR MAIN BUS STAND, RAWATSAR 21-12-2016
298 ANMOL MULTIPURPOSE ACTIVITIES AND SOCIAL SERVICES SOCIETY WARD NO. 20, NEAR MAIN BUS STAND, RAWATSAR 23-12-2016
299 ANNAI EDUCATIONAL TRUST 1/174,NEAR CENTRAL BANK, BANGALORE HIGH ROAD, MOOKANDAPALLI, HOSUR 4-1-2016
300 ANNAI EDUCATIONAL TRUST NO:27, NEW SANKARANPALAYAM ROAD,OPP.RICE MILL, SANKARANPALAYAM, VELLORE. 7-1-2015
301 ANNAI EDUCATIONAL TRUST ANNAI EDUCATIONAL TRUST, NO:37/41,SKC ROAD , SURAMPATTI NALL ROAD,ERODE,TAMILNADU,SOUTHINDIA. 14-9-2015
302 ANNAI EDUCATIONAL TRUST SAASTHA INDUSTRIAL SCHOOL NO:108-A, ARNI ROAD, KOSAPET, VELLORE 22-12-2014
303 ANNAI FATHIMA COLLEGE OF ARTS AND SCIENCE FATHIMA NAGAR, ALAMPATTI , TIRUMANGALAM 19-8-2015
304 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD, THOOTHUKUDI. THOOTHUKUDI DT. TAMILNADU 7-1-2016
305 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1,ETTAYAPURAM ROAD,THOOTHUKUDI, THOOTHUKUDI DT. TAMILNADU 5-2-2016
306 ANNAI INDRAGANDHI MEMORIAL EDUCATIONAL TRUST NO.4/51/1, ETTAYAPURAM ROAD, NEAR APC MAHALAKSHMI COLLEGE, THOOTHUKUDI, THOOTHUKUDI-DT, TAMILNADU. 15-9-2015
307 ANNAI JAYA EDUCATIONAL AND CHARITABLE TRUST ANNAI JAYA EDUCATIONAL & CHARITABLE TRUST, NO 213,ROAD STREET, SEMMIYAMANGALAM & POST, POLUR TALUK, TIRUVANAMALAI DIST,TAMILNADU 18-3-2015
308 ANNAI JKK SAMPOORANI AMMAL CHARITABLE TRUST T.N.PALAYAM POST GOBI TALUK ERODE DISTRICT 15-1-2015
309 ANNAI KAMSALAI EDUCATIONAL AND CHARITABLE TRUST MIG 52 B KURUNJI STREET NEW HOUSING UNIT THANJAVUR 17-9-2015
310 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR 14-10-2016
311 ANNAI SAROJA FOUNDATION #14,FIRST FLOOR KONDAMAPURAM STREET,TIRUVALLUR 22-9-2016
312 ANNAI SAROJA FOUNDATION NO.14, FIRST FLOOR, KONDAMAPURAM STREET, TIRUVALLUR 3-11-2016
313 ANNAI SWASEM TRUST MUNICIPAL COMPLEX UPSTAIRS, ULAVAR SANDHAI, KARUR 4-12-2014
314 ANNAI TERASA SOCIAL SERVICE AND CHARITABLE TRUST KALAIMAGAL SCHOOL STREET, NANGAVALLI POST, METTUR T.K, SALEM DISTRICT 11-1-2016
315 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K.SALEM DISTRICT 18-1-2016
316 ANNAI TERESA SOCIAL SERVICE AND CHARITABLE TRUST METTU MARANUR, AURURPATTY POST, THARAMANGALAM VIA OMALUR T.K 12-1-2016
317 ANNAI THERASAL CHARITABLE TRUST 71A, MELVIN COLLEGE, SALAI STREET, RAMANATHAPURAM 1-7-2014
318 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE DISTRICT, TAMILNADU STATE, INDIA. 14-10-2015
319 ANNAI TRUST NO.7A, PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE - TK, CUDDALORE DISTRICT, TAMILNADU, INDIA. 21-12-2015
320 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK, CUDDALORE DISTRICT, TAMILNADU. 21-9-2015
321 ANNAI TRUST NO.7A PERUMAL CAMPUS, PALUR MAIN ROAD, PILLALI THOTTI, THIRUVENTHIPURAM POST, CUDDALORE TK 15-9-2015
322 ANNAMALAI ASDJFKL ADF ASDF AS F 20-1-2015
323 ANNAMALAIYAR EDUCATIONAL ACADEMY 115, 116 NEW GANDHI NAGAR, BANGALORE MAIN ROAD, ATHIYANDAL, TIRUVANNAMALAI. 8-5-2015
324 ANNAPURNA CHARITABLE TRUST PLOT NO - 961(A), FOREST PARK BHUBANESWAR 8-1-2016
325 ANNAPURNA MICROFINANCE PVT LTD DIBYAJYOTI PATTANAIK, DIRECTOR HIG-97, DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR,ODISHA PIN-751030 29-2-2016
326 ANNAPURNA SEVA SANSTHAN E-3011, RAJIPURAM LUCKNOW 13-9-2015
327 ANNIE AWARENESS AND WELFARE SOCIETY ANNIE COLLEGE, SAROJ BHAWAN , PATRIKA CROSSING, ( NEAR PETROL PUMP/RAMA MEDICAL) STANLY ROAD, CIVIL LINES, ALLAHABAD 5-8-2016
328 ANNPURNA SEVABHAVI SANSTHA KRISHNA PLANET VIDHYNAGAR , KARAD , DIST : SATARA, MAHARASHTRA , (INDIA) 8-11-2013
329 ANSAR EDUCATIONAL AND CHARITABLE TRUST DOOR NO VP-513/10-F, MEMUNDA AMSON DESOM OF VADAKARA TALUK, VADAKARA 5-4-2016
330 ANSAR EDUCATIONAL AND CHARITABLE TRUST P.O KEEZHAL, VADAKARA, KOZHIKODE 5-1-2016
331 ANS SKILLS PVT LTD ARYANS SQUARE, 5D, SECTOR-126, EXPRESSWAY NOIDA, GAUTAM BUDHA NAGAR, UP-201301. 9-4-2015
332 ANTHEM GLOBAL TECHNOLOGY SERVICES PVT LTD N:24-27, NEW IT ZONE CHANDAKA INDUSTRIAL ESTATE, PATIA, BHUBANESWAR 14-9-2015
333 ANTS CONSULTING AND SERVICES PRIVATE LIMITED #5, 4TH CROSS, 5TH MAIN, DORESANI PALYA, ANTAPPA LAYOUT, J.P NAGAR 7TH PHASE BANGALORE 25-11-2013
334 ANUDIP FOUNDATION FOR SOCIAL WELFARE FD-286, SECTOR III, SALT LAKE CITY, KOLKATA 700 106, WEST BENGAL, INDIA 28-10-2013
335 ANUDISH SANSTHAN HOUSE OF MR. KAILASH CHAND JAIN, BEHIND DIGAMBER JAIN BHAWAN, WARD NO 14 WARASEONI, BALAGHAT (M.P) 24-6-2015
336 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST C/O ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA. 15-3-2016
337 ANUGRAHA EDUCATION AND SOCIAL WELFARE TRUST ANUGRAHA TRAINING COLLEGE, MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA, INDIA . 15-9-2015
338 ANUGRAHA TRAINING COLLEGE MAHILA VRUNDA BUILDING, I.B.ROAD, NEAR TOWN PANCHAYATH OFFICE, BELTHANGADY TALUK, DAKSHINA KANNADA DISTRICT, MANGALORE, KARNATAKA 22-6-2015
339 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, M.P. 18-9-2015
340 ANUGRAH LEARNING AND DEVELOPMENT PRIVATE LIMITED C/O S.A. BROWN, NEW RESIDENCE OF CHURCH COMPOUND, CHHINDWARA, MP 15-9-2015
341 ANUNA EDUCATION NETWORK PRIVATE LIMITED B-73, NIRALA NAGAR LUCKNOW 14-10-2016
342 ANUPAMA EDUCATION SOCIETY BHARHUT NAGAR, SATNA (M.P.) 25-11-2013
343 ANUPAM BAL VIDYA MANDIR SAMITI SHIV JYOTI SCHOOL INDRAVIHAR, TALWANDI, KOTA 14-9-2015
344 ANURADHA MULTIPURPOSE EDUCATION SOCIETY 101, AMRUTKANTI APARTMENT, BEHIND IMA HALL, MANGHELAL PLOT, CAMP AMRAVATI 8-6-2016
345 ANUSANDHAN SHIKSHA EVAM SAMAJIK SAMITI NEAR AJANTA PENTAR'S,AMBEDKAR CHOURAHA,MANDSAUR (MP) 14-9-2016
346 ANWESHA CYBOTECH RESEARCH INSTITUTE PRIVATE LIMITE 19, RAINBOW STREET, NORTH S. K. PURI 1-10-2015
347 ANZAR EDUCATIONAL FOUNDATION FLAT 302, ROOPSNEH CHAMBERS J. M. ROAD, BEHIND SAI PETROL PUMP, PUNE, MAHARASHTRA 15-9-2015
348 APAR PEOPLEWORLD SOFTWARE SERVICES PRIVATE LIMITED #915, ESSAE PRIDE, 80 FT ROAD, 6TH BLOCK, KORMANGALA, BANGALORRE 6-10-2016
349 APAR PEOPLEWORLD SOFTWARE SERVICES PVT LTD 915 ESSAE PRIDE 80 FT ROAD 6TH BLOCK KORMANGALA BANGALORE 19-10-2016
350 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064 24-10-2016
351 APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI 10-11-2016
352 APAR TECHNOLOGIES PRIVATE LIMITED APAR TECHNOLOGIES PRIVATE LIMITED UNIT 305, C-WING, EUREKA TOWER, MINDSPACE, BEHIND TOYOTA SHOWROOM, LINK ROAD, MALAD WEST, MUMBAI-400064 29-11-2016
353 APEX GLOBAL SOLUTIONS NO: 13/6, KUMARAN COLONY, 3RD STREET, VADAPALANI, CHENNAI. 30-4-2015
354 APITCO LIMITED 8TH FLOOR PARISRAMA BAVAN BASHEERBAGH HYDERABAD 8-12-2013
355 APNE AAP WOMEN WORLDWIDE INDIA TRUST INDIA INTERNATIONAL CENTRE, GATE NO. 3/4, 2ND FLOOR 40 MAX MUELLER ROAD, LODHI ESTATE, NEW DELHI INDIA 26-11-2013
356 APOLLO COMPUTER EDUCATION LTD NO 7,OLD STATE BANK BUIDING POST OFFICE ROAD,PALANI 1-7-2014
357 APOLLO HOSPITALS EDUCATIONAL RESEARCH FOUNDATION 8-2-293/82/III/900A, APOLLO HOSPITALS COMPLEX, JUBILEE HILLS, HYDERABAD, ANDHRA PARADESH 28-3-2014
358 APOLLO HOSPITALS EDUCATIONAL TRUST 21, GREAMS LANE, OFF GREAMS ROAD, CHENNAI 5-6-2014
359 APOLLO MEDSKILLS LTD APOLLO MEDSKILLS, ALI TOWERS, 4TH FLOOR, #55, GREAMS ROAD, CHENNAI 15-12-2016
360 APOLLO TECHNICAL EDUCATION FOUNDATION APOLLO HOUSE, 7 INSTITUTIONAL AREA, SECTOR 32; GURGAON 27-9-2013
361 APPAREL RETAIL TRAINING AND JOB SOLUTIONS NO 258, 3RD MAIN, 4TH CROSS, SAI ENCLAVE, ARAKERE, MICO LAYOUT, NEAR M S RAMAIAH CITY, BANNERGHATTA ROAD, BANGALORE 29-10-2013
362 APPAREL TRAINING AND DESIGN CENTRE AEPC BUILDING, NO.3,THIRD STREET, INDIRA NAGAR, OFF-AVINASHI ROAD, TIRUPUR 11-8-2014
363 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN 15-11-2016
364 APPLEWARE COMPUTER ACADEMY Z/S-14, BIDHANNAGAR ZONAL MARKET, DURGAPUR-06 BURDWAN 18-10-2016
365 APPLITEK COMPUTERS PVT LTD 3RD FLOOR, BANSAL COMPLEX, FAIZABAD ROAD, INDIRA NAGAR, LUCKNOW, U.P 21-8-2015
366 A P SECURITAS PVT LTD APS HOUSE, PLOT NO 02, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA 16-2-2016
367 AP SECURITAS PVT LTD APS HOUSE, PLOT NO 2, PHASE IV, UDYOG VIHAR, GURGAON, HARYANA 7-10-2016
368 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION), ARAMBAGH 12-1-2016
369 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN (INFRONT OF ARAMBAGH POLICE STATION ), ARAMBAGH 11-1-2016
370 ARAMBAGH GRAMIN NABADIGANTA WELFARE SOCIETY PHANCYBAGAN, ARAMBAGH, HOOGHLY 14-10-2015
371 ARANYAK TALMUL SASAN, TALMUL, ANGUL, ODISHA 15-3-2016
372 ARANYAK AT- TALMUL SASAN, PO- TALMUL, DIST- ANGUL, STATE- ODISHA, 759040 5-2-2016
373 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-BIG STREET,MURUGAIYAH COMPLEX, PATTUKOTTAI 14-7-2016
374 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,BIG STREET,MURUGAIYAH COMPLEX,OPP CANARA BANK,PATTUKKOTTAI 29-11-2016
375 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-B,MURUGAIYAH COMPLEX,UPSTAIRS PRABA STUDIO,BIG STREET,PATTUKOTTAI 21-6-2016
376 ARASU EDUCATIONAL AND CHARITABLE TRUST 149-I,MURUGAIYAH COMPLEX,PRABA STUDIO UPSTAIRS, BIG STREET,PATTUKOTTAI,THANJAOUR,TAMILNADI. 7-1-2016
377 ARAVALI INSTITUTE OF DEVELOPMENT RESEARCH 297, TAGORE NAGAR, AJMER ROAD, JAIPUR, RAJASTHAN 26-4-2016
378 ARAVINDAR PROFESSIONAL EXCELLANCE TRUST ARAVINDAR POLYTECHNIC COLLEGE, 2-234, MADURAI NATIONAL HIGHWAY, AMBATHURAI, DINDIGUL 25-11-2014
379 ARCHANA WOMENS DEVELOPMENT CHARITABLE TRUST ARCHANA INSTITUTE OF FASHION DESIGNING, METRO PLAZA, OOTY ROAD, GUDALUR, THE NILGIRIS, TAMILNADU 4-1-2016
380 ARCHONZ BUSINESS SERVICES PRIVATE LIMITED 22/2, INDRA ENCLAVE, 402, 4TH FLOOR, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR COLONY, KUKATPALLY 5-2-2015
381 ARDENT COMPUTECH PVT LTD 39/2 BEADON ROW,PO- BEADON STREET 4-11-2016
382 ARDENT COMPUTECH PVT LTD 39/2,BEADON ROW, KOLKATA 6-10-2016
383 ARESS SOFTWARE AND EDUCATION TECHNOLOGIES PVT LTD L-13, ADDITIONAL INDUSTRIAL AREA, MIDC AMBAD, NASHIK 11-6-2014
384 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA 10-11-2016
385 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA 14-10-2016
386 ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT VASTUNIRMAN PRIVATE LIMITED ARIHANT CONSTRUCTIONS, SHOP NO.12&13, SHANKESHWAR HERITAGE, OPP.HDFC BANK,MARUTI MANDIR ,RATNAGIRITRA MAHARASHRA 28-10-2016
387 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI 20-7-2016
388 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI 23-5-2016
389 ARIHANT VASTU NIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR RATNAGIRI 9-6-2016
390 ARIHANT VASTUNIRMAN PVT LTD FIRST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR, RATNAGIRI 26-4-2016
391 ARIHANT VASTUNIRMAN PVT LTD 1ST FLOOR, SIDDHIVINAYAK COMMUNITY CENTRE, SIDDHIVINAYAK NAGAR, SHIVAJI NAGAR , RATNAGIRI 14-9-2015
392 ARIMA EXIM PVT LTD 2/89,FIRST FLOOR,CISONS COMPLEX,MONTIETH ROAD,EGMORE,CHENNAI. 17-2-2015
393 ARIMA FINANCIAL AND SERVICES PVT LTD KUNGUMAM COMPLEX,1ST FLOOR 1-A TANJORE MAIN ROAD,I.A.S NAGAR TIRUVERAMBUR, TRICHY, TAMILNADU 11-9-2015
394 AROGYA JAN KALYAN SANSTHA A-1, PLATINUM PLAZA, MATA MANDIR,6TH FLOOR,BHOPAL, M.P. 27-3-2014
395 AROH FOUNDATION F-52, SECTOR-8, NOIDA 4-10-2013
396 AROOR CHOLANADU EDUCATIONAL AND SOCIAL DEVELOPMENT AROOR CHOLANADU INDUSTRIAL SCHOOL 1/231-B,MUDHALIAR STREET KATTUR&POST,KODAVASAL TALUK TIRUVARUR 8-9-2014
397 ARPAN SEVA SANSTHAN A-34 SAHELI NAGAR, NEAR SAHELIYON KI BARI, UDAIPUR 23-12-2013
398 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.MAHISAGAR 5-1-2017
399 ARPAN VIKAS TRUST AT.RAGHAVANA MUVADA, PO.KOTHAMABA, TA.LUNAWADA, DIST.PANCHMAHAL 16-6-2016
400 ARPAN VIKAS TUST AT.RAGHAVANA MUVADA, PO.KOTHAMBA, TA.LUNAWADA, DI.PANCHMAHAL 26-4-2016
401 ARRINA EDUCATION SERVICES PRIVATE LIMITED REGISTERED OFFICE: 7TH FLOOR, BHAVESHWAR ARCADE, LBS MARG, GHATKOPAR (WEST), MUMBAI HEAD OFFICE: 201 - A/1, 'RAHEJA ARCADE - 1' LBS MARG, GHATKOPAR (WEST), MUMBAI 24-6-2015
402 ARROW KNOWLEDGE SERVICES PRIVATE LIMITED 22/2, INDRA ENCLAVE, 402, 4TH FLOOR, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR COLONY, KUKATPALLY 16-9-2015
403 ARSAN EDUCATIONAL AND SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA 12-1-2016
404 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108 11-9-2015
405 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO. BHADAS TEHSIL NAGINA DISTT.MEWAT HARYANA PIN- 122108 18-9-2015
406 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108 23-10-2015
407 ARSAN EDUCATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA 14-10-2015
408 ARSAN EDUVATIONAL SOCIAL ORGANISATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA PIN NO. 122108 5-1-2016
409 ARSINA FOUNDATION VPO BHADAS TEHSIL NAGINA DISTT MEWAT HARYANA 21-12-2015
410 ARS LEATHERS CHANDIGARH AMBALA ROAD ZIRAKPUR MOHALI (SAS NAGAR) PUNJAB 5-5-2014
411 ARTBEAT COMMUNICATIONS PRIVATE LIMITED PLOT# 45, TEACHERS COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD 14-9-2015
412 ARTEVA CONSULTING PRIVATE LIMITED R-10/D-24, RAJ NAGAR 5-5-2016
413 ARTHAMULLA MAHALIR NALA SANGAM NO.5, T.K.S COMPLEX, BANU NAGAR 1ST MAIN ROAD, PUDUR, AMBATTUR, CHENNAI - 600053 22-11-2016
414 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK 5-1-2017
415 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, PATHARDI PHATA AMBAD LINK ROAD, NEAR SHAMRAO VITTAL BANK NASHIK 26-9-2016
416 ARTISAN EDUCATION FOUNDATION URJAYANT ARCADE, NEAR SHAMRAO VITTAL BANK, PATHARDI PHATA AMBAD LINK ROAD, NASHIK 30-8-2016
417 ARUN INSTITUTE OF RURAL AFFAIRS AT. ASWAKHOLA, PO. KARAMUL, VIA. MAHIMAGADI, DIST. DHENKANAL 28-9-2016
418 ARUN KUMAR RURAL DEVELOPMENT SOCIETY # 4/42, PALLE VANDLA PALLI.UMR PALLI.POST,NALLACHERUVU,MANDAL,515551,ANANTAPURAM DIST 9-2-2016
419 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADASA CIRCLE P.B. ROAD HAVERI 27-11-2015
420 ARUNODAYA INTEGRATED COMMUNITY DEVELOPMENT SOCIETY KANAKA COMPLEX KANAKADAS CIRCLE P.B.ROAD HAVERI 16-9-2015
421 ARUNODAYA SHIKSHAN SAMITI ASHISH INFOTECH SHANKAR NAGAR STATION ROAD DURG 5-12-2016
422 ARUNODAYA TRUST D.NO :1-4/7, 2ND LANE, EX SERVICE MEN COLONY, BALAJI NAGAR, SECUNDERABAD - 500087, AANDHRA PRADESH 4-8-2016
423 ARVIND LIMITED NARODA ROAD, NEAR CHAMUNDA BRIDGE, AHMEDABAD 17-8-2015
424 ARYABHATT EDUCATIONAL AND HEALTH TRUST AT-MEHTA COMPLEX,NEAR LAXMI PETROL PUMP , NAWABGANJ ,HAZARIBAGH PIN-825301 JHARKHAND 17-6-2014
425 ARYA EDUCATIONAL AND EMPLOYMENT SOCIETY NAGROTA BAGWAN,DISTT-KANGRA,H.P 4-11-2016
426 ARYA KALINGA BIKASH AT-CHANDIKHOLE, PO-SUNGUDA, PS- BARCHANA DIST- JAJPUR, PIN-754296 14-10-2015
427 ARYAN INSTITUTE OF MEDICAL SCIENCE PRIVATE LIMITED RAHUL HOSPITAL, NEAR BUS STAND, DELHI MATHURA ROAD, PALWAL, HARYANA- 121102 14-5-2015
428 ARYAN SANRAKSHAN 1323 KISAN MARG BARKAT NAGAR TONK PHATAK JAIPUR 30-1-2014
429 ARYANS CHARITABLE SOCIETY 5D, SECTOR-126, NOIDA EXPRESSWAY NOIDA, GAUTAMBUDHNAGAR, UP. 3-2-2014
430 ARYANS EDUCATIONAL TRUST VILLAGE RAJPUR P.O.SARAWAN DISTT.YAMUNANAGAR 17-8-2015
431 ARYANS EDUTECH PRIVATE LIMITED 5D, SECTOR-126, NOIDA EXPRESSWAY, NOIDA. 1-10-2013
432 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, P.O. ASANSOL PIN- 713301, DIST. BURDWAN ,WEST BENGAL 14-9-2015
433 ASANSOL UNICOM INSTITUTE OF TECHNOLOGY T.P. MARKET ROAD, 16-9-2015
434 ASBM ASBM CORPORATE OFFICE, #8, SAI ANANDAM COMPLEX, CHANDAKA SQUARE, BHUBANESWAR, ODISHA 8-6-2016
435 ASCENSIVE EDUCARE PRIVATE LIMITED 1110 RASHBIHARI AVENUE , CHANDANNAGAR , FATOKGORA , HOOGHLY 2-2-2015
436 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD. 8-11-2016
437 ASD EDUCATION PRIVATE LIMITED 1ST FLOOR, RAMKY GRANDIOSE, GACHIBOWLI, HYDERABAD 27-10-2016
438 ASEED INNOVATIVE LEARNING CENTRE PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA 23-5-2016
439 A S FOUNDATION AND CHARITABLE TRUST 3 RD FLOOR JIVAN JYOUT COMPLEX NEAR GATHAMAN GATE NR SARKARI TECHNICAL HIGH SCHOOL PALANPUR 385001 17-9-2015
440 ASFSDA ASDF 18-3-2015
441 ASHA AT/PO- KAMAKHYANAGAR,VIA- KAMAKHYANAGAR DIST- DHENKANAL,ODISHA 26-7-2016
442 ASHADIP MEDICAL AND SOCIAL WELFARE ASSOCIATION AT+PO+PS-SABANG,DIST-PASCHIM MEDINIPUR,WB 11-1-2016
443 ASHA FOUNDATION SHASTRI WARD TAR BAZAR PANDHURNA TAH PANDHURNA DIST CHHINDWARA 26-7-2016
444 ASHA FOUNDATION HOSHBANOO MANSION, 3RD FLOOR, OLD ICE FACTORY BUILDING, ABOVE KOHINOOR, GOKHALE ROAD , NAUPADA , THANE ( W ). PHONE #: +91 022 25398200 6-4-2015
445 ASHA KIRANA SAMAJA SEVA SANGHA MIG2/63,NETAJI NAGAR,HOUSING BOARD COLONY,INFANTRY ROAD 11-9-2015
446 ASHA SOCIETY FOR ALL SOCIAL HELP ASSOCIATION A 243 LAL BAGH AZAD PUR DELHI 19-10-2016
447 ASHA SOCIETY FOR EDUCATION AND TRAINING 13-2-35 OPPOSITE HDFC BANK SRISAILAM ROAD MACHERLA GUNTUR (DT) 7-9-2016
448 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW 7-3-2016
449 ASHA VISHWAS SAIYYAM AVS EDUCATIONAL AND DEVELEOPM FIRST FLOOR 545GA NEW CHANDGANJ GARDEN, ALIGANJ LUCKNOW 10-3-2016
450 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B 4 B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD 5-1-2017
451 ASHIRWAD EDUCATIONAL SOCIAL WELFARE SOCIETY B4B SHILAKHANA ROAD TELIYARGANJ ALLAHABAD 18-8-2016
452 ASHOKA INSTITUTE OF TECHNOLOGY AND MANAGEMENT GRAM- TORANKATTA PO- SOMNI DIST- RAJNANDGAON 14-10-2015
453 ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING AND R ASHOK LEYLAND INSTITUTE FOR DRIVING TRAINING & RESEARCH, POST -LINGA, DIST-CHHINDWARA(MP) 9-9-2016
454 ASHOK NILAY VILL-ULLON, PO-RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL 2-9-2016
455 ASHOK NILAY VILL - ULLON, PO - RAMLOCHANPUR, DIST-SOUTH 24 PARGANAS, WEST BENGAL 1-9-2016
456 ASHPRA SKILLS PRIVATE LIMITED B - 13 A, INSTITUTIONAL AREA, SECTOR - 62, NOIDA 20-7-2016
457 ASHPRA SKILLS PRIVATE LIMITED B-13A,NEAR IBM BUILDING, INSTITUTIONAL AREA, SECTOR 62, NOIDA GAUTAM BUDH NAGAR, UTTAR PRADESH - 201301 9-9-2016
458 ASHPRA SKILLS PRIVATE LIMITED NO. 402 - P. NO 24, CGHS TECHNOLOGY APARTMENT, PATPARGANJ, DELHI - 110092 5-8-2016
459 ASHRAYA PLOT NO-29, RAJARANI COLONY, POST-BJB NAGAR, BHUBANESWAR, DIST-KHORDHA, ODISHA 9-2-2016
460 ASHRAY SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA 22-12-2016
461 ASHRYA SOCIAL WELFARE FOUNDATION B 504 SAMUDRA, NR KLASIC GOLD HOTEL,OFF C G ROAD,NAVARANGPURA 14-12-2016
462 ASHUTOSH SHIKSHA EVAM SEWA SANSTHAN 15-H, KAILASHKUNJ,DAUDPUR,CHARUCHANDRAPURI COLONY 23-6-2016
463 ASHWA SAMGRA SAMAJIK AWAM MANAV KALYAN SANGTHAN VILLAGE AND POST OFFICE ADAWAL, BLOCK JAGDALPUR 14-9-2015
464 ASIAN ART CRAFTS PRIVATE LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA 18-7-2016
465 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR, PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA 15-3-2016
466 ASIAN ART CRAFTS PVT LTD 5/2B, SACHIN MITRA LANE, KOLKATA, (WB) 700063 2-6-2016
467 ASIAN ART CRAFTS PVT LTD RDB BOULEVARD, 8TH FLOOR,PLOT K-1, SECTOR V, BLOCK EP & GP, SALT LAKE CITY, KOLKATA 4-4-2016
468 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL 17-6-2016
469 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2, SURGUNAVEETHI JUNCTION, NAGERCOIL 6-1-2016
470 ASIAN CENTRE FOR PROFESSIONAL SKILLS 66 C 1/2 LADIES CLUB ROAD SARGUNA VEETHI JUNCTION NAGERCOIL 4-4-2016
471 ASIAN EDUCATIONAL TRUST COLLEGE ROAD, GANDHI NAGAR, JATNI 13-1-2014
472 ASIAN INSTITUTE OF PUBLIC HEALTH PLOT NO 1037, SRIRAM NAGAR, SAMANTARAPUR, OLD TOWN. 9-9-2016
473 ASIAN MISSION INSTITUTE KURIHA, P.O. KAYAKUCHI, DIST. BARPETA, ASSAM 14-9-2015
474 ASIAN PUBLIC SEWA PARISHAD A-35, VIJAY NAGAR, LAL GHATI, AIRPORTROAD, BHOPAL ,M.P. 14-10-2015
475 ASIAN PUBLIC SEWA PARISHAD H.NO. A-35, VIJAY NAGAR, LAL GHATI, AIRPORT ROAD, BHOPAL, M.P. 10-11-2015
476 ASIAN SCHOOL OF ENGLISH LANGUAGE ASEL CENTRAL BANK (LUNIYA PETROL PUMP) KE SAMNE, NEW BUS STAND ROAD, SHIKSHAK NAGAR MUNGELI CG 14-3-2016
477 ASIAN SOCIETY FOR ENTREPRENEURSHIP EDU AND DEVP PLOT NO. 30/2, KNOWLEDGE PARK-III, GREATER NOIDA 15-6-2016
478 ASKAR MULTI SOCIAL SERVICE ASSOCIATION H NO 3-9-557 REDDY COLONY HANAMKONDA WARANGAL DISTRICT TELANGANA 14-9-2015
479 ASK HORIZON EDUCATION AND TECHNOLOGY PRIVATE LIMIT PLOT NO. 29 ZONE-II, M.P. NAGAR BHOPAL 16-5-2016
480 ASMACS SKILL DEVELOPMENT LTD HUNT JOBS PRIVATE LTD BUNGLOW NO.1 & 2, MANDAKINI BUILDING, JANGID COMPLEX, MIRA ROAD EAST, DIST THANE, 401 107, INDIA 30-1-2014
481 ASMACS SYSTEMS SOLUTIONS PVT LTD 123,ATLANTA,12TH FLOOR,NARIMAN POINT,MUMBAI 26-3-2014
482 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON NAGAON ASSAM 14-9-2015
483 ASOM RAJYIK KRISHAK SAMANNAY SAMITY SENCHUWA PO SENCHUWA VIA HAIBORGAON DIST NAGAON ASSAM PIN 782002 8-5-2015
484 ASPIRE KNOWLEDGE AND SKILLS 1289, 2ND FLOOR, ABOVE JETKING CENTER, OPP. HOTEL SWAN INN, NEAR BALGANDHARVA CHOWK,, J.M.ROAD , SHIVAJINAGAR , PUNE, 411005. 11-3-2016
485 ASPIRE KNOWLEDGE AND SKILLS 1289, JMROAD ,2ND FLOOR, ABOVE JETKING , SHIVAJINAGAR, PUNE 411005 23-2-2016
486 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA 23-2-2016
487 ASSAM INSTITUTE JALUKBARI, GUWAHATI-781349,DIST. KAMRUP(M) ASSAM 14-3-2016
488 ASSAM INSTITUTE CORPORATE OFFICE: DHAMDHAMA, P.O.: NIZ DHAMDHAMA, DIST.: NALBARI (ASSAM) INDIA 5-2-2016
489 ASSAM PROFESSIONAL ACADEMY SOCIETY ULUBARI,BORA SERVICE,G.S ROAD,GUWAHATI,PIN-781007,ASSAM 9-4-2015
490 ASSENT INFOTECH PRIVATE LIMITED 1. 2ND FLOOR, RIDHI SIDHI COMPLEX, BESDIE BSNL OFFICE, ABOVE SMART SHOWROOM. RAJENDRA NAGAR, PATNA 6-7-2016
491 ASSERTIVE BUSINESS SOLUTION PRIVATE LIMITED 8-4-548/1, 202, N. SIDDAPPA NILAYAM,, 2ND LEFT AFTER GOKUL THEATRE, ERRAGADDA, HYDERABAD 14-9-2015
492 ASSET INFOTECH LIMITED FIRST FLOOR, 93, SHUBHASH ROAD, NEAR MKP CHOWK, DEHRADUN-248001 (UTTARAKHAND) 5-9-2014
493 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED HOUSE NO 25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI 14-12-2016
494 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED #25, MANIKANCHAN, MOTHER TERESA ROAD, GITANAGAR, GUWAHATI, ASSAM 22-11-2016
495 ASSOCIATED TEA AND AGRO MANAGEMENT SERVICES PRIVATE LIMITED 25 MOTHER TERESA ROAD, GEETANAGAR, GUWAHATI 6-12-2016
496 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO. 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE, PIN/603103 5-9-2016
497 ASSOCIATION FOR COMMUNITY DEVELOPMENT SERVICE NO 3/429 SATHANKUPPAM, KELAMBAKKAM, KANCHEEPURAM DISTRICT, TAMILNADU STATE PIN.603103 4-8-2016
498 ASSOCIATION FOR DEVELOPMENTAL ACTIONONRURALSOCIETYHARIJANSANDADIBASIES N - 6/514, JAYADEV VIHAR, BHUBANESWAR, ODISHA 1-12-2014
499 ASSOCIATION FOR GRASSROOT DEVELOPMENT RESEARCH AND ACTION VILLAGE NARWAR, MUNJAKHEDI ROAD, POST NARWAR, NEAR AARADHYA SCHOOL, DEWAS ROAD, DISTRICT UJJAIN 31-8-2016
500 ASSOCIATION FOR RURAL DEVELOPMENT ARD 2/127 ARD NAGAR, P.MEENAKSHIPATTI, KARUMATHUR P.O, CHECKANURANI VIA, THENI MAIN ROAD. 26-8-2016
501 ASSOCIATION FOR RURAL YOUTH AWARENESS NETWORK AT-NEELAKANTHESWAR MARGO PO-BORIGUMMA DIST- KORAPUT 11-9-2015
502 ASSOCIATION FOR SOCIAL WORK AND SOCIAL RESEARCH AT-SEVA VIHAR, POST- BUTUPALI, PS/DIST.- BOUDH, PIN-762014, ODISHA, INDIA 18-3-2015
503 ASSOCIATION OF LADY ENTREPRENEURS OF ANDHRA PRADESH DOOR NO. 8-3-677/6,(PLOT NO.6), YELLAREDDYGUDA, SRIKRISHNADEVARAYA NAGAR, SRI NAGAR COLONY, YOUSUFGUDA, HYDERABAD .AP. 13-1-2014
504 ASSOCOM INDIA PVT LTD 601, DDA BUILDING DISTRICT CENTRE, LAXMI NAGAR 15-1-2015
505 ASTERIX COMPUTERS LEFT WING 2ND FLOOR, BLUE STAR COMPLEX, NEELIGIN ROAD, HUBLI 30-4-2015
506 ASTHA MAHILA VIKAS SANSTHA AASAWARI BUILDING B-23 VIDHARBHA HOUSING SOCIETY GODHANI ROAD YAVATMAL TA.DIST.YAVATMAL ( M.S.) 21-9-2015
507 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001 28-12-2015
508 ASTITVA CHARITABLE TRUST M-103, AKSHARDEEP COMPLEX, NEAR MADHAV COMPLEX, SHASHTRINAGAR, BHAVNAGAR, GUJRAT-364001 15-9-2015
509 ASTM SKILLS PRIVATE LIMITED INSTITUTE OF ADVANCED SECURITY TRAINING & MANAGEMENT PVT. LIMITED, A 61, SECTOR 16, NOIDA, UP 17-3-2016
510 ASTRIC COMPUTERS INDIA PVT LTD FLAT NO.401, SAMRIDHI COMPLEX, S.P. VERMA ROAD PATNA, BIHAR 19-1-2017
511 ASTRIC SOLUTIONS DURBHASHA BHAWAN BSNL TELEPHONE EXCHANGE COMPOUND KHAJPURA BAILEY ROAD PATNA BIHAR 1-12-2014
512 ASTRON HOSPITAL AND HEALTHCARE CONSULTANTS L.G.F. SURYA KIRAN BUILDING, OLD GURGAON-MEHRAULI ROAD,SECTOR-14, OPPOSITE TO SBI BANK ,GURGAON 5-1-2017
513 ASTRON INSTITUTE OF SOCIAL SCIENCES L.G.F. SURYA KIRAN BUILDING , OPP TO SBI BANK, SEC-14, OLD GURGAON MEHRAULI ROAD, GURGAON 19-7-2016
514 ASWATTHA ADVISORS PVT LTD UNIT 6 NEERU SILK MILLS, MATHURADAS MILLS COMPOUND, 126 N.M. JOSHI MARG, LOWER PAREL (W), MUMBAI 26-11-2013
515 ATACHAYA TRUST ATACHAYA TRUST 8/145 THONDIYAPPA ESTATE, SAKKARAKOTTAI (PO) NEAR RAILWAY GATE, RAMANATHAPURAM 13-5-2016
516 ATCHAYA TRUST 8/145 THONDIYAPPA ESTATE, NEAR RAILWAY GATE, SAKKARAKOTTAI (PO) RAMANATHAPURAM 5-7-2016
517 ATHENCOTTASAN MUTHAMIL KAZHAGAM ATHENCOTTASAN MUTHAMIL KAZHAGAM (AMK) AMK, 7-46B, NADUVOORKARAI – ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. WEBSITE: WWW.AMKCENTRE.ORG E-MAIL: AMKCENTRE@GMAIL.COM, AMKHOSPITAL@YAHOO.COM PH: 04651 –222356, 223382, 223342, 223384 MOBILE: 09444691456 28-9-2015
518 ATHENCOTTASAN MUTHAMIZH KAZHAGAM AMK AMK, NO.7-46B, NADUVOORKARAI ROAD, MONDAIKADU & POST, KANYAKUMARI DISTRICT, TAMIL NADU, SOUTH INDIA.PIN: 629 252. 18-9-2015
519 ATHEOS INFRASOLUTIONS PVT LTD 3266, 11TH MAIN, HAL 2ND STAGE, INDIRANAGAR, BANGALORE 14-9-2015
520 ATHI NAINAPPAN EDUCATIONAL AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE, SIVAGANGAI TALUK, SIVAGANGAI DISTRICT 13-10-2016
521 ATHI NAINAPPAN EDUCATION AND CHARITABLE TRUST SATHARASANKOTTAI VILLAGE SIVAGANGAI TALUK SIVAGANGAI 13-1-2017
522 ATIDIPTAH SOLUTIONS PVT LTD 102, PLOT NO-9, PKT-7, AGGARWAL SQUARE PLAZA, SECTOR-12, DWARKA, DELHI 28-9-2016
523 A TO Z ON WHEELS PRIVATE LIMITED PLOT NO. 204, BLOCK E-3, MOLARBAND EXTENSION, BADARPUR,NEW DELHI. 14-9-2015
524 ATULYA VIKASH ATULYA VIKASH, NEAR SUN RISES SCHOOL, KUNDA, DEOGHAR, JHARKHAND, 814143 17-9-2015
525 ATULYA VIKASH SUN RISES SCHOOL, BHIKHANA, KUNDA, DEOGHAR, JHARKHAND, 814143 7-1-2016
526 A UNIT OF FOUR SEASONS FOUNDATION A-81 SECTOR 2 NOIDA UP 21-12-2016
527 AURA FACILITIES MANAGEMENT PVT LTD 002, DUPLEX HEIGHTS, PARASRAMPURIA TOWER NO 6, OPP MILLAT NAGAR, OSHIWARA, ANDHERI (W), MUMBAI 12-11-2013
528 AURIC SOLUTIONS PRIVATE LIMITED 701A & B,702A & 703 DEVIKA TOWER,BUILDING NO:-6, NEHRU PLACE NEW DELHI 14-9-2015
529 AUROBINDO CHAUDHURI MEMORIAL GREAT INDIAN DREAM FO IIPM CAMPUS, CHATTARPUR BHATTIMINES ROAD, SATBARI CHANDANHAULA. NEW DELHI 4-10-2013
530 AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY AUROVILLE INSTITUTE OF APPLIED TECHNOLOGY,IRUMBAI MAIN ROAD(OPP.TNEB-STATION)IRUMBAI&PO.605111,VANUR TALUK,VILLUPURAM DIST,PHONE 0413 2671758 11-1-2016
531 AUSTRALIAN RETAIL COLLEGE INDIA PVT LTD 24/3RT SANJEEVA REDDY NAGAR MAIN ROAD, SANJEEVA REDDY NAGAR, HYDERABAD, TELANGANA 21-8-2014
532 AUTOLINK ENTERPRISES INDIA PRIVATE LIMITED 57, ADCHINI, AURBINDO MARG, NEW DELHI 15-9-2015
533 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA 3-3-2016
534 AVA INDIA SERVICES PRIVATE LIMITED 312 PATLIPUTRA COLONY, PATNA 5-2-2016
535 AVANI EDUCATION SOCIETY HIG-2/16,BORSI HOUSING BOARD COLONY,DURG, CHHATTISGARH 26-3-2014
536 AVE MARIA MEDICAL AND EDUCATIONAL SERVICE SOCIETY NEAR SAIBABA TEMPLE, GANDHI NAGAR, SRUNGAVARAPUKOTA 5-9-2014
537 AVINASHILINGAM INSTITUTE FOR HOME SCIENCE AND HIGHER EDUCATION METTUPPALAYAM ROAD, COIMBATORE, TAMIL NADU 30-1-2014
538 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136 29-12-2016
539 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136 9-12-2016
540 AVLOKAN DEVELOPMENT INDIA CENTRE PARBOTIPUR, WARD NO-13 PO+PS-TAMLUK ,PURBA MEDINIPUR , WB, 721136 21-12-2016
541 AVON FACILITY MANAGEMENT SERVICES LTD #27, 4TH FLOOR, SV TOWERS, 80 FEET ROAD, 6TH BLOCK, KORMANGALA, BANGALORE 560095 30-9-2013
542 AVR CONSULTANCY AND PROJECTS PVT LTD PLOT NO-1,PHASE -2, MAYFAIR CITY, BALIKUDA, NEAR RAILWAY LEVEL CROSSING, GOPALPUR, CUTTACK, ODISHA 30-10-2013
543 AVSARR QUEST PRIVATE LIMITED E-4, DEFENCE COLONY, 2ND FLOOR, MAINRING ROAD, NEW DELHI - 110024 25-11-2014
544 AVS EDUCATIONAL AND DEVELOPMENT SOCIETY FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW 9-2-2016
545 A V S M SECURITY AND OUTSOURCING PVT LTD 28, FIRST FLOOR, ADARSH COMPLEX, ENGG. COLLEGE CROSSING , SECTOR E, JANKIPURAM, LUCKNOW 28-9-2016
546 AVSR SOFTECH PRIVATE LIMITED NEAR GOPAL TALKIES, SHYAM NAGAR, BUDAUN (U.P.) 24-5-2016
547 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW 20-7-2016
548 AVS TECHNOQUEST INDIA LIMITED FIRST FLOOR 545 GA NEW CHANDGANJ GARDEN ALIGANJ, LUCKNOW, UTTAR PRADESH 20-7-2016
549 AVTAR WELFARE SOCIETY 842,SIDDHI BHAWAN, NEAR RANI MAHAL JHANSI 22,MISSION COMPOUND CIVIL LINES, JHANSI 5-9-2016
550 AVTEG PRIVATE LIMITED 1001, LEVEL 10, IRIS TECH PARK A, SECTOR 48, SOHNA ROAD, GURGAON 9-4-2015
551 AVVAI VILLAGE WELFARE SOCIETY AVVAI VILLAGE WELFARE SOCIETY KILVELUR NAGAPATTINAM DISTRICT 22-12-2013
552 AVVAS INFOTECH PVT LTD AVVAS INFOTECH PVT LTD, #40, 6TH SECTOR, 12TH MAIN, BEHIND BDA COMPLEX & JSS WOMEN’S COLLEGE, HSR LAYOUT, BANGALORE – 560102 18-1-2017
553 AVYAN SKILL DEVELOPMENT PRIVATE LIMITED NO. 71-74, NEW NO. 41, VENKADU SWAMY STREET, NEW SIDHAPUDUR, COIMBATORE, TAMIL NADU 6-7-2016
554 AWADH SEWA SANSTHAN VILLAGE AND POST GAURA KUREBHAR DISTRICT SULTANPUR (UP) 1-11-2016
555 AWAKE AGRICULTURAL AND RURAL DEVELOPMENT SOCIETY 8-5-283/25 DEFENCE COLONY, VAISHALI NAGAR, KARMANGHAT, RANGA REDDY,AP. CELL 9440886883 10-2-2015
556 AWANTI BAI JANSEVA SANSTHAN HO.NO.356/SP-95, SONAPUR, ALAMNAGAR, LUCKNOW 20-8-2015
557 AYES INFOTECH PRIVATE LIMITED 130, FIRST FLOOR ZONE-2 M.P. NAGAR BHOPAL M.P.-462011 1-7-2014
558 AZUPUKI MULTIPURPOSE COOPERATIVE SOCIETY LIMITED THILIXU VILLAGE, 3RD MILE, DIMAPUR, NAGALAND - 797112 22-1-2014
559 B4 SECURITY PRIVATE LIMITED M-64,1ST FLOOR,OPP. JHANKAR BANQUETS HALL, LADO SARAI,NEW DELHI 5-2-2015
560 BABA BHAGWAN DASS EDUCATION SOCEITY VILL TIKLA PO NANGAL TEJU 5-9-2016
561 BABA BHAGWAN DASS EDUCATION SOCIETY VILL TIKLA PO NANGAL TEJU TEH BAWAL DISTT REWARI 9-8-2016
562 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIOANL SOCIETY B-75, RAKSHA VIKA, APPARTMENT, PHASE -1, PLOT NO. 2, BODHELLA, VIKASPURI, NEW DELHI - 110018 11-1-2016
563 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APPARTMENT, PHASE - 1, PLOT NO.2, BODHELLA, VIKASPURI, NEW DELHI - 110018 4-1-2016
564 BABA SAHEB AMBEDKAR TECHNICAL EDUCATIONAL SOCIETY B-75, RAKSHA VIKAS APARTMENT, PHASE - 1, PLOT NO-2, BODHELLA, VIKASPURI, NEW DELHI - 110018 29-12-2015
565 B ABLE BASIX ACADEMY FOR BUILDING LIFELONG EMPLOYABILITY LTD (B-ABLE) 315/274, 2ND FLOOR, WEST END MARG SAID-UL-AJAB, M.B.ROAD, NEW DELHI 30-9-2013
566 BABU HARBANS BAHADUR SINGH SMRITI VIDYA NYAS VILLAGE-JAGDEESHPUR (KOTE), PO.-KATARI, CHOLAPUR, DISTT-VARANASI, U.P 12-9-2016
567 BACHHAWAT SAREES PRIVATE LIMITED DHULA HOUSE, BAPU BAZAR, JAIPUR 21-12-2016
568 BADHTE KADAM CAMPUS OF CAPITAL COACHING INSTITUTE, ASHOK RAJPATH, MAHENDRU 4-8-2016
569 BADI KALMER JANSEVA SAMITI 51, BADI KALMER, POST AND TEHSIL HATOD, DIST. - INDORE 28-9-2015
570 BADI KALMER JANSEVA SAMITI BADI KALMER, POST AND TEHSIL HATOD, DIST. INDORE (M.P.) 11-9-2015
571 BADLOO SINGH LAKSHMI DEVI DEVELOPMENT SOCIETY 217, THIRD FLOOR, SUKHDEV VIHAR NEW DELHI 16-3-2016
572 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE ADMINISTRATIVE BUILDING,SBVR COLLEGE OF EDUCATION CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR ROAD, BADVEL , YSR DIST 8-4-2016
573 BADVEL AND SIDHOUT HIGHER EDUCATION COMMITTEE SBVR EDUCATIONAL GROUP CAMPUS, MADAKALAVARIPALLI, GOPAVARAM MANDAL, MYDUKUR MAIN ROAD, BADVEL, YSR KADAPA DIST 17-5-2016
574 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR 26-12-2016
575 BAGARIA EDUCATION TRUST 110, ARAVIND NAGAR, JAGATPURA, JAIPUR 29-12-2016
576 BAGNAN JANA KALYAN SAMITY VILL & P.O. HATURIA, DIST HOWRAH, PIN - 711303, WEST BENGAL 2-9-2016
577 BAHUUDDESHIYA SHAHARI EVAM GRAMIN VIKAS SANSTHAN KHAIRI TEK, NAGPUR ROAD SEONI 26-4-2016
578 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY C-181 PATEL GARDEN EXT KAKROLA DWARKA MOR NEW DELHI 28-10-2016
579 BAJRANGBALI EDUCATIONAL AND SOCIAL WELFARE SOCIETY KH NO 15/23 KAKROLA OPP. TARA NAGAR DWARKA SEC16B 4-8-2016
580 BAKRESHWAR SOCIAL WELFARE AND DEVELOPMENT TRUST PRESENT ADDRESS - VILL- SAGAR, PO-HETAMPUR, DIST-BIRBHUM, WEST BENGAL 15-9-2016
581 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.) 7-1-2016
582 BALAGANJ SOCIAL WELFARE SOCIETY SAMITI SAI GROUP OF INSTITUTE SCIENCE & TECHNOLOGY SHIKSHA VIBHAG PARISAR GANDHI CHOURAHA MANDSAUR (M.P.) 12-1-2016
583 BALAJEE ARUN EDUCATIONAL SOCIETY PLOT NO: 44, 42A, BEHIND NACHARAM TELEPHONE EXCHANGE, MALKAJGIRI , RANGA REDDY DISTRICT, HYDERABAD 9-4-2015
584 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL 17-8-2016
585 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY 16-8-2016
586 BALAJI EDUCATIONAL CHARITABLE FAMILY TRUST VILL + POST MANDRA, P.S. DHANIAKHALI DIST : HOOGHLY, WEST BENGAL 17-8-2016
587 BALAJI EDUCATIONAL TRUST BALAJI ITI CAMPUS NH-47 BHAVANI MAIN ROAD SANKARI - TK, SALEM - DT 21-8-2014
588 BALAJI INDUSTRIAL AGRICULTURAL CASTINGS PVT LTD 16, IDA, BALANAGAR, HYDERABAD, ANDHRA PRADESH 2-3-2016
589 BALARAM PANDA TRUST B-004, KRISHNA TOWER, NAYAPALLI, BHUBANESWAR, DIST: KHORDA, ODISHA 7-10-2016
590 BALASORE CHAMBER OF INDUSTRY AND COMMERCE UDYAG BHAWAN, INDUSTRIAL ESTATE, BALASORE, ODISHA 5-4-2016
591 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - 2, NEW DELHI 22-7-2016
592 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART II, NEW DELHI - 110048 27-6-2016
593 BAL BHARTI ACADEMY E-366, LOWER GROUND FLOOR, GREATER KAILASH PART - II, NEW DELHI 9-8-2016
594 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI, PIN: 781028 16-9-2015
595 BAL BHARTI EDUCATIONAL TRUST SYNDICATE REGALIA, FLAT NO: 2B, JAYANAGAR- KHANAPARA ROAD, P.O.: BELTOLA, P.S.: BASISTHA, GUWAHATI, 14-9-2015
596 BAL GANGADHAR TILAK SHIKSHAN SANSTHAN WARD NO 05 NEAR RAILWAY STATION BHADRA 9-4-2015
597 BALGONA ICON COMPUTER ACADEMY BALGONA CHATTI P.O - NITYANANDAPUR 14-9-2015
598 BALI EDUCATION SOCIETY FIRST FLOOR OF PUNJAB & SIND BANK, G.T.ROAD, P.O.DINANAGAR, DISTT-GURDASPUR, 13-12-2016
599 BAL MAHILA AVAM GRAM VIKAS SEWA SAMITI 58/300/1 B1 AYODHYA KUNJ ARJN NAGAR MAIN ROAD AGRA 4-1-2016
600 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH 4-8-2016
601 BAL MAHILA VIKAS SAMITI 9-C, MAHARANA PRATAP NAGAR, USHA COLONY, NEAR JIWAJI CLUB, LASHKAR-474009, GWALIOR, MADHYA PRADESH 5-9-2016
602 BAL MAHILA VIKAS SAMITI VAMA 9-C MAHARANA PRATAP NAGAR, USHA COLONY NEAR JIWAJI CLUB LASHKAR GWALIOR 17-5-2016
603 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI NURSING HOME, NDA ROAD, NEAR UTTAMNAGAR TELEPHONE EXCHANGE, UTTAMNAGAR, PUNE 13-11-2015
604 BAMBURDE MEDICAL AND SOCIAL FOUNDATION SAYALI MULTISPECIALITY HOSPITAL,NDA ROAD,NEAR UTTAMNAGAR TELEPHONE EXCHANGE,UTTAMNAGAR,PUNE-23 15-9-2015
605 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHARIJAKARRIBARI DIST- COOCH BEHAR 31-8-2016
606 BANCHUKAMARI JANA KALLYAN SOCIETY VILL- BANCHUKAMARI PO- KHAR 14-9-2016
607 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 700091 27-10-2016
608 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 6-12-2016
609 BANDHAN KONNAGAR DN 32, SECTOR V, SALT LAKE CITY, KOLKATA, WEST BENGAL 23-11-2016
610 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY MAIN ROAD OPPOSITE HANDLOOM DEPARTMENT BANDIPORA 193502 KASHMIR 11-1-2016
611 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPP. HANDLOOM DEPARTMENT MAIN ROAD BANDIPORA SRINAGAR 30-11-2015
612 BANDIPORA COLLEGE OF INFORMATION TECHNOLOGY OPPOSITE HANDLOOM DEPARTMENT MAIN MARKET BANDIPORA KASHMIR 10-2-2016
613 BANGALORE RURAL EDUCATIONAL AND DEVELOPMENT SOCIETY BANGALORE RURAL EDUCATIONAL AND DEVELOPMENT SOCIETY (BREADS) DON BOSCO, 75 NORTH ROAD, BANGALORE 2-6-2014
614 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI ALLAHAPUR ALLAHABAD ALLAHABAD 211006 UTTAR PRADESH 28-9-2016
615 BANKE BIHARI JAN KALYAN SEWA SANSTHAN 638 BAGHAMBARI GADDI, ALLAHAPUR, ALLAHABAD UTTAR PRADESH 27-10-2016
616 BANSIDHAR AND ILA PANDA FOUNDATION IMFA BUILDING, BOMIKHAL, P.O-RASULGARH, BHUBANESWAR 19-11-2013
617 BARAK VALLEY WELFARE DEVELOPMENT SOCIETY ADDRESS: RAMKRISHNA MISSION ROAD, SILCHAR, CACHAR, ASSAM. PINCODE: 788007 PHONE & FAX (OFFICE): 03842-267981 +91-9435072276 (PRESIDENT) E-MAIL ADDRESS: CHANDAGOURANGA@YAHOO.COM BARAKVALLEYNGO@GMAIL.COM WEBSITE: WWW.BARAKVALLEYSOCIETY.ORG 1-7-2014
618 BARASAT CHETAN SEVASHRAM SANGHA ANANDA NIKETAN,BURIPUKUR, BARASAT, KOLKATA, WEST BENGAL, INDIA 5-9-2016
619 BARDHAMAN NEXT INDRAPRASTHA , BABURBAG, BURDWAN-713104 11-1-2016
620 BARDHAMAN NEXT REG.OFF.-INDRAPRASTHA, BABURBAG, BURDWAN, 5-1-2016
621 BARDHAMAN NEXT INDRAPRASTHA, BABURBAG, BURDWAN 27-6-2016
622 BARFANI ANUSANDHAN SANSTHAN NEAR P.T.S BARFANI DHAM PATAL BHAIRVI, RAJNANDGAON 5-11-2013
623 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR, KHARAGPUR, PASCHIM MEDINIPUR ,WEST BENGAL , PIN -721301 14-9-2015
624 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATANBAZAR, KAUSHALLYA, KHARAGPUR, PASCHIM MEDINIPUR CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL, PASCHIM MEDINIPUR 28-9-2015
625 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATAN BAZAR KAUSHALLYA KHARAKPUR KOLKATA MIDNAPORE 11-8-2016
626 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY REGISTERED ADDRESS:-PURATAN BAZAR ,KAUSHALLYA, KHARAGPUR , PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 CORRESPONDING ADDRESS:-MADANMOHAN, CHANGUAL, KHARAGPUR LOCAL,PASCHIM MEDINIPUR ,WEST BENGAL,INDIA , PIN CODE:-721301 24-11-2015
627 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR PASCHIM MEDINIPUR 9-9-2016
628 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR KAUSHALLYA KHARAGPUR 22-9-2016
629 BARNAMALA EDUCATIONAL AND CULTURAL SOCIETY PURATANBAZAR,KAUSHALLYA,KHARAGPUR,PASCHIM MEDINIPUR 6-10-2016
630 BARUNA TARUN SANGHA K-27 SARATPALLY, MIDNAPORE, PASCHIM MEDINIPUR, WEST BENGAL 14-9-2015
631 BASANTDEVI CHARITABLE TRUST MITS GROUP CORPORATE OFFICE, 2(P), INFOCITY, PATIA, CHANDAKA INDUSTRIAL ESTATE 25-11-2014
632 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, P.O+ P.S-MURARAI, DIST.- BIRBHUM, WEST BENGAL-731219 22-8-2016
633 BASANTIKA MEMORIAL EDUCATION SOCIETY BASANTIKA, BHADISWAR MORE, POST.+ P.S-MURARAI, DIST.-BIRBHUM, WEST BENGAL-731219. 18-8-2016
634 BASANTIKA MEMORIAL EDUCATION SOCIETY BHADISWAR MORE, PO. MURARAI, DIST. BIRBHUM, WEST BENGAL - 731219 22-8-2016
635 BASE INFORMATION MANAGEMENT LIMITED BASE INFORMATION MANAGEMENT LIMITED,D/715-718,NATHANI ROAD,VIDYAVIHAR(WEST),MUMBAI-400086 27-6-2016
636 BASIL MENDES MEMORIAL EDUCATIONAL AND CHARITABLE OPPOSITE CIRCUIT HOUSE KADRI HILLS MANGALORE 14-9-2015
637 BASILMENDESMEMORIALEDUCATIONALANDCHARITABLETRUST OPP CIRCUIT HOUSE KADRI HOUSE MANGALORE 12-1-2016
638 BASILMENDESMEMORIALEDUCATIONAL AND CHARITABLETRUST OPPOSITE CIRCUIT HOUSE, KADRI HILLS MANGALORE 17-2-2016
639 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A,BOUNGLOW STREET, VASUDEVANALLUR[PO] SIVAGIRI [TK] TIRUNELVELLI [DT] TAMILNADU STATE, SOUTH INDIA 15-9-2015
640 BASSURPANNAIYAR RURAL DEVELOPMENT CHARITABLE TRUST 8A BOUNGLOW STREET VASUDEVANALLUR SIVAGIRI TK TAMILNADU 3-3-2016
641 B C L EDUCATIONAL SOCIETY SAI COMPLEX BUDH BAZAR STATION ROAD 18-8-2015
642 BCL SECURE PREMISES PVT LTD VIOM TOWER, 7TH FLOOR, PLOT NO.- 14A, SECTOR - 18, MARUTI INDUSTRIAL COMPLEX, GURGAON - HARYANA. 4-1-2016
643 BCL SECURE PREMISES PVT LTD 7TH FLOOR, PLOT NO 14A, SECTOR 18, MARUTI INDUSTRIAL COMPLEX, GURGAON (HARYANA) 14-10-2015
644 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW 29-12-2015
645 BCS CONSULTING PRIVATE LIMITED 21/A-2 TILAK MARG DALIBAGH LUCKNOW 31-12-2015
646 BCS CONSULTING PRIVATE LIMITED 21/A-2, TILAK MARG, DALIBAGH, LUCKNOW- UP 28-12-2015
647 BEANSTALK TRAINING AND ASSESSMENTS PRIVATE LIMITED APEEJAY HOUSE, 6TH FLOOR, MUMBAI SAMACHAR MARG, FORT, MUMBAI 20-9-2016
648 BEHALA INSTITUTE OF ALLIED HEALTH SCIENCES 2C/6, HO CHI MINH SARANI, SANJIB PALLY, BEHALA, KOLKATA - 700034 5-2-2015
649 BEHALA MOTHER WELFARE SOCIETY 18,S.N.CHATTERJEE ROAD,KOLKATA,PIN-700034,WEST BENGAL 23-12-2016
650 BELAL ZAFAR MEMORIAL SOCIETY NEAR BANK OF INDA LALDARWAZA, GHAZIPUR DIST. GHAZIPUR UTTAR PRADESH 5-12-2016
651 BELLIKOTH INSTITUTE RURAL ENTREPRENEURSHIP DEVELOPMENT THE DIRECTOR BELLIKOTH INSTITUTE ( ANDHRA BANK RSETI) ANADHASRAMAM (PO) KANHANGAD KASARAGOD (DIS) 26-3-2014
652 BENESHWER LOK VIKAS SANSTHAN NEAR DAKSHIN KALIKA MATA TEMPLE, BEDWA, PARTAPUR, GARHI, BANSWARA RAJASTHAN 23-5-2016
653 BENSON GOURMET PVT LTD NO-9 MOUNASAMAY MADAM CROSS STREET, VENKATAPURAM, AMBATTUR O.T, CHENNAI 24-6-2015
654 BENTOGREEN SKILL PRIVATE LIMITED 50L, GULSHAN COLONY, WEST CHOWBAGA, KOLKATA, WEST BENGAL 23-12-2016
655 BERHAMPORE PRAGATI 73/1 SWARNAMOYEE ROAD, BERHAMPORE, MURSHIDABAD 8-1-2016
656 BERKELEY HEALTHEDU PVT LTD FIRST FLOOR 37 LINK ROAD LAJPAT NAGAR 15-3-2016
657 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI 26-2-2016
658 BERKELEY HEALTHEDU PVT LTD 37, LINK ROAD, LAJPAT NAGAR-3, NEW DELHI 5-2-2016
659 BERKELEY HEALTHEDU PVT LTD 37 LINK ROAD LAJPAT NAGAR NEW DELHI 4-4-2016
660 BEROJGAR MAHILA SEWA SAMITI ZONE-3, KHURSIPAR, BHILAI, DIST-DURG, (C.G.), PIN-490011 PHONE - 91-788-356822, 5534906 26-12-2013
661 BEST DRIVING SCHOOL 639/188 B MAIN ROAD, VADAGUDI CHATHIRAM, NAGORE POST, NAGAPATTINAM. 17-3-2015
662 BEST FIRST STEP EDUCATION PRIVATE LIMITED 1G, EVEREST HOUSE 46C, JAWAHARLAL NEHRU ROAD KOLKATA. 7-1-2015
663 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND INFORNT OF D A V INTER COLLEGE G T ROAD ALIGARH 11-1-2016
664 BEST INSTITUTE OF INFORMATION MENTION TECHNOLOGY SAMITI B.DAS COMPOUND IN FRONT OF DAV INTER COLLEGE G.T. ROAD ALIGARH U.P. 15-1-2016
665 BHAGINI NIVEDITA SHIKSHA SAMITI 40, SHIV SHAKTI NAGAR, HOSHANGABAD ROAD, BHOPAL 11-1-2016
666 BHAGINI NIVEDITA SHIKSHA SAMITI SHIV SHAKTI NAGAR HOSHANGABAD, HOSHANGABAD MADHYA PRADESH, BHOPAL 16-9-2015
667 BHAGVATI EDUCATION AND CHARITABLE TRUST AT CHORWAD RAMKUNJ KRISHNA ENGLISH MEDIUM SCHOOL SOMNATH DWARKA ROAD TQ MALIYAHATINA 7-1-2016
668 BHAGWAN PARSHURAM ASHRAM SEWA SAMITI SECTOR 7-A, ROHTAK ROAD, GOHANA, SONEPAT, HARYANA 4-8-2016
669 BHAGWAN SRI BALASAI EDUCATIONAL CHARITABLE SOCIETY KALINGA UNIVERSITY CAMPUS VILL KOTNI NEAR MANTRALAYA NAYA RAIPUR 15-6-2016
670 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA 14-9-2015
671 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA 14-10-2015
672 BHAGYODAYA SHIKSHAN PRASARAK SANSTHA 1192, PANCHSHEEL NAGAR, BHINGAR, AHMEDNAGAR - 414002 MAHARASHTRA 4-1-2016
673 BHANDARI HEALTH CARE PRIVATE LIMITED 138 A VASUNDHARA COLONY GOPALPURA BYPASS TONK ROAD JAIPUR 26-7-2016
674 BHANDARI HEALTH CARE PRIVATE LIMITED 138A VASUNDHARA COLONY TONK ROAD JAIPUR 18-8-2016
675 BHANWARLAL NAHATA SMRITI SANSTHAN MANDSAUR INSTITUTE OF TECHNOLOGY, SH-31, MHOW-NEEMUCH BY-PASS ROAD, MANDSAUR (M.P.) 14-10-2015
676 BHARANI PIPES AND TUBES PRIVATE LIMITED 279, SATHY ROAD, ERODE, TAMIL NADU 14-10-2015
677 BHARAT AROGYA AND GYAN MANDIR BIRLA CAMPUS, SARALA BIRLA PUBLIC SCHOOL VILL. ARA, MAHILONG, RANCHI-PURULIA HIGHWAY,TATISILWAI RANCHI-835103, JHARKHAND 2-6-2014
678 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH NEAR BUS STAND THEHAT ROAD ROOPGARH DANTARAMGARH SIKAR RAJASTHAN 11-8-2016
679 BHARAT BHARTI SHIKSHAN SHANSTHAN ROOPGARH V/PO-ROOPGARH, VAYA-KOCHOR DANTARAMGARH SIKAR RAJSATHAN 5-9-2016
680 BHARAT BHARTI SHIKSTHAN SHANSTHAN ROOPGARH VILLAGE-ROOPGARH,VAYA-KOCHOR DANTARAMGARH, SIKAR, RAJSATHAN 25-7-2016
681 BHARAT EDUCATIONAL AND SOCIAL WELFARE SOCIETY VILLAGE AND POST OFFICE BABAIN, BABAIN,KURUKSHETRA HARYANA 5-8-2016
682 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-DIST., 26-4-2016
683 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140 E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI DIST., TAMILNADU. 5-2-2016
684 BHARAT EDUCATIONAL CHARITABLE TRUST NO.2/140-E, G.K.ROAD, PARAYAPATTI PUDUR-P.O., PAPPIREDDIPATTI-T.K., DHARMAPURI-636903 8-1-2016
685 BHARAT EDUCATIONA SOCIETY H. NO.12,HOUSING BOARD, CHAKKI WALI GALI JIND,HARYANA 13-9-2015
686 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL ADOOR,ADOOR TOWN 14-10-2015
687 BHARATH EDUCATIONAL CHARITABLE SOCIETY CENTRAL JUNCTION,ADOOR TOWN,ADOOR POST 30-10-2015
688 BHARATHI CATERING INDUSTRIAL SCHOOL 36/22, EXTENSION STREET, NAVALPUR,RANIPET,VELLORE 10-11-2014
689 BHARATHI INDEPENDENT MEDIA PVT LTD ARYABHATTA BHAVAN, VISHWA BHARATHI CAMPUS, NIZAMPET ROAD, KUKATPALLY, HYDERABAD 19-1-2017
690 BHARATHIYAR MAKKAL NALVALVU SANGAM 42/78 TOWN RAILWAY STATION ROAD, NEAR MULLVADIGATE, SALEM. TAMILNADU 6-4-2015
691 BHARATHIYA VANITHA VIKASANA SANGAM N.S.S BUILDING KOTTARAKKARA P.O KOTTARAKKARA 14-9-2015
692 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 16-2-2016
693 BHARATH UNIVERSITY 173, AGHARAM ROAD, SELAIYUR, CHENNAI, TAMIL NADU 600073 8-2-2016
694 BHARATHY EDUCATIONAL TRUST PALLARIPALAYAM, C.MEIYUR POST, TIRUKKOILUR-TALUK, VILLUPURAM-DIST, TAMILNADU 23-9-2014
695 BHARATIA UNITY BENEFIT BHARATIA UNITY BENEFIT, R-C/5, SALLY RIDE PATH, SE-2B , BIDHANNAGAR, DGP-12 16-1-2017
696 BHARATIY MAHILA GRAMODYOG SANSTHAN REGD: VILL BAGHERA POST DHARAWARA KARCHHANA DIST ALLAHABAD. 212301 HEAD OFFICE : 51-B GEORGE TOWN ALAHABAD 211002 26-4-2016
697 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH) 30-11-2016
698 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH) 16-12-2016
699 BHARAT JAN SEWA SANSTHAN JCEE DAY, 3 NORTH LADDHAWALA, NEAR PAL DHARMASHALA ROORKEE ROAD, MUZAFFARNAGAR ( UTTAR PRADESH) 14-12-2016
700 BHARAT MATA WELFARE FOUNDATION 128-C, POCKET-F MAYUR VIHAR, PHASE-II DELHI-110091 8-4-2015
701 BHARAT SANCHAR NIGAM LIMITED RAJIV GANDHI MEMORIAL TELECOM TRAINING CENTER GST ROAD,OPP.TO OLD AIRPORT MEENAMBAKKAM, CHENNAI 29-12-2016
702 BHARAT SASHAKTIKARAN TRUST RZ-137 D-DLOCK PATEL GARDEN KAKROLA MOR NEW DELHI 15-9-2015
703 BHARAT SASHAKTIKARAN TRUST RZ-137 DBLOCK PATEL GARDEN KAKROLA MOR DWARKA 3-5-2016
704 BHARAT SEVA TRUST S-3, 61&62, SECTOR-A, ZONE-B, MANCHESWAR INDUSTRIAL ESTATE, BHUBANESWAR, 11-5-2016
705 BHARAT SEVA TRUST NO-01, LAXMISAGAR, BHUBANESWAR 26-4-2016
706 BHARDWAJ COMPANY VILL. POST.PRATAPPURA,VAYA-BANDIKUI TEH-BASWA DISTT-DAUSA SIKANDRA ROAD, BANDIKUI, DISTT.DAUSA 6-5-2016
707 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI NEW SANGANER ROAD, JAIPUR 14-12-2016
708 BHARTI VIKAS SANSTHAN 81, PANCHWATI COLONY, GURJAR KI THADI, NEW SANGANER ROAD, JAIPUR- 302019 9-12-2016
709 BHARTIYA GRAM SUDHAR SAMITI FCA-794/A, BLOCK-C, BAGHWALI POCKET, SGM NAGAR, PATEL CHOWK, FARIDABAD 19-1-2017
710 BHARTIYA LOK KALYAN SANSTHAN BLKS BHWAN, RAJ NAGAR, POWER HOUSE, NEAR RAILWAY CROSSING, POST-CHUTIA, PS-CHUTIA, WARD-48, DIST-RANCHI 1-11-2013
711 BHARTIYA SAMAJ KALYAN AVAM GRAMIN VIKAS SANSTHAN 23Q/3B/3, VINOVA NAGAR, NEW MARKET, NAINI, ALLAHABAD 30-10-2013
712 BHARTIYA SHAIKSHIK SANSTHAN 12 GURJAR SHOPPING COMPLEX TULSI NAGAR BHOPAL(MP) 29-3-2014
713 BHASKAR FOOD PRIVATE LIMITED OFFICE BLOCK -1A, 5TH FLOOR DB CITY CORPORATE PARK, ARERA HILLS OPP. MP NAGAR ZONE -I, BHOPAL-462011, MADHYA PRADESH, INDIA 7-10-2013
714 BHASKAR FOUNDATION E-14C, GROUND FLOOR, SECTOR-8, NOIDA-201301 17-3-2016
715 BHAT BIOTECH INDIA PRIVATE LIMITED NO 11 A 4TH CROSS VEERASANDRA INDUSTRIAL AREA ELECTRONIC CITY 14-9-2015
716 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE,KOTA 6-5-2016
717 BHATIA AND COMPANY 23-24B,INDUSTRIAL ESTATE,KOTA 17-5-2016
718 BHATIA AND COMPANY 23-24 B INDUSTRIAL ESTATE, KOTA 8-6-2016
719 BHAVANI URBAN CREDIT COOP SOCIETY LTD SHEGAON BHAVANI URBAN CREDIT COOP SOCIETY LTD SHEGAON NEAR GANDHI CHOWK TQ SHEGAON DIST BULDHANA PIN NO(444203) C/O KRUSHNA PRALHAD PATIL NO 09850351135 22-7-2016
720 BHAVISHYA BHARAT B-BLOCK 2ND FLOOR ROXANA TOWERS GREENLANDS BEGUMPET HYDERABAD TELANGANA 6-1-2016
721 BHAVISHYA BHARAT BHAVISHYA BHARAT 7TH FLOOR, BLOCK- B, ROXANA TOWERS, GREENLANDS, BEGUMPET, HYDERABAD 20-7-2016
722 BHAVITHA EDUCATIONAL SOCIETY FOR TRANSFORMATION 13-1-44, BANGARAIAH GARI VEEDHI, RAMACHANDRA RAO PETA, TADEPALLIGUDEM-534102 WEST GODAVARI DISTRICT, ANDHRA PRADESH 21-10-2016
723 BHAVYA DEVELOPMENT PROCESSING SOLUTIONS PVT LTD 3RD SWARNALOK COMPLEX, RAJAGOPALACHARI STREET GOVERNORPET, VIJAYAWADA-2 1-11-2013
724 BHAWNA 85,CHAKA, NAI BASTI (IN FRONT OF SHEMFORD), NAINI ALLAHABAD, UTTAR PRADESH 16-11-2016
725 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI DISTT MEERUT -25001 13-1-2017
726 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI D-18 NEAR ZILA SEHKARI BANK GANGA NAGAR MEERUT 25001 2-2-2016
727 BHIDWARIYA SHIKSHA PRACHAR PRASAR SAMITI VILL ULAKHPUR PO SAINI MAWANA ROAD MEERUT 29-2-2016
728 BHILAI INSTITUTE OF TECHNOLOGY TRUST VILLAGE: KENDRI, BLOCK: ABHANPUR, DIST: RAIPUR NH - 30, CHHATTISGARH 13-5-2016
729 BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA BHIMASHISHYA MAGASVARGIYA BAHU VIKAS SANSTHA KHANDALA POST JAWALA TQ ARNI DIST YAVATMAL MAHARASHTRA 15-6-2016
730 BHOJPUR MAHILA KALA KENDRA BAZARI SHA KA MANDIR, ABAR POOL PAR, ARA 17-9-2015
731 BHOLA INSTITUTIONAL TRUST 303,LAXMI TOWER MAIN ROAD,HINOO NEAR HDFC BANK RANCHI 13-10-2015
732 BHOLA INSTITUTIONAL TRUST 108, HIMADRI APARTMENT, SOUTH OFFICE PARA, DORANDA, RANCHI 6-1-2016
733 BHOLA INSTITUTIONAL TRUST 303, MAIN ROAD, LAXMI TOWER HINOO, RANCHI 27-11-2015
734 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW 31-5-2016
735 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW 20-7-2016
736 BHOOMI SOCIAL SERVICES 1 FLOOR NISITH PLAZA JANKIPURAM ALIGANJ LUCKNOW 4-1-2016
737 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW 22-1-2016
738 BHOOMI SOCIAL SERVICES 1ST FLOOR,NISHIT PLAZA,JANKIPURAM LUCKNOW 17-5-2016
739 BIG CONCEPTS FOUNDATION PRIVATE LIMITED BIG CONCEPTS FOUNDATION PRIVATE LIMITED MEISNAM LEIKAI, THANGMEIBAND, IMPHAL - 795001, MANIPUR, INDIA 15-1-2015
740 BIGLEAP SOLUTIONS PRIVATE LIMITED IV TH FLOOR, MARKAZ COMPLEX, INDIRA GANDHI ROAD, PUTHIYARA P.O, CALICUT, KERALA 6-4-2016
741 BIHAR INSTITUTE OF ECONOMIC STUDIES 1, IAS COLONY, KIDWAIPURI, PATNA, BIHAR 24-8-2016
742 BILIPS BHARADWAJ INDIA LIVESTOCK & POULTRY SOLUTIONS PVT. LTD. (BILIPS), 105,1ST FLOOR, SANKLA ARCADE, OPP. LAGU BANDHU MOTIWALE, KARVE ROAD, ERANDWANA,PUNE-411004 24-5-2016
743 BINARY SKILL DEVELOPMENT TRAINING CENTRE 2ND, FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE, ANAND. 2-7-2014
744 BIRBAL ACADEMEY AND PUBLICATIONS PVT LTD 701/A,BRITISH LINGUA,BAHADURPUR BAGICHA, BAZAR SAMITI, RAJENDRA NAGAR, PATNA REGD.OFFICE- BRITISH LINGUA ,PALIKA MARKET,OPP- P.U.LIBRARY,ASHOK RAJPATH,PATNA-800006 19-8-2014
745 BIRBHUMIR GRAMEEN UNNAYAN SOCIETY P.O. SURI, SONATORE PARA, MADRASA ROAD, 1ST FLOOR, H.T. MARKET, DIST. BIRBHUM, 18-3-2015
746 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM 6-10-2016
747 BIRBHUM JAN JAGRITI FOUNDATION 2ND FLOOR, ELECTRIC SUPPLY OFFICE, HATTALA, AHMADPUR, BIRBHUM, WEST BENGAL 12-5-2016
748 BISHNUPUR PUBLIC EDUCATION INSTITUTE VILL-GOPASWARPALLI, PO-BISHNUPUR, DIST-BANKURA, WEST BENGAL. 1-9-2016
749 BISWAAS AT - BAHARANA PO - BAHARANA, VIA - NIALI DIST-CUTTACK PIN-754004 6-5-2016
750 BISWAAS BAHARANA.NIALI,CUTTACK 29-2-2016
751 BITCHEM ASPHALT TECHNOLOGIES LIMITED ANIL PLAZA, ABC, G.S ROAD, GUWAHATI 26-4-2016
752 BIT EDUCATION SOCIETY SCO 14,15 LAJ COMPLEX NEAR LAJ DHARAM KANTA 24-6-2014
753 BITS AND BYTES COMPUTERS 2ND FLOOR, ASHIRWAD TOWERS, BESIDE RAJ THEATRE, G.E. ROAD, RAIPUR, CG 12-11-2013
754 B K P MEDIA VISION PRIVATE LIMITED B 28,SUBHASH CHOWK LAXMI NAGAR, DELHI 27-4-2016
755 BLACK PANTHER GUARDS AND SERVICES PVT LTD 405-SHREEVARDHAN COMPLEX,4-RNT MARG, INDORE 3-1-2014
756 BLIND PEOPLE S ASSOCIATION 132FT RING ROAD, JAGDISH PATEL CHOWK, OPP IIM AHMEDABAD 15-4-2014
757 BLOOM SOLUTIONS PRIVATE LIMITED G2 CHAITANYA PALACE 1-4-879/51/G2 STREET NO. 8 GANDHI NAGAR HYDERABAD 9-12-2016
758 BLOOM SOLUTIONS PRIVATE LIMITED G2, CHAITANYA PALACE, 1-4-879/51/G2, STREET NO. 8, GANDHI NAGAR, HYDERABAD 19-1-2017
759 BLS INSTITUTE OF MANAGEMENT B-8 LONI INDUSTRIAL AREA, MOHAN NAGAR, GHAZIABAD, UTTAR PRADESH 8-5-2014
760 BLUE LOTUS TECHNOLOGIES PVT LTD PLOT # 194,195,FIRST MAIN ROAD ,NEHRU NAGAR , KOTTIVAKKAM,OLD MAHABALIPURAM ROAD (OMR) 2-6-2014
761 BMEDUCATIONSOCIETY E-7/830 AREA COLONY BHOPAL 15-2-2014
762 B M KRISHNA EDUCATIONAL SOCIETY NEAR RAILWAY PHATAK, HANSI ROAD, JULANA 14-10-2015
763 BM MEDICAL AND EDUCATIONAL TRUST 36 5TH MAIN ROAD THILLAI GANGA NAGHAR 1-7-2014
764 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029 14-10-2016
765 BNT CONNECTIONS IMPEX LIMITED 126 NELSON MANICKAM ROAD, 5TH FLLOR AMINJIKKARAI,CHENNAI 600029 15-11-2016
766 BOMBAY RAYON FASHIONS LIMITED D WING, OBEROI GARDEN ESTATES, CHANDIVALI FARMS ROAD, CHANDIVALI, ANDHERI EAST, MUMBAI 5-9-2014
767 BONANZA HUMAN RESOURCE PRIVATE LIMITED BONANZA HOUSE, PLOT NO. M-2,CAMA INDUSTRIAL ESTATE, WALBHAT ROAD,BEHIND THE HUB, GOREGAON (EAST), MUMBAI - 400 063. 21-1-2015
768 BONSON INSTITUTE OF INFORMATION TECHNOLOGY NEAR K.P.INTER COLLEGE, KHIRNI GATE, AGRA ROAD, ALIGARH 17-9-2015
769 BRAINWARE CONSULTANCY PRIVATE LIMITED PLOT Y8, BLOCK EP SECTOR V, SALT LAKE KOLKATA 13-11-2014
770 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA 11-11-2016
771 B R CHAUDHARY TT MAHAVIDYALAYA PRBANDH SAMITTEE 19 JRK , PAKKA BHADWA , VIA - GOLUWALA 29-11-2016
772 BRIDGE AND BUILDING CONSTRUCTION CO PVT LTD ADDRESS- 90B, S.P. MUKHERJEE ROAD, KOLKATA-700026 3-2-2014
773 BRIDGE POINT SKILLS AND NETWORK PRIVATE LIMITED GROUND FLOOR, 1995, SECTOR 45, GURGAON, HARYANA - 122003 13-9-2015
774 BRIGHT CAREER EDUCATION AND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ) 5-4-2016
775 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY CHHAWANI CIRCLE, TONK(RAJ.) 16-3-2016
776 BRIGHT CAREER EDUCATIONAND WELFARE SOCIETY MARATHA COLONY, CHHAWANI CIRCLE, TONK(RAJ.) 6-4-2016
777 BRIGHT FUTURE ACADEMY KETKA ROAD, SHYAMJI MARG, SURAJPUR 13-12-2016
778 BRIGHT FUTURE COM CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B 24-5-2016
779 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED R.O: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 & C.O: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075 10-8-2016
780 BRIGHT FUTURE COM SKILLS PRIVATE LIMITED CORPORATE OFFICE: 17TH SOUTH ROAD, GROUND FLOOR, JADAVPUR, KOLKATA-700 075 REGISTERED OFFICE: 3RD FLOOR PRAGATI PLAZA, RANCHI ROAD, PURULIA 723101 (W.B) 22-6-2016
781 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075 29-9-2016
782 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075 12-9-2016
783 BRIGHT FUTURE DOT COM SKILLS PRIVATE LIMITED REGISTERED ADDRESS: 3RD FLOOR, PRAGATI PLAZA, RANCHI ROAD, PURULIA -723101 ADDRESS FOR CORRESPONDENCE: 17 SOUTH ROAD, SANTOSHPUR, KOLKATA-700075 30-9-2016
784 BRIGHT LIGHT SOCIETY NO 70. T.M.MAISTHRY STREET VANNANTHURAI THIRUVANMIYUR, CHENNAI - 600041 4-11-2013
785 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR, OPP. POLICE STATION, V.P.O. CHHACHHRAULI,DISTT. YAMUNA NAGAR, HARYANA 15-9-2015
786 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION.V.P.O. CHHACHHRAULI. 13-10-2015
787 BRILLIANT EDUCATION SOCIETY MAIN BAZAAR,OPP. POLICE STATION,V.P.O. CHHACHHRAULI,DISTT.YAMUNA NAGAR.HARYANA 21-9-2015
788 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI 13-1-2017
789 BRINDHAVANAM TECHNOLOGIES PRIVATE LIMITED NO.205, VELACHERY MAIN ROAD, CAMP ROAD JUNCTION, SELAIYUR, CHENNAI 18-1-2017
790 B R INSTITUTE OF TECHNOLOGIES KATHAGADA SAHI , PRAKATHNATH LANE, NEAR TERAPANTHI BHAWAN 22-6-2015
791 BRISTLECONE HOSPITALS PVT LTD PLOT NO. 3-4-136/A, BARKATPURA, HYDERABAD 18-1-2017
792 BRITTI PROSIKSHAN PVT LTD 128/18, HAZRA ROAD, KOLKATA 10-11-2013
793 BRM EDUCATION AND WELFARE SOCIETY GAUSHALA ROAD, FATEHABAD, HARYANA. 15-4-2015
794 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR 28-10-2016
795 BROOKLYNN INNOVATIVE RESEARCH AND DEVELOPMENT G2,ANANTHIS APARTMENT,NANGANALLLUR 9-12-2016
796 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP 18-8-2015
797 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PART 201 MANGAL PRABHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE MP 16-9-2015
798 B R P ABHILASHA CONSULTANCY LIMITED LIABILITY PARTNERSHIP 201 MANGAL PRABHAT APPARTMENT 137 MAHADEV TOTLA NAGAR INDORE 3-4-2014
799 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)-421301, DISTT. – THANE, MAHARASHTRA, INDIA 13-1-2017
800 BUDDHA BHUSHAN CHARITIES INSTITUTE MHADA COLONY, HIG 93/1518, OPP. BIRLA COLLEGE, KALYAN (W)DISTT. THANE, MAHARASHTRA 16-1-2017
801 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD CONNAUGHT PLACE, NEW DELHI 14-10-2015
802 BUDDHA EDUCATION FOUNDATION T-22 ATUL GROVE ROAD, CONNAUGHT PLACE ,NEW DELHI 17-11-2015
803 BUL BUL SHAH SOCIETY FOR TECHNICAL EDUCATION BISHAMBER NAGAR NEAR VALLEY ORTHECRAFT 7-1-2016
804 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BARDHAMAN SADAR,WEST BENGAL, 2-9-2016
805 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL, 5-9-2016
806 BURDWAN ALAMGANJ EDUCATION SOCIETY ALAMGANJ,NATUNGANJ,BHARDHAMAN SADAR,WEST BENGAL, 5-9-2016
807 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD, NEAR BIDYARTHI BHAVAB BOY'S SCHOOL ,BIRHATA SRIPALLY BURDWAN 29-11-2016
808 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD NEAR (VIDYARTHI BHAVAN HIGH SCHOOL) BIRHATA,BURDWAN 28-12-2016
809 BURDWAN SWAMI VIVEKANANDA YOUTH EDUCATIONAL INSTITUTE 1 NO ICHLABAD BIRHATA SRIPALLY BURDWAN 9-12-2016
810 BUSY INFOTECH PVT LTD 206-208,MG HOUSE,2 COMMUNITY CENTRE WAZIRPUR IND AREA, DELHI 4-10-2013
811 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE 10-2-2016
812 BVG EDUCATIONAL TRUST NO. 3, 1/6, 1ST CROSS, M C ROAD, VIJAYANAGAR, BANGALORE 25-11-2016
813 BVG INDIA LIMITED BVG HOUSE PREMIER PLAZA, PUNE MUMBAI ROAD, CHINCHWAD 25-11-2016
814 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD 14-9-2015
815 BVS FOUNDATION FLAT NO 89, VENKATESHWARA ENCLAVE, OPP: PRIYADARSHINI HOTEL, SUCHITRA X ROAD, SECUNDERABAD 14-3-2016
816 C4 MEDIA AND COMMUNICATION PVT LTD 2/42 VIPUL KHAND GOMTI NAGAR LUCKNOW 25-7-2016
817 CAD COMPUTER PANT BUILDING,MAHAVIR CHOWK,MZN,U.P 23-12-2016
818 CAD COMPUTER CENTRE A1,GROUND FLOOR & BASEMENT,MAHAVIR CHOWK MUZAFFAR NAGAR.UP 20-7-2016
819 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL,OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI – 27-6-2016
820 CADD CENTRE TRAINING SERVICE PRIVATE LIMITED NO 91,DR.RADHAKRISHNAN SALAI,8TH FLOOR,GEE GEE CRYSTAL, OFFICE NO. 8C & 8D,MYLAPORE,CHENNAI. 22-6-2016
821 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR,RAAHAT PLAZA, NO-172,ARCOT ROAD,VADAPALANI,CHENNAI 1-11-2016
822 CADD SCHOOL PRIVATE LIMITED 196&197,2ND FLOOR, RAAHAT PLAZA, NO-172,ARCOT ROAD, VADAPALANI, CHENNAI 28-9-2016
823 CADD SCHOOL PRIVATE LIMITED 196/197,SECOND FLOOR, RAAHAT PLAZA,NO.172,ARCOT ROAD,VADAPALANI CHENNAI-600026. 23-11-2016
824 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R P C LAYOUT, VIJAYNAGAR, BANGALORE 30-10-2015
825 CADMAXX SOLUTIONS PVT LTD #2095, 5TH MAIN, 9TH CROSS, R.P.C LAYOUT, VIJAYNAGAR, BANGALORE 28-1-2016
826 CADPOINT ENGINEERING SOLUTIONS PVT LTD CADPOINT, PLANTHOTTAM COMPLEX, NEAR KSRTC, MC ROAD, THIRUVALLA, PATHANAMTHITTA, KERALA 5-9-2016
827 CAIT EDUSYS PVT LTD PLOT 9, SECTOR 21, RACHETA CHS, YAMUNA NAGAR, NIGDI, PUNE 14-9-2015
828 CALANCE SOFTWARE PRIVATE LIMITED 201, GREENWOOD PLAZA, GREENWOOD CITY, SECTOR, 45, GURGAON. 11-11-2014
829 CAP FOUNDATION 101, GOWRI SHANKAR RESIDENCY, KAMALAPURI COLONY PHASE-III, HYDERABAD 30-9-2013
830 CAPITAL CNC NO 9, FIRST FLOOR, COROMANDAL TOWN, AMBATTUR INDUSTRIAL ESTATE, CHENNAI 1-7-2014
831 CAPITAL COACHING CENTER NO 103 2ND FLOOR V.V.P NAGAR ARCH LANE THATTANCHAVDY PONDICHERRY 605009. 30-4-2015
832 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO 3,GANDHI STREET, IYYAPPA NAGAR,AYYAPAKKAM,CHENNAI 18-8-2016
833 CAPITAL EDUCATIONAL AND CHARITABLE TRUST NO:3,GANDHI STREET,IYYAPPA NAGAR,AYAPAKKAM,CHENNAI 22-7-2016
834 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP) 30-9-2016
835 CAPITAL INFOLINE MARKETING PRIVATE LIMITED SHOP NO. 4/11, 1ST FLOOR, RAMAGOVIND PALACE, SIRMAUR CHAURAHA, REWA (MP) 14-9-2016
836 CAP WORKFORCE DEVELOPMENT INSTITUTE PVT LTD 102, GOWRI SHANKAR RESIDENCY, 53&54, KAMALAPURI COLONY PHASE-III, HYDERBAD 1-10-2013
837 CARADA AT – RAILWAY STATION ROAD, PO – PARAMANDAPUR, BHAWANI PATNA, DIST – KALAHANDI, ODISHA 14-3-2016
838 CARDIAC RESEARCH AND EDUCATION FOUNDATION 8-2-595/2/B, CARE CONVERGENCE CENTRE, ROAD NO. 10, BANJARA HILLS, HYDERABAD - 500034 2-8-2016
839 CARE EDUCATIONAL AND WELFARE SOCIETY 2624 HUDSON LINE 17-3-2016
840 CARE EDUCATIONAL TRUST 18/492, INDIRA NAGAR LUCKNOW 3-3-2016
841 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU 28-1-2016
842 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, DOGRA HALL, JAMMU 5-1-2016
843 CARE EDUCATIONAL TRUST DOGRA SADAR SABHA, OPP SRML HR SEC SCHOOL, DOGRA HALL, JAMMU 26-8-2016
844 CAREER DISHA ACADEMY 59, RAM CHANDRA PATH ROAD, 20 NO. RAILWAY GATE, ICHAPUR, P.O- NAWABGANJ, DIST- NORTH 24 PARGANAS 22-9-2016
845 CAREERFIT360 PRIVATE LIMITED MIG ,136 GANDHI NAGAR KOCHI 24-5-2016
846 CAREER POINT LIMITED CP TOWER ROAD NO 1 IPIA KOTA (RAJASTHAN)324005 24-6-2015
847 CARE INSTITUTE OF HEALTH SCIENCES PLOT NO 43, H NO 8-25-293/82/F-II-A-43, ROAD NO 7, JUBILEE HILLS FILM NAGAR, HYDERABAD - 500033, TELANGANA, INDIA 21-7-2016
848 CARES NO.21, RAJIV GANDHI NAGAR, CHITTOOT ROAD, TIRUTTANI, TIRUVALLUR(DT),TAMIL NADU. 21-8-2014
849 CARE SECURITY AND ALLIED SERVICES AT-B/13,2ND FLOOR, RUCHIKA MARKET, BARAMUNDA, BHUBANESWAR, ODISHA 14-9-2015
850 CARMINE COMMUNICATIONS A-203, DURIAN ESTATE, NEAR OBEROI JUNCTION, GORGEAON MULUND LINK ROAD, GORGEAON EAST,MUMBAI 17-3-2015
851 CASYON TECHNOLOGY SOLUTION PVT LTD PLOT NO. 59, 2ND FLOOR MODI CHAMBER, NEAR CHETAK BRIDGE, KASTURBA NAGAR, BHOPAL (M.P.) 462023 7-10-2016
852 CATHOLIC CHARITIES CATHOLIC CHARITIES, KHURDA ROAD, JATNI, 14-9-2015
853 CATHOLIC CHARITIES CATHOLIC CHARITIES KHURDA ROAD (JATNI) CATHOLIC CHARITIES P.B NO.18,PIN NO.752050 KHURDA DIST,BHUBNESWAR, ODISHA, INDIA ORISSA STATE, INDIA 6-1-2016
854 CATS EDUTECH PRIVATE LIMITED BALAJI COMPLEX 2ND FLOOR KIRANA OLI KAMPTEE DISTRICT NAGPUR MAHARASHTRA 3-4-2014
855 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO: 702, 7TH MAIN,4TH CROSS, 1ST BLOCK, HRBR LAYOUT, KALYANNAGAR, BENGALURU, KARNATAKA 8-4-2016
856 CAVALIER INDIA TRAINING AND CONSULTING PVT LTD NO.702, 7TH MAIN, 4TH B CROSS, HRBR LAYOUT, 1ST BLOCK, KALYANNAGAR,BANGALORE 4-1-2016
857 CCDS SOCIETY HNO 48-11/3-3/1, ROAD NO 6 KONERU RAMAKRISHNAIAH STREET CURRENCY NAGAR VIJAYAWADA, ANDHRA PRAGESH 11-5-2016
858 CCDS SOCIETY 48-11/3-3/1,ROAD NO-6,KONERU RAMAKRISHNAIAH STREET,CURRENCY NAGAR,VIJAYAWADA, 26-4-2016
859 CCDS SOCIETY 48-11/3-3/1, ROAD NO.6,KONERU RAMAKRISHNAIH STREET,CURRENCY NAGAR,VIJAYAWADA 5-4-2016
860 CELEBRON SOLUTIONS PRIVATE LIMITED CELEBRON SOLUTIONS PRIVATE LIMITED, PLOT NO.171, RS TOWERS, KAVURI HILLS PHASE 2, MADHAPUR, HYDERABAD, TELANGANA 7-1-2015
861 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ 16-11-2016
862 CELICK TECHNOLOGIES PRIVATE LIMITED BARAHIMA MATHIYA, SIDHWALIYA, GOPALGANJ 30-11-2016
863 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, PANNA CHAMBERS, IIND FLOOR, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE 5-8-2016
864 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE, MAHARASHTRA 4-7-2016
865 CENTER FOR ADVANCED TECHNOLOGIES PUNE IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE 10-2-2016
866 CENTER FOR ADVANCED TECHNOLOGIES PUNE 501/B, IIND FLOOR, PANNA CHAMBERS, SHIVAJI ROAD, GHORPADE PETH, NEAR SWARGATE CORNER, PUNE 7-1-2015
867 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA 10-2-2016
868 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR, ODISHA 29-2-2016
869 CENTER FOR CATALYZING COMMUNITY 641, SAHEED NAGAR, BHUBANESWAR 14-3-2016
870 CENTER FOR COMMUNITY ECONOMICS AND DEVELOPMENT CONSULTANTS SOCIETY CENTER FOR COMMUNITY ECONOMICS AND DEVELOPMENT CONSULTANTS SOCIETY (CECOEDECON) FLAT NO A-502 BCM HEIGHTS PU-4 SCM NO 54 INDORE 11-6-2014
871 CENTER FOR COMMUNITY SERVICE AND ALTRUISM 21,RAMCOMPLEX, PUDUPALAYAM MAIN ROAD, CUDDALORE. 6-10-2016
872 CENTER FOR COMMUNITY SERVICE AND ALTRUISM NO.21, RAM COMPLEX PUDUPALAYAM, CUDDALORE. 9-12-2016
873 CENTER FOR INTEGRATED RURAL ANDTRIBAL DEVELOPMENT AT/PO-RANGADHIPA,GOVT COLLEGE ROAD,SUNDERGARH 26-8-2016
874 CENTER FOR MODERN SKILLS DEVELOPMENT INDIA PLOT NO:167,POONGA STREET AVADI CHENNAI 14-9-2015
875 CENTER FOR RURAL EDUCATION DEVELOPMENT AND INNOVATIVE TECHNOLOGIES OF CENTER FOR RURAL EDUCATION DEVELOPMENT AND INNOVATIVE TECHNOLOGIES OF INDIA (CREDIT-I) # 449 J.L.B.ROAD, OPP HARDWICK PU COLLEGE, MYSORE 9-8-2016
876 CENTER FOR VOCATIONAL AND ENTERPRENEURSHIP STUDIES IIPM CAMPUS, CHATTARPUR BHATTIMIES ROAD SATBARI CHANDANHAULA NEW DELHI 25-11-2013
877 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI. 5-4-2016
878 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI. 16-3-2016
879 CENTRAL EDUCATIONAL AND SOCIAL TRUST 9A, TRICHY ROAD, PUDUKKOTTAI, TAMILNADU. 15-9-2015
880 CENTRAL EDUCATIONAL AND SOCIAL TRUST CENTRAL EDUCATIONAL AND SOCIAL TRUST, 9A, TRICHY ROAD, PUDUKKOTTAI. 26-4-2016
881 CENTRAL FOOTWEAR TRAINING INSTITUTE CHENNAI 65/1, GST ROAD, GUINDY, CHENNAI 1-7-2014
882 CENTRAL PERSONNEL SECURITY SERVICES 1006B, ANSAL API CORPORATE PARK , PLOT NO.-7A/1, SECTOR-142, NOIDA-201301 21-7-2014
883 CENTRAL TOOL ROOM AND TRAINING CENTRE BHUBANESWAR A SOCIETY UNDER MINISTRY OF MSME GOVT OF INDIA B-36, CHANDAKA INDUSTRIAL ESTATE, BHUBANESWAR-751024, ODISHA, INDIA 6-12-2016
884 CENTRE FOR ACTION ON DISABLED RIGHTS AND EMPOWERMENT CENTRE FOR ACTION ON DISABLED RIGHTS AND EMPOWERMENT (CADRE) #3-35, 2ND FLOOR, NEAR SRIKRISHNA TALKIES, UPPAL 17-4-2015
885 CENTRE FOR ADVANCE DEVELOPMENT 24, DEEPTI PARISAR INDORE ROAD. UJJAIN 5-8-2016
886 CENTRE FOR ADVANCED RESEARCH AND DEVELOPMENT H-2/195, ARVIND VIHAR, BAGMUGALIA, BHOPAL 11-8-2014
887 CENTRE FOR ALTERNATE RURAL EMPLOYEMENT 19/31,1ST CROSS,THILLAIPURAM,NAMAKKAL 29-6-2016
888 CENTRE FOR DEVELOPMENT ORIENTATION AND TRAINING 96/1 E, 2ND FLOOR, OPP. LOTUS APPT., NEW PATLIPUTRA COLONY, PATNA, BIHAR 31-10-2013
889 CENTRE FOR EDUCATION P.P COMPOUND, PO.- GPO, P.S- HINDPIRI,RANCHI 9-9-2015
890 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,BEFORE GURUNANAK SCHOOL,P.P COMPOUND,P.O-GPO,P.S-HINDPIRI, RANCHI, JHARKHAND 18-9-2015
891 CENTRE FOR EDUCATION CENTRE FOR EDUCATION,NEAR GURUNANAK SCHOOL, P.P COMPOUND,P.O-GPO, P.S-HINDPIRI, RANCHI,JHARKHAND 21-9-2015
892 CENTRE FOR EMPLOYMENT ANDEDUCATIONAL GUIDANCE CEEG CEEG, PYNNAKKODAN'S TOWER, BEHIND BUS STAND, PO; KOTTAKKAL DT: MALAPPURAM, KERALA 7-1-2015
893 CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT OF KARNATAKA CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT OF KARNATAKA(CEDOK) PLOT NO 1(A & B) BELUR INDUSTRIAL AREA BELGAUM ROAD DHARWAD 24-4-2014
894 CENTRE FOR EXCELLENCE IN ORGANIZATION PVT LTD 19, SINGARAVELLAN NAGAR 1ST STREET, NEAR MADURAVOYAL MARKET STOP, MADURAVOYAL, CHENNAI 3-4-2014
895 CENTRE FOR GRASSROOT DEVELOPMENT RESEARCH ACTION VILLAGE MUNJAKHEDI ROAD, POST NARWAR, DEWAS ROAD, NEAR AARADHYA PUBLIC SCHOOL DISTRICT UJJAIN 12-8-2016
896 CENTRE FOR INFORMATION ANDTECHNOLOGY IN RURAL AREAS SELSI, P.O: MOTBUNG, P.S: GAMNOM SAPERMEINA SENAPATI DISTRICT, MANIPUR, INDIA. 8-12-2013
897 CENTRE FOR OVERALL DEVELOPMENT CENTRE FOR OVERALL DEVELOPMENT, PB NO 33, MATHA TOWERS, THAMARASSERY, KOZHIKODE, KERAALA 24-2-2016
898 CENTRE FOR PEOPLES FORESTRY H.NO: 12-13-483/39, STREET NO. 14, LANE-6, NAGARJUNANAGAR COLONY, TARNAKA ,SECUNDERABAD 8-5-2015
899 CENTRE FOR RESEARCH INDUSTRIAL STAFF PERFORMANCE OPP.MANAS BHAVAN,SHYAMLA HILLS,BHOPAL. 3-10-2013
900 CENTRE FOR RURAL EDUCATION AND DEVELOPMENT 301, MAIN ROAD, T.VADIPATTY 18-7-2014
901 CENTRE FOR RURAL HEALTH AND SOCIAL EDUCATION 215/216, KOTTAIYUR ROAD, YELAGIRI HILLS - 635 853 VELLORE DISTRICT, TAMILNADU, INDIA 14-10-2015
902 CENTRE FOR SOCIAL MOBILIZATION AND ACTION D-18, PHASE-2, METRO SATELLITE CITY, HANSPAL, BHUBANESWAR, ODISHA- 752101 10-2-2016
903 CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY CENTRE FOR WOMEN STUDIES ALAGAPPA UNIVERSITY KARAIKUDI TAMILNADU INDIA 22-6-2016
904 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1, INSTITUTIONAL AREA, GANGADHAR MEHER MARG, BHUBANESWAR, DIST-KHURDA 5-12-2016
905 CENTRE FOR YOUTH AND SOCIAL DEVELOPMENT E1 INSTITUTIONAL AREA GANGADHAR MEHER MARG 16-11-2016
906 CENTRE OF IT AND INTERACTIVE LEARNING AT- BIJAYA TALKIES ROAD, PO/DIST- SUNDARGARH 6-1-2016
907 CENTRE OF TECHNOLOGY AND ENTREPRENEURSHIP DEVELOPMENT E 6 SECTOR 21 INDUSTRIAL AREA JAGDISHPUR DISTRICT AMETHI U.P 29-10-2013
908 CENTUM WORKSKILLS INDIA LIMITED 127, NEELAGAGAN, MANDI ROAD, SULTANPUR, MEHRAULI, NEW DELHI 3-10-2013
909 CGS CHARITABLE AND EDUCATIONAL TRUST NO. 7, FIRST FLOOR, D.T.E COLONY, M.G.R ROAD, NANGANALLUR, CHENNAI. 15-9-2015
910 CHAKRAVARTHI HEAVY DRIVING SCHOOL 1/331,PULAVARPALAYAM,PARAMATHI ROAD,NAMAKKAL TK,NAMAKKAL DT. 2-2-2015
911 CHAMPANATH INSTITUTE OF TECHNOLOGY AT/PO-CHAMPESWAR,PS-KANPUR 26-4-2016
912 CHAMPARAN YUVA KALYAN SOCIETY RAMNAGAR WEST CHAMPARAN, BIHAR 21-1-2015
913 CHANAKYA FOUNDATION CHANAKYA NAGAR, KHAGAUL NAHAR, PO- KHAGAUL, 13-1-2014
914 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKRAMARI PO CHANDNICHAKHAT DIST MURSHIDABAD 4-7-2016
915 CHANDNICHAKHAT ASSOCIATION FOR R S H ADVANCEMENT KANKAMARI,PO-CHANDNICHAKHAT,PS-SUTI,DIST-MURSHIDABAD 11-1-2016
916 CHANDULAL CHANDRAKAR MEMORIAL HOSPITAL CM MEDICAL COLLEGE AND HOSPITAL, KACHANDUR, DURG 17-9-2015
917 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966;P.B.NO.20;ARCHBISHOP'S HOUSE,CHANGANACHERRY,686101,KOTTAYAM,KERALA,INDIA. 6-10-2016
918 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY, REG.NO.K/1966,P.B. NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686 101, KERALA , INDIA 4-8-2016
919 CHANGANACHERRY SOCIAL SERVICE SOCIETY CHANGANACHERRY SOCIAL SERVICE SOCIETY,REG.NO.K.44 OF 1966,P.B.NO.20,ARCHBISHOPS HOUSE, CHANGANACHERRY, 686101, KERALA,INDIA 28-9-2016
920 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703 9-6-2016
921 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD D’ WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400705 28-9-2016
922 CHANNEL HR AND SKILL DEVELOPMENT PVT LTD WING, 88-A, VASHI PLAZA, SECTOR NO-17, VASHI, NAVI MUMBAI- 400703 23-5-2016
923 CHARITHA COMPUTERS D NO:16-7-136,2ND MAIN ROAD,RAMAMURTHY NAGAR, NELLORE,ANDHRA PRADESH 16-11-2016
924 CHARITIES AID FOUNDATION INDIA 136, NO:136, IIND FLOOR VISHAL HOUSE, JAMRUDPUR 6-9-2015
925 CHARU SHIKSHA SAMITEE C-8, NEHRU NAGAR , BHOPAL,MADHYA PRADESH 20-7-2016
926 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM, NATIONAL HIGHWAY NO.8, VILLAGE MOGAR, DISTRICT ANAND, GUJARAT 14-3-2016
927 CHARUTTAR EDUCATION AND NAVRACHANA TRUST UDAY FARM,NATIONAL HIGHWAY NO 8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT 5-8-2016
928 CHARUTTAR EDUCATION AND NAVRACHANA TRUST ANAND UDAY FARM,NATIONAL HIGHWAY NO.8,VILLAGE MOGAR,DISTRICT ANAND,GUJARAT 17-5-2016
929 CHARVAKA SENIOR CITIZENS TRUST CHARAVKA BHAVAN, MALYALA VILLAGE, CHANDURTHI MANDAL, RAJANNA SIRICILLA DISTRICT TELANGANA STATE 29-12-2016
930 CHAUDHARY SURAJ SINGH MEMORIAL TRUST VILLAGE AND POST JAGEER, MAINPURI,U.P 6-9-2015
931 CHAUSON EDUCATION SOCIETY NO.14, MLA LAYOUT, 4TH BLOCK, RMV 2ND STAGE, NEW BEL ROAD, BANGALORE 5-9-2014
932 CH BHAGMAL SEWA SAMITI HN 2737 URBAN ESTATE JIND 21-12-2016
933 CHECKMATE SERVICES PVT LTD GF- 6 TO 9, AMAAN TOWERS, SUVAS COLONY, FATEHGUNJ MAIN ROAD, VADODARA, GUJARAT, INDIA 23-10-2013
934 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DARUL ISLAM,PARAVANADUKKAM P.O KASARGOD,KERALA-671317 9-5-2016
935 CHEMNAD ALIYA ARABIC COLLEGE COMMITTEE DELI CHEMNAD ROAD, PARAVANDUKKAM,KASARKOD-671317 6-4-2016
936 CHENNAIS AMIRTA INSTITUTE OF HOTEL MANAGEMENT NO:15/25, 3RD CROSS STREET, OPP : M.C RAJA MENS HOSTEL, WEST CIT NAGAR, NANDANAM, CHENNAI 27-6-2016
937 CHETANA RURAL DEVELOPMENT TRUST A/P: NEAR BANASHANKARI TEMPLE, H.NO.2424 ZIDDI GALLI MUNAVALLI. TAL: SAVADATTI, DIST: BELAGAVI 14-9-2015
938 CHETHANA INTEGRATED DEVELOPMENT SOCIETY KAYAMKULAM P.O., ALAPPUZHA, KERALA, INDIA 15-6-2016
939 CHHATRAPATI SHIVAJI MAHARAJ BAHUUDESHIY SEVABHAVI SANSTHA DHAR AT-DHAR,POST-GOJEGOAN TQ. AUNDHA NAGNATH ,DIST-HINGOLI (MAHARASHTRA) INDIA 431509 9-4-2015
940 CHHATTISGARH GRAMIN VIKAS SANSTHA NEAR SAHANI PETROL PUMP BAITAL SINGH GALI HATKACHOURA JAGDALPUR 13-9-2015
941 CHHATTISGARHPROFESSIONALEDUCATIONANDNTWORKPVTLTD CHHATTISGARH PROFESSIONAL EDUCATION AND NETWORK PVT. LTD. , NIMSE ALTERNATIVE MEDICAL COLLEGE CAMPUS, LORMI, DISTT - MUNGELI C.G. 6-9-2015
942 CHHINMASTIKA EDUTECH 7-CIVIL LINES OPP WAR MEMORIAL DHARAMSHALA HIMACHAL PRADESH 8-9-2014
943 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH 15-11-2016
944 CHIKITSABRATI UDYOG VILL-KOTALGHATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH 30-11-2016
945 CHIKITSABRATI UDYOG VILL-KOTALGHATA,POST OFFICE- KUSHBERIA( VIA ULUBERIA) DIST- HOWRAH. 14-9-2016
946 CHIKITSABRATI UDYOG VILL-KOTALGNATA, P.O-KUSHBERIA,ULUBERIA, HOWRAH 5-9-2016
947 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM 11-3-2016
948 CHILARAI KRISHI BIKASH SAMITY A K AZAD ROAD,DHUBRI,ASSAM 15-9-2015
949 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO.: E-97A, KONDLI DELHI 11-5-2016
950 CHILDREN AND WOMEN GRIVENCE RESEARCH FOUNDATION H.NO- E97A, KONDLI, DELHI 11-1-2016
951 CHIMERA GENTEC PVT LTD 34, KNOWLEDGE PARK-1 GREATER NOIDA 13-10-2014
952 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR 9-12-2016
953 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , PIN -711303,STATE-WEST BENGAL 14-10-2016
954 CHIRANABIN VILL- PARBAKSHI , P.O.- BAKSHI , P.S.- JOYPUR , 3. PIN:- 711303 21-9-2016
955 CHIRANJI LAL GUPTA AND SONS PRIVATE LIMITED NO. 32A, BLOCK C4-A, JANAKPURI 17-4-2014
956 CHITROTPLA DIGITAL PRIVATE LIMITED C-3 SECTOR-3 DEVENDRA NAGAR RAIPUR- 30-11-2016
957 CHITROTPLA SEWA SANSTHAN C-3, SEC-3, DEVENDRA NAGAR, DIST. - RAIPUR (C.G.) M.NO. - 7773888200,7771007940 13-1-2017
958 CH K R SWAMI EDUCATIONAL SOCIETY HANUMANGARH ROAD, SAGAR PALACE BUILDING NEAR FLY OVER, ABOHAR 5-2-2015
959 CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY CHOTANAGPUR CRAFT DEVELOPMENT SOCIETY RAOD NO 3 HAWAI NAGAR RANCHI 17-1-2017
960 CHOUDHURY AND CHOUDHURY INDIA LIMITED 1, RAJKAMAL, OPP UNIVERSITY CAMPUS, C.S.T. ROAD, KALINA, MUMBAI 14-9-2015
961 CHOUHAN EDUCATION SOCIETY 46/6 SOUTH T.T. NAGAR BHOPAL 13-6-2016
962 CH RAMESH CHAND CHARITABLE TRUST MIRPUR,TRONICA CITY P.O.:-MANDOLA DIST.:- GHAZIBAD 201102 12-10-2013
963 CHRISTIAN TRUST OF INDIA CTI P.O.BOX - 55, LINGSIPHAI VILLAGE, CHURACHANDPUR DISTRICT, MANIPUR 21-12-2013
964 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR,BERHAMPORE 14-10-2015
965 CHUANPUR SAPTAPARNI LOKNATHPALLY,CHUANPUR BERHAMPORE 28-9-2015
966 CHUANPUR SAPTAPARNI 43,LOKNATHPALLY,CHUANPUR 11-9-2015
967 CHUNYAPUR NABA MUKUL SEBA SAMITY VILL - CHUANPUR SARAT PALLY, PO - CHALTIA, PS - BERHAMPUR, DIST - MURSHIDABAD, WEST BENGAL 2-9-2016
968 CIPET CIPET DCRUST CAMPUS 5OTH MILE STONE NH-1 MURTHAL SONIPAT, HARYANA 22-12-2013
969 CISS AND KUSHWAH INFRASTRUCTURE PVT LTD 701, CRYSTAL PARADISE MALL, VEERA DESAI, ANDHERI WEST, MUMBAI, 400053 3-4-2014
970 CISSL 301, A-WING, MUKTI FOUNDATION, 141-A, MODEL TOWN, 4 BUNGALOWS, ANDHERI (W), MUMBAI. 8-11-2013
971 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19 ,KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA (UP) 8-3-2016
972 CITY EDUCATIONAL AND SOCIAL WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, PLOT NO.-19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP) 2-3-2016
973 CITY EDUCATIONAL AND WELFARE SOCIETY NOIDA INSTITUTE OF ENGINEERING & TECHNOLOGY, 19, KNOWLEDGE PARK-2, INSTITUTIONAL AREA, GREATER NOIDA(UP) 8-3-2016
974 CITY MAKERS PRIVATE LIMITED A-52, NARMADA APARTMENT, EXHIBITION ROAD 5-1-2016
975 CKG FOUNDATION A-1/122,SEWADHAM ROAD, MANDOLI,DELHI-110094 11-1-2016
976 CLAN INFOTECH PVT LTD B-20, SECTOR-16, NOIDA 4-12-2014
977 CLAN LEARNING PRIVATE LIMITED 1ST FLOOR B-20 SECTOR 16 NOIDA U.P. 21-8-2014
978 CLAT MENTORS INDIA PVT LTD 2ND FLOOR , UDAY TOWER ,NEHRU ROAD ,BHILWARA 14-9-2015
979 CLAT MENTORS INDIA PVT LTD 201 , 2ND FLOOR , UDAY TOWER , NEHRU ROAD , BHILWARA 14-10-2015
980 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI 5-8-2016
981 CLEAR MAZE CONSULTING PRIVATE LIMITED 133, 13TH FLOOR , JOLLY MAKER CHAMBERS - II 225, VINAYAK KUMAR SHAH MARG NARIMAN POINT, MUMBAI 11-8-2016
982 CL EDUCATE LIMITED 15 A, KNOWLEDGE PARK - II, GREATER NOIDA 30-9-2013
983 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE 10A CHAPEL ROAD HASTINGS KOLKATA 18-8-2016
984 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE, 10A CHAPEL ROAD, HASTINGS, KOLKATA, WEST BENGAL 15-9-2016
985 CLIFFORD FACILITY SERVICES PVT LTD SARAN HOUSE;10 A CHAPEL ROAD;HASTINGS;MOBILE NO:-9830853384 14-9-2015
986 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI 26-4-2016
987 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO. 104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI 4-4-2016
988 CLR FACILITY SERVICES PRIVATE LIMITED UNIT NO.104, TIMMY ARCADE, MAKWANA ROAD, MORAL NAKA, ANDHERI (EAST), MUMBAI 27-4-2016
989 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI 28-10-2016
990 CMCORPS INTEGRATED SERVICES PRIVATE LIMITED 906 VIKRAM TOWER 16 RAJENDRER PLACE NEAR SIDDHARTHA HOTEL NEW DELHI 9-12-2016
991 CMC SKILLS PVT LTD 133, 13TH FLOOR, JOLLY MAKER CHAMBERS II, 225 VINAYAK KUMAR SHAH MARG, NARIMAN POINT 11-5-2016
992 CMTES INFORMATICS PVT LTD NO 60, LUZ CHURCH ROAD, OPP. NAGESWARA RAO PARK, MYLAPORE CHENNAI 12-11-2014
993 CMX SKILL DEVELOPMENT PVT LTD CMX SKILL DEVELOPMENT PRIVATE LIMITED 94 B, HINDI PARK, SHYAM LAL ROAD, DARYA GANJ, OPP HINDI PARK,, NEW DELHI, DELHI, INDIA 25-7-2016
994 CNC INFOTECH SKILL DEVELOPMENT PVT LTD CORP. OFFICE : CNC INFOTECH SKILL DEVELOPMENT PVT.LTD., 3/322, SECTOR-3, MALVIYA NAGAR, JAIPUR 302017 30-1-2014
995 CNT COMPUTER EDUCATION B-552, NEAR RASTOGI INTER COLLEGE, LAJPAT NAGAR, MORADABAD, UTTAR PRADESH. 20-1-2015
996 COD NERC 3RD FLOOR, LALAT CHAMBER, NEAR SOLOMON’S CAVE, TEMPLE SQ, ZODIN ROAD 29-3-2014
997 COFFEE DAY GLOBAL LIMITED CAFE COFFEE DAY ( A DIVISION OF ABCTCL) COFFEE DAY SQUARE,VITTAL MALLYA ROAD, BANGALORE 22-6-2015
998 COHESION FOUNDATION TRUST 6-SEJAL APARTMENTS, BEHIND NAVNEET PUBLICATIONS, GURUKUL ROAD, MEMNAGAR 12-5-2016
999 COIGN CONSULTANTS PRIVATE LIMITED S11,3RD FLOOR,BALLAD ESTATES,TARNAKA, NEAR TARNAKA X ROADS,SECUNDERABAD,HYDERABAD. 6-4-2015
1000 COIMBATORE INDUSTRIAL INFRASTRUCTURE ASSOCIATION 8/4, RACE COURSE ROAD,2ND FLOOR,NEAR COFFEE DAY COIMBATORE-641 018 24-6-2014
1001 COIMBATORE INSTITUTE OF FASHION TECHNOLOGY COIMBATORE INSTITUTE OF FASHION TECHNOLOGY # C-55, 1ST FLOOR, SVV ARCADE, 4TH CROSS, THILLAINAGAR MAIN ROAD, TRICHY – 620 018. 6-9-2015
1002 COLLABERA TECHNOLOGIES PRIVATE LIMITED 702, 7TH FLOOR IVORY TERRACE OPP CIRCUIT HOUSE, R. C. DUTT ROAD, BARODA, GUJARAT - 390 005 4-12-2014
1003 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD 14-10-2015
1004 COMMANDO SECURITY GUARD 3-1-2(1D)A-2, MOTIVALLEY, TRIMULGHERRY, SECUNDERABAD 16-9-2015
1005 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA,PIN-766001 6-4-2016
1006 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA, 16-3-2016
1007 COMMERCIAL AGRICULTURE AND RURAL AREA DEV AGENCY HO-RAILWAY STATION ROAD,PO-PARAMANANDPUR ,VIA-BHAWANIPATNA,KALAHANDI,ODISHA 3-3-2016
1008 COMMUNITY ASSOCIATION FOR RURAL DEVELOPMENT SOCIETY NO/7. E.V.R STREET, VADIVEL NAGAR, KANCHIPURAM TALUK & DISTRICT. CELL : 9364320785 8-5-2015
1009 COMMUNITY AWARNESS RURAL EDUCATIONAL TRUST 6/118,KALANGANI NAMAKKAL (DT) 11-11-2014
1010 COMMUNITYDEVELOPMENT AND WELFARESOCIETY CODWELSOCIETY ARIKATHOTA PO VILL RAMABHADRAPURAM MANDALAM VIZAYANAGARAM DIST ANDHRAPRADESH INDIA 535579 23-2-2016
1011 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TALUK VELLORE DISTRICT TAMILNADU 2-9-2016
1012 COMMUNITY DEVELOPMENT TRUST 202 BAZZAR STREET SHOLINGHUR WALAJAH TK VELLORE DT 12-8-2016
1013 COMMUNITY FRIENDLY MOVEMENT CFM 5K-1ST FLOOR, JUNGI HOUSE, SHAHPUR JAT, NEW DELHI, INDIA 13-11-2014
1014 COMMUNITY HEALTH HOUSING AND SOCIAL EDUCATION THOMAIYAR STREET, PANNUR VILLAGE AND POST, TIRUVALLUR DISTRICT, 8-9-2014
1015 COMMUNITY RECONSTRUCTION OF SOCIAL SERVICE NO: 8 10TH EAST CROSS ROAD, GANDHI NAGAR,VELLORE. 6-9-2015
1016 COMMUNITY WELFARE ORGANISATION 9-B INDRAPURI INFRONT OF BHEL GATE NO 1 11-9-2015
1017 COMPLETE ALTERNATIVE PARALLEL SOLUTION CAPS 5-D, PKT-4, EHS FLATS MAYUR VIHAR-3 23-2-2016
1018 COMPUTEC SOCIETY FOR ELECTRONICS AND SOFTWARE TECHNOLOGY JAIN MANDIR ROAD 23-12-2016
1019 COMPUTER HOUSE 3/5-5 C EXTENSION 1ST FLOOR VIJAY KHAND GOMTI NAGAR LUCKNOW 22-1-2014
1020 COMPUTER POINT EDUCATIONAL SOCIETY H NO 6-186/C MAIN ROAD TOOPRAN DIST MEDAK ANDHRA PRADESH 3-1-2014
1021 COMPUTER POINT LTD 1/1B UPPER WOOD STREET KOLKATA 16-11-2015
1022 COMPUTER POINT LTD 1/1B UPPER WOOD STREET,KOLKATA, WEST BENGAL - 700017 10-12-2015
1023 COMTECH INFO SOLUTIONS PRIVATE LIMITED REGISTERED OFFICE: KHAWAJA BAGH BARAMULLA. ADMINISTRATIVE OFFICE : KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR 21-12-2016
1024 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR 30-8-2016
1025 COMTECH INSTITUTE OF TECHNOLOGY 3RD FLOOR KHIDMAT COMPLEX THE BUND REGAL LANE SRINAGAR JAMMU AND KASHMIR 14-10-2016
1026 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA 9-12-2016
1027 COMTECH IT EDUCATION TRUST HYDER COMPLEX NEAR FIRE SERVICES LANE MADINA MARKET BARAMULLA 1-11-2016
1028 CONCEPTS AND SOLUTIONS MARKETING PRIVATE LIMITED 1529/13, GOVINDPURI, KALKAJI, NEW DELHI 9-4-2015
1029 CONCEPT SOCIETY CENTRE OF NEEDY, CREATIVE EXPERIMENT AND PARTICIPATORY TECHNIQUES SOCIETY, 101, AHILYA NAGAR, ANNAPURNA ROAD, INDORE - 452009 - MADHYA PRADESH 7-9-2016
1030 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI 14-7-2016
1031 CONCORD INSTRUMENTS PRIVATE LIMITED PLOT NO.2987 V BLOCK IST ANNANAGAR CHENNAI 1-6-2016
1032 CONFEDERATION OF REAL ESTATE DEVELOPERS ASSOCIATIONS OF INDIA NATIONAL SECRETARIAT, 703, ANSAL BHAWAN, 16, KASTURBA GANDHI MARG,NEW DELHI 11-11-2014
1033 CONFEDERATION OF WOMEN ENTREPRENEURS COWE H. NO. 6-3-657/F1, KAPADIA LANE, SOMAJIGUDA, HYDERABAD 500 082, INDIA 3-4-2014
1034 CONFIDENCE FACTORY 3RD FLOOR,NB TOWER,NAYAPALLI,BHUBANESWAR, 5-2-2016
1035 CONGREGATION OF THE SISTERS OF SAINT ANNE TIRUCHIRAPPALLI COHAJ HOSPITAL-SAT UNIT, KAMESWARAM, THIRUPOONDI VIA, KILVELUR TALUK, NAGAPATTINAM DIST, TAMILNADU, INDIA 19-8-2014
1036 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA 23-11-2016
1037 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK SARASWATI VIHAR AJABPUR KHURD DEHRADUN UTTARAKHAND INDIA 6-12-2016
1038 CONNECT ONE FACILITY SERVICE PRIVATE LIMITED C-BLOCK, SARASWATI VIHAR, AJABPUR KHURD, DEHRADUN UTTARAKHAND, INDIA 1-11-2016
1039 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1170,PKT3,SECTOR-19, AKSHARDHAM APARTMENTS, DWARKA, NEW DELHI 14-3-2016
1040 CONSERVATION CENTRE OF HERBS YOGA AND NATUROPATHY 1107/1170, POCKET-3 SECTOR- 19 DWARKA 15-9-2015
1041 CONSORTIUM FOR TRAINING RESEARCH AND DEVELOPMENT AE 641, SECTOR 1, SALT LAKE ,NEAR AE MARKET (KWALITY PARK) , KOLKATA 29-12-2016
1042 CONSTRUCTION INDUSTRY DEVELOPMENT COUNCIL 801, 8TH FLOOR, HEMKUNT CHAMBERS, 89, NEHRU PLACE,NEW DELHI-110019 19-5-2014
1043 CONSTRUCTION INDUSTRY VOCATIONAL TRAINING COUNCIL PLOT NO. 18, ANAND INDUSTRIAL ESTATE, MOHAN NAGAR, GHAZIABAD-201007 8-12-2013
1044 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA 31-8-2016
1045 CONSULTING MANAGEMENT INCORPORATE PRIVATE LIMITED DIMPLE COURT 1ST FLOOR, 26 SHAKESPEARE SARANI, KOLKATA 5-9-2016
1046 COOCH BEHAR HIMALAYAN NATURE DEVELOPMENT SOCIETY KHALASHI PATTY NEAR SHIVMANDIR,COOCH BEHAR,WEST BENGAL,INDIA-736101 5-2-2016
1047 COODU 15-A KONGU NAGAR EAST, RAMANATHAPURAM, COIMBATORE - 45 5-2-2015
1048 COODU TRUST H.83.R M.COLONY DINDIGUL 28-9-2015
1049 COODU TRUST H.83.R M.COLONY DINDIGUL 18-9-2015
1050 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA 25-11-2016
1051 COREEDUADVANTAGES PROJECTS ANDTECHNOLOGIES PVT LTD 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA 28-9-2015
1052 CORE EDUCATION AND TECHNOLOGIES LTD UNIT NO. 1-4,VLDG NO. 4, SECTOR III, MILLENIUM BUSINESS PARK, MAHAPE, NAVI MUMBAI-400710 25-10-2013
1053 COREMAGE ACADEMY 512/518, INDRAPRASTH COMPLEX, PANCHESHWAR TOWER ROAD, JAMNAGAR, GUJARAT 12-9-2016
1054 CORE MIND TECHNOLOGIES PVT LTD 12/56, KANCHI NILAYAM, 1ST FLOOR, SOUTH USMAN ROAD, T.NAGAR, CHENNAI. 15-9-2015
1055 CORE WELLNESS LIMITED B WING, 101-102, REMI BIZ COURT, VEERA DESAI ROAD, ANDHERI WEST, MUMBAI 400 053 21-10-2014
1056 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93-A, NOIDA, UTTAR PRADESH 1-6-2016
1057 CORRIGO CONSULTANCY PRIVATE LIMITED FLAT NO 0983, ATS VILLAGE, TAJ EXPRESSWAY, SECTOR 93A, NOIDA 23-6-2016
1058 CORSENDONK CONSULTANTS PRIVATE LIMITED PLT NO 73, SURVERY NO 25, VISHALINAGAR. MADINAGUDA HYDERABAD 500050 30-1-2016
1059 CORUS TECHNOSOFT PRIVATE LIMITED A-118, SAHID NAGAR, BHUBANESWAR 30-1-2014
1060 CORVUS TECH PVT LIMITED 3RD FLOOR, GALAXY HOUSE , 12/483, MACROBERTGANJ KANPUR 8-9-2014
1061 COSMOS MANPOWER PVT LTD B 183/184,SECTRO-26,GIDC,GANDHINAGAR,GUJARAT 26-8-2014
1062 COSTFORD CENTRE OF SCIENCE AND TECHNOLOGY FOR RURAL DEVELOPMENT AYYANTHOLE, THRISSUR-3 27-7-2016
1063 COUNCIL OF EDUCATION AND DEVELOPMENT PROGRAMMES OFFICE NO. 3, SAI CLASSIC, NEXT TO GAVANPADA BUS STOP, GAVANPADA, MULUND (EAST), MUMBAI 24-6-2014
1064 COVALENCY TECHNOLOGIES NO. 4/98, FIRST FLOOR, CHAVADI ST, PALLAVARAM, CHENNAI - 600043. 7-1-2015
1065 COVERPRO SECURITY SOLUTIONS LLP 114, STERLING CENTER, OPP HOTEL AURORA TOWERS, MG ROAD, PUNE CAMP, PUNE. 411001 30-1-2014
1066 CPIT EDUTECH PRIVATE LIMITED 126 GANDHI COLONY, OPP. ITI COLLEGE, RANIA ROAD, SIRSA (HRY.) 23-12-2013
1067 CPS SECURITY PRIVATE LIMITED 1006B ANSAL API CORPORATE PARK, PLOT NO.7A/1 SECTOR 142 NOIDA-201301 25-8-2014
1068 CRADLE LIFESCIENCES PVT LTD C A/5, P.C.COLONY,KANKARBAGH,PATNA 17-10-2013
1069 CRADLE OF MANAGEMENT EDUCATIONAL SOCIETY 988/2, MANSA RAM ENCLAVE, NEAR OBEROI FARM, KAPASHERA, NEW DELHI 23-12-2016
1070 CRAYONS ACADEMY FOR SKILLS EXCELLENCE A-99, SECTOR 58, NOIDA 26-4-2016
1071 CRAYONS ACADEMY FOR SKILLS EXCELLENCE LLP 116, UDAY PARK, NEW DELHI, SOUTH DELHI 16-3-2016
1072 CREATION INDIA SOCIETY SA 15/138 B-1 MAWAIYA SARNATH VARANASI U.P. 30-10-2015
1073 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II BHOPAL 14-9-2015
1074 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, OPP VARENYAM BIKE, BHOPAL 4-3-2016
1075 CREATIVE BRAINS EDUCATIONAL AND WELFARE SOCIETY F-2/6, AMBAR COMPLEX, MP NAGAR, ZONE-II, BHOPAL 23-2-2016
1076 CREDIT I 449 JLB ROAD OPP HARDWICK PRE UNIVERSITY COLLEGE MYSORE 16-6-2016
1077 CRESCENTO IT SERVICES PRIVATE LIMITED F-219, 2ND FLOOR, OPP LANE TO SPENCERS , BESIDE BUSY BEES SCHOOL, VIVEKANANDA NAGAR COLONY, KUKATPALLY. 24-6-2015
1078 CRISTY WELFARE CHARITABLE TRUST 52C, 1ST FLOOR, KRISHNA COMPLEX HSANPUR VILLAGE PATPARGANJ 28-9-2015
1079 CRISTY WELFARE CHARITABLE TRUST KRISHNA COMPLEX 52C, 1ST FLOOR, HASANPUR VILLAGE PATPARGANJ EAST DELHI 18-9-2015
1080 CROSSROADS INDIA ASSISTANCE PVT LTD X-1,SECOND FLOOR,OKHLA INDUSTRIAL AREA,PHASE-2 22-11-2014
1081 CRUX MANAGEMENT SERVICES PVT LTD 4TH FLOOR, LIFE STYLE BUILDING, MY HOME TYCOON, KUNDAN BAGH, BEGUMPET, HYDERABAD 16 25-8-2014
1082 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I, GREATER NOIDA - 201308 6-4-2016
1083 CSB EDUCATION AND SKILL PRIVATE LIMITED 29-D KNOWLEDGE PARK - I GREATER NOIDA - 201308 26-4-2016
1084 CSC COMPUTER EDUCATION PVT LTD 153 & 155 SOUTH WEST BOAG ROAD, T.NAGAR, CHENNAI.600017 TAMIL NADU 11-6-2014
1085 CSC SHANKARPUR VILL-SHANKARPUR PO-BAIJUPUR TEH-SHAHABAD DIST-HARDOI UTTAR PRADESH 15-9-2015
1086 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL AT POST RAHNAL TAL BHIVANDI DIST THANE 2-12-2016
1087 CSS ANANT SHIKSHAN GRAMVIKAS MANDAL 001 KANCHAN COMPOUND RAHNAL TAL BHIVANDI DIST THANE 7-9-2016
1088 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE 5-4-2016
1089 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE 14-3-2016
1090 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE 8-1-2016
1091 CSTED CENTRE FOR SCIENCE & TECHNOLOGY ENTREPRENEURSHIP DEVELOPMENT (C-STED) OLD TALUK OFFICE BUILDING, PUTHIYARA P.O, KOZHIKODE 19-2-2016
1092 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI 14-10-2015
1093 CST EDUCATIONAL AND CHARITABLE TRUST 87C,MUTHANANTHAPURAM 1 ST STREET KOVILPATTI 23-10-2015
1094 CTC COMPUTER EDUCATION NO. 39, EAST RAJA STREET, MAMALLAPURAM, KANCHEEPURAM DISTRICT, TAMIL NADU - 603104 2-2-2015
1095 C TEC EDUCATIONAL SOCIETY SCF 34, PHASE 7, SAS NAGAR (PUNJAB) 21-11-2013
1096 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, 7TH ST, K.K. NAGAR, TEACHERS COLONY MAIN ROAD, NANGANALLUR, CHENNAI. 17-9-2015
1097 CTL CHARITABLE AND EDUCATIONAL TRUST CTL (COVALENCY TECHNOLOGIES) CHARITABLE & EDUCATIONAL TRUST, NEW NO. 1, K.K.NAGAR 7TH ST, TEACHER'S COLONY MAIN ROAD, NANGANALLUR, CHENNAI. 28-9-2015
1098 C TRACK COMPUTERS PLOT NO. HI-5, IT PARK, ROAD NO. 4, BEHIND CITY MALL, IPIA, KOTA 30-1-2014
1099 CULTURAL ACADEMY FOR PEACE DOOR NO. 41/1964 FIRST FLOOR, PIYOLLI ROAD ERNAKULAM NORTH COCHIN 15-9-2015
1100 CYBER ACADEMY 1ST FLOOR,NISHIT PLAZA,C-66,JANKIPURAM LUCKNOW 16-9-2015
1101 CYBER ACADEMY 47, RAINA MARKET, COMPANY BAGH, NAWABGANJ, KANPUR 15-9-2015
1102 CYBERMAX ENTERPRISES 17/1,MADAN MOHAN MALVIYA MARG, NEAR P.K. BHAWAN, HAZRATGANJ, LUCKNOW 26-2-2016
1103 CYBERSOFT AND SOFTWARES SOLUTIONS PRIVATE LIMITED PLOT. NO-3115, LEVEL -2 , INDUSTRIAL AREA PHASE-2, 6-9-2015
1104 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD SUNDER NAGAR,NEAR BASTI JODHEWAI CHOCK.LUDHIANA 11-8-2016
1105 CYBER STAR EDUCATIONAL SOCIETY 9-A,MAIN ROAD,NEAR BASTI JODHEWAL,SUNDAR NAGAR ,LUDHIANA 7-9-2016
1106 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO-H 3/47(FIRST FLOOR), MAHAVIR ENCLAVE, NEW DELHI 6-9-2015
1107 CYCLOPS SECURITY AND ALLIED SERVICES PVT LTD OFFICE NO- H-3/47(FF),MAHAVIR ENCLAVE,NEW DELHI 14-9-2015
1108 DAGAR INDUSTRIES PRIVATE LIMITED H-1-47 OLD RIICO INDUSTRIAL AREA BAGARU JAIPUR 5-1-2017
1109 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH 20-7-2016
1110 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, MADHYA PRADESH 14-3-2016
1111 DAKSH FOUNDATION 290/D, NAPIER TOWN, JABALPUR, M.P. 10-2-2016
1112 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI – 110049 14-9-2015
1113 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI 17-1-2017
1114 DAKSYA ACADEMY PRIVATE LIMITED 252, A/2,2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI 27-6-2016
1115 DAKSYA ACADEMY PRIVATE LIMITED 252-A/2, 2ND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI-110049. 18-1-2017
1116 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI 18-8-2016
1117 DAKSYA ACADEMY PVT LTD 252, A/2, SECOND FLOOR, MOHIT HOUSE, SHAHPUR JAT, NEW DELHI 8-9-2016
1118 DALAL GLOBAL TRUST A-206 SOM APARTMENT PLOT NO.24 SECTOR 6 DWARKA NEW DELHI 21-7-2016
1119 DALAL GLOBAL TRUST A 206 SOM APARTMENT PLOT NO. 24 SECTOR 6 DWARKA NEW DELHI 22-7-2016
1120 DALAL GLOBAL TRUST B 805, DHAULADHAR APARTMENT, PLOT N0-15, SECTOR-5,DWARKA, NEW DELHI 19-7-2016
1121 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UTTAR PRADESH 24-5-2016
1122 DALIMSS SUNBEAM EDUCOMP LIMITED B 38/8-6 A, RAGHUNATH NAGAR, MEHMOORGANJ, VARANASI, UP 24-5-2016
1123 DALIT SOLIDARITY PEOPLES HOUSE NO. 181, POCKET-1, SECTOR-1, DWARKA, NEW DELHI- 110075 14-10-2016
1124 DALIT SOLIDARITY PEOPLES 151, POCKET-1, SECTOR-1, DWARKA, NEW DELHI 21-9-2016
1125 DALMIA BHARAT GROUP FOUNDATION 12TH FLOOR, HANSALAYA BUILDING, 15 BARAKHAMBA ROAD, NEW DELHI 19-8-2014
1126 DALVI EDUCATIONAL AND CHARITABLE TRUST 2/9, MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST,MUMBAI 14-3-2016
1127 DALVI EDUCATIONAL AND CHARITABLE TRUST MAVLANKAR NAGAR, DATTA MANDIR ROAD, MALAD EAST, MUMBAI 3-3-2016
1128 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1-759-2, GORANTLA ROAD, NEAR POTHURAJU KALUVA, BALARAM COLONY, ONGOLE, PRAKASAM DIST, ANDHRAPRADESH 11-8-2015
1129 DANNASI PRAKASAMAIAH FOUNDATION SOCIETY 1/759-2, GORANTLKA ROAD, NEAR POTHURAJU KALUVA, ONGOLE, PRAKASAM DISTRICT, ANDHRA PRADESH 3-9-2015
1130 DANTOUR VIKAS SARVAJINIK PUNYARTH TRUST VPO DANTOUR, WARD NO. 3, TEHSIL KHAJUWALA, DIST. BIKANER 7-5-2014
1131 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD 28-9-2016
1132 DARAGANJ GRAMODYOG VIKAS SANSTHAN 109 TAGORE TOWN ALLAHABAD 12-1-2016
1133 DARASHAW AND COMPANY PRIVATE LIMITED 1205-6, REGENT CHAMBERS, 12TH FLOOR 208, NARIMAN POINT, MUMBAI 29-9-2016
1134 DARCL LOGISTICS LIMITED SCO-47, 3RD FLOOR, CIVIL LINES, OLD JUDICIAL COMPLEX, GURGAON 14-9-2015
1135 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA 23-10-2015
1136 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA 6-1-2016
1137 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA 14-10-2015
1138 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COMPLEX, DELHI ROAD, ROHTAK, HARYANA 28-9-2015
1139 DARSH EDUCATION AND WELFARE SOCIETY 22-23, GEETA COLONY, DELHI ROAD, ROHTAK, HARYANA 1-10-2015
1140 DARSH EDUCATION AND WELFARE SOCIETY 22-23 GEETA COMPLEX, DELHI ROAD ROHTAK 30-11-2015
1141 DARWIN SOCIETY 179 MRD ROAD, BAMUNIMAIDAM GUWAHATI, ASSAM 6-9-2015
1142 DASH INFOTECH 168-KRISHNA NAGAR, BHARATPUR 11-5-2016
1143 DATAM EDU PRIVATE LIMITED FLOT NO.403, SURAJ MANSION,AMEERPET, HYDERABAD 21-10-2014
1144 DATAPRO COMPUTERS PVT LIMITED 47-9-20/2, FIRST FLOOR, 3RD LANE, DWARAKA NAGAR, VISAKHAPATNAM (AP) 22-11-2013
1145 DATAR DEVELOPMENT FOUNDATION 7 MOHMMADI NAGAR OPP. DATAR TECHNICAL INSTITUTE OLD DSP OFFICE DEOPUR DHULE 28-7-2016
1146 DATASOFT COMPUTER CENTRE SANSTHAN LOCK,AMARPURA, NAUBATPUR, PATNA 14-10-2015
1147 DATATEC EDUCATIONAL TRUST DATATEC INSTITUTE OF SCIENCE AND MANAGEMENT, PULIMOODU JN:,MAVELIKARA,ALAPPUZHA (DIST),KERALA 24-6-2015
1148 DAUDNAGAR ORGANISATION FOR RURAL DEVELOPMENT 2ND FLOOR, CHITKOHRA HOUSE, DR. ASHRAF LANE, S.P.VERMA ROAD 2-5-2014
1149 DAV COMPUTER EDUCATION SOCIETY 5A/15;TILAK NAGAR; NEW DELHI 24-4-2014
1150 DAYARAM PRATHISTHAN FLAT -1,RAMRAJYA BUILDING NO -1,NEAR BM COLLEGE, SAMARTH NAGAR,COLLEGE ROAD,NASHIK. 16-12-2016
1151 DBG WELFARE TRUST GUSHKARA ,HATTALA.NEW TOWN ROAD.P.O-GUSHKARA, P.S- AUSGRAM, DIST-BURDWAN.PIN-713128,WEST BENGAL 12-9-2016
1152 DB SKILLS AND LIVELIHOOD PRIVATE LIMITED 205, B WING, SUNRISE, SWAMI SMARTH NAGAR, LOKHANDWALA COMPLEX, OSHIWARA, ANDHERI (WEST), MUMBAI - 400053, MAHARASHTRA. 28-10-2016
1153 DCL COMPUTER EDUCATION KALYANI BUILDING, DR.NO.6-41H TVM MAIN ROAD MARTHANDAM 10-11-2014
1154 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR, MAHMOORGANJ, VARANASI(UP) 6-4-2016
1155 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP) 22-7-2016
1156 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ DITT:- VARANASI(UP) 27-6-2016
1157 DEDICATED SOCIETY OF TEACHERS B-37/8, BIRDOPUR MAHMOORGANJ VARANASI(UP) 2-3-2016
1158 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST:- MAHMOORGANJ VARANASI U.P. 5-2-2016
1159 DEDICATED SOCIETY OF TEACHERS B-37/8 BIDOPUR,MAHMOORGANJ,VARANASI(UP) 16-3-2016
1160 DEDICATED SOCIETY OF TEACHERS B-37/8 BIRDOPUR POST-MAHMOORGANJ VARANASI(UP) 26-4-2016
1161 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA, GUJARAT (INDIA) 3-11-2016
1162 DEEPAK FOUNDATION NIJANAND ASHRAM PREMISES, ADJOINING L&T KNOWLEDGE CITY ON NH NO. 8, WAGHODIA ROAD, VADODARA 11-5-2016
1163 DEEPAK FOUNDATION COMMUNICATION ADDRESS: DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA-390019, GUJARAT (INDIA) REGISTERED ADDRESS: "DEEPAK FARM", OPP. HARIKRUPA SOCIETY, NR. T.B. HOSPITAL, GOTRI ROAD, VADODARA-390021 18-11-2016
1164 DEEPAK FOUNDATION DEEPAK FOUNDATION NIJANAND ASHRAM, ADJOINING L&T KNOWLEDGE CITY ON NATIONAL HIGHWAY-8, VADODARA- 390019, GUJARAT (INDIA) TEL.: 91-265-6562101 - 107 WEBSITE: WWW.DEEPAKFOUNDATION.ORG 7-4-2016
1165 DEEPALI INFOTECH PRIVATE LIMITED BARA BAZAR, JHANDA CHOWK, 26-7-2016
1166 DEEPAM EDUCATIONAL TRUST S. UDAYAKUMAR DEEPAM EDUCATIONAL TRUST 73A1, OLD HOSPITAL ROAD, KULITHALAI TOWN & TALUK, KARUR DISTRICT 12-9-2015
1167 DEEPAM FOR EDUCATION EMPOWERMENT AND DEVELOPMENT NO.21, MARIAMMAN KOIL STREET, EDAYARPALAYAM, POORANANKUPPAM POST, PONDICHERRY. 26-8-2016
1168 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT 14-10-2015
1169 DEEPAM TRUST 73A1 OLD HOSPITAL ROAD KULITHALAI TOWN AND TALUK KARUR DISTRICT 30-10-2015
1170 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR 23-12-2016
1171 DEEPSHIKHA KALA SANSTHAN SEC-3, VARUN PATH, MANSAROVAR, JAIPUR 17-9-2015
1172 DEEPSHIKHA KALA SANSTHAN WHITE BUILDING, SEC-03, VARUN PATH, MANSAROVAR, JAIPUR, RAJASTHAN 19-1-2017
1173 DEEPSHIKHA KALA SANSTHAN SECTOR-3, VARUN PATH, MANSAROVAR, JAIPUR 29-12-2016
1174 DEEP TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR, MODI CHAMBER,STATION ROAD, ALWAR 18-9-2015
1175 DEKAY CARE 75, HAZRATGANJ, LUCKNOW, UTTAR PRADESH 16-6-2014
1176 DELHI COMPETITIVE AND VOCATIONAL SOCEITY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI 5-4-2016
1177 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR DELHI 18-4-2016
1178 DELHI COMPETITIVE AND VOCATIONAL SOCIETY 1/49 LALITA PARK MAIN VIKAS MARG LAXMI NAGAR, DELHI 16-3-2016
1179 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE 14-10-2015
1180 DELPHI SKILL DEVELOPMENT CORPORATION PVT LTD 201A, INDIRA BUILDING, NEXT TO TITAN SHOWROOM, BHANDARKAR ROAD, PUNE 11-8-2015
1181 DELTA EDUCATION PALAMANDAP,CUTTACK 22-12-2013
1182 DENTCARE DENTAL LAB PVT LTD XVI/242C, NAS ROAD, NEAR KSRTC MUVATTUPUZHA, ERNAKULAM DIST. 25-8-2014
1183 DESHPANDE EDUCATIONAL TRUST DCSE BUILDING BVBCET CAMPUS VIDYANAGAR 17-9-2015
1184 DESHPANDE FOUNDATION DCSE BUILDING, BVBCET CAMPUS, VIDYANAGAR, HUBLI 17-12-2013
1185 DE UNIQUE EDUCATIONAL SOCIETY K-16, SOUTH EXTENSION, PART-I, NEW DELHI-110049 17-12-2013
1186 DEVAM COMPUTECH "DEVAM BHABAN", THAKURPARA (MALANCHA), P.O - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122 17-9-2015
1187 DEVAM DISHARI "DEVAM BHABAN", THAKURPARA(MALANCHA), BISHNUPUR, P.O. - BISHNUPUR, DIST. - BANKURA, WEST BENGAL - 722122 14-10-2015
1188 DEVELOPMENTAL INNOVATION FOR SOCIAL HUMAN ACTION D-8, SHAKTI VIHAR COMPLEX,NEAR WRIGHT TOWN STADIUM, WRIGHT TOWN,JABALPUR 6-1-2016
1189 DEVELOPMENT OF RURAL EDUCATION AGRICULTURE MULTIPURPOSE SERVICE TRUST DEVELOPMENT OF RURAL EDUCATION AGRICULTURE & MULTIPURPOSE SERVICE TRUST (DREAMS TRUST) 2/54B,2ND WARD,N.PANJAMPATTY(PO),DINDIGUL-DISTRICT,TAMIL NADU-STATE,SOUTH INDIA. 8-9-2014
1190 DEVELOPMENT SERVICES INTERNATIONAL B 152 SECOND FLOOR SURYA NAGAR DISTRICT GHAZIABAD UTTAR PRADESH 10-8-2016
1191 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD 24-6-2016
1192 DEV GROUP SOCIETY GEETA MANDIR ROAD,MODEL TOWN FATEHABAD 5-8-2016
1193 DEV GROUP SOCIETY NEAR GEETA MANIR,MODEL TOWN-FATEHABAD 20-7-2016
1194 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCULAR ROAD, DALANWALA, DEHRADUN 17-5-2016
1195 DEV RISHI EDUCATIONAL SOCIETY 32/22, CIRCLULAR ROAD, DALANWALA, DEHRADUN 6-5-2016
1196 DEV SARVODAYA SAMITI SAHU CHOWK, VALLABHAV NAGAR WARD, SAGAR (M.P.) 13-11-2014
1197 DEWCON WELFARE SOCIETY POSTAL ADDRESS & REGD. OFFICE RATHTHAMBOOR COMPLEX M.P NAGAR ZONE-II , BHOPAL - 462 016 (M.P.) HEAD OFFICE 104, I FLOOR, SHARDHA APARTMENT PLOT NO. 6 MALVIYA NAGAR BHOPAL 3-2-2014
1198 DEXTER SKILL DEVELOPMENT PVT LTD 764A, AMBEDKAR NAGAR, NEAR NEST PREPARATORY SCHOOL,NEAR SECTOR -9, GURGAON, HARYANA 28-9-2016
1199 DFHDFHFH KJDVNMDV,M DV 10-2-2016
1200 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059 4-8-2016
1201 DGN SKILLS AND MANAGEMENT PRIVATE LIMITED PLOT NO.1 S/F FONT SIDE BLOCK-C-4, BHAGWATI GARDEN EXTENSION, UTTAM NAGAR NEW DELHI - 110059 6-7-2016
1202 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE 16-3-2016
1203 DHANAM EDUCATIONAL TRUST AISHWARYA COMPLEX IIND FLOOR, NEAR MANI HIGHER SECONDARY SCHOOL, PAPPANAICKENPALAYAM, COIMBATORE 8-6-2016
1204 DHANAMOORTHY EDUCATIONAL TRUST NO. 32/13, AGRAHARA STREET, THIYAGADURGAM - 606 206. KALLAKURICHI TALUK, VILLUPURAM DISTRICT, TAMIL NADU, INDIA. 11-8-2014
1205 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU 23-2-2016
1206 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU 14-9-2015
1207 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU 6-1-2016
1208 DHANDAPANI RURAL CHARITABLE TRUST P.K.R ARTS COLLEGE FOR WOMEN, DHANDAPANI RURAL CHARITABLE TRUST, MURUGANPUDUR, GOBICHETTIPALAYAM, ERODE DISTRICT, TAMIL NADU 18-11-2016
1209 DHAN FOUNDATION NO. 1, VAIDYANATHAPURAM EAST, KENNET CROSS ROAD NEAR SEVENTH DAY SCHOOL MADURAI 625016 22-12-2013
1210 DHANUSH ENGGSERVICES INDIA PVT LTD 16-31-393-395/306,K.P.H.B COLONY, KUKATPALLY 11-8-2014
1211 DHANVANTRI EDUCATION SOCIETY 13/598, SAFALYAS, SINDHYA NAGAR, DURG 10-11-2016
1212 DHANYA INFOMEDIA PRIVATE LIMITED 1ST FLOOR, DR WHITE HOUSE , ATTA CHOWK, GAUTAMBUDH NAGAR, NOIDA, UP 24-8-2016
1213 DHARANA LIVELIHOOD PROJECTS PVT LTD NAPT, RAM NIVAS, OPP UNION BANK, AIR ROAD, VAZHUTHACAUD, THIRUVANANTHAPURAM 11-11-2016
1214 DHAROHAR FOUNDATION VPO BHANBHORI HISAR 6-10-2016
1215 DHAROHAR FOUNDATION VPO BHANBHORI TEHSIL BARWALA DISTT HISAR 26-9-2016
1216 DHAROHAR FOUNDATION REGD OFFICE VPO BHANBHORI TEHSIL BARWALA DISTTI HISAR HARYANA 125121 COMMAND OFFICE HANSI ROAD NH 65 NEW BUS STAND BARWALA HISAR 125121 22-8-2016
1217 DHATRI FOUNDATION 7-1-246/95, BJR NAGAR,OPP.NATURE CURE HOSPITAL MMTS RLY.STN., SR NAGAR, HYDERABAD 25-11-2013
1218 DHATRI RURAL DEVELOPMENT SOCIETY PLOT NO: 230/PART, USHODAYA COLONY, NEAR UMCC HOSPITAL, QUTHUBULLAPUR MUNCIPALITY, G R ROAD, HYDERABAD 5-11-2013
1219 DHEYA CAREER MENTORS INDIA PVT LTD SUSHIL , 26 RAGHUVIR SOCIETY, MUKUND NAGAR, OFF SATARA ROAD, PUNE 15-4-2014
1220 DHOSA CHANDANESWAR BRATYAJANA SAMITY BLOCK CB 35 ,SALT LAKE SECTOR-I,KOLKATA 28-9-2016
1221 DHYEYAPURTI SEVA SWAYAMROJGAR PRAKSHIKSHAN COOP SO SHIVRAM NAGAR, DASAK, JAIL ROAD, NASHIK ROAD, NASHIK 7-11-2013
1222 DIAMOND NDT INSPECTION SERVICES PVT LTD #38-C, SRI VELA PLAZA, WEAVERS STREET, OPP. RAMRAJ COTTON SHOW ROOM, HOSUR-635109, KRISHNAGIRI DT. TAMIL NADU. 28-9-2015
1223 DIA SKILL DEVELOPMENT PRIVATE LIMITED 18A, FIRST FLOOR, HINT HOUSE, RDC RAJ NAGAR, GHAZIABAD, UP 25-11-2014
1224 DICT INFOTEC PRIVATE LIMITED 11, MAHAKOSHAL NAGAR, BEHIND SARASWATI H.S. SCHOOL, ADHARTAL, JABALPUR- 482004 11-11-2014
1225 DIET DEVELOPMENT INSTITUTE OF INNOVATIVE ENTREPRENEURSHIP AND TRAINING (DIET) 403, D.NO:43-9-149, 4TH FLOOR APARTMENT, AVR ENCLAVE, T.S.N.COLONY ROAD, DONADAPARTHY, VISAKHAPATNAM.530016 17-9-2015
1226 DIGITAL NETWORKING AMC EXPERT 33,1ST FLOOR,GDA COMPLEX (IN FRONT OF LIC OFFICE) TARAMANDAL ROAD GORAKHPUR 23-6-2016
1227 DINABANDHU FOUNDATION FERSED DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT, REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR 11-8-2016
1228 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: MIG 17, PRAGATI ENCLAVE, NILADRI VIHAR, BHUBANESWAR 14-12-2016
1229 DINABANDHU FOUNDATION FOR EDUCATIONAL RESEARCH AND SOCIO ECONOMIC DEVELOPMENT REGD OFFICE: A/127, SAHID NAGAR, BHUBANESWAR CORP OFFICE: F2, CHANDAKA INDUSTRIAL ESTATE, CHANDRASEKHARPUR, BHUBANESWAR, ODISHA 6-10-2016
1230 DISHA ACADEMY 101, MADURTDAHA KALIKAPUR, NEAR BHURIBHOJ, KOLKATA, WEST BENGAL. 2-9-2016
1231 DISHA CONSULTING SERVICES CMR COMPLEX, PLOTNO:18,MAIN ROAD UPPAL 5-1-2016
1232 DISHA CONSULTING SERVICES CMR COMPLEX, PLOT NO 18,3RD FLOOR, WARANGAL HIGH WAY, PEERZADIGUDA,UPPAL, HYDERABAD 23-10-2015
1233 DISHA EDUCATION DISHA CROWN KATHNA ROAD SHANKAR NAGAR RAIPUR CHHATTISGARH ADDRESS FOR COMMUNICATION: "DISHA PARK" BUILDING 1, GROUND FLOOR, RAM NAGAR - KOTA MARG, BEHIND NIT AND HOTEL PICCADILLY, RAIPUR 11-8-2015
1234 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY Plot No:16/A,SRI SAI ENCLAVE,PHASE 2 BODUPPAL,HYDERABAD 30-10-2015
1235 DISHA EDUCATIONAL AND YOUTH DEVELOPMENT SOCIETY SRI SAI ENCLAVE,PLAT NO:18 UPPAL MAIN ROAD 7-1-2016
1236 DISHA EDUCATION SOCIETY DISHA TOWER NEW SHANTI NAGAR, RAIPUR C.G. 25-8-2014
1237 DISHA GRAMIN VIKAS PRATISTHAN NEAR COURT, SHIVAJI NAGAR, HINGOLI 12-1-2016
1238 DISHA GRAMIN VIKAS PRATISTHAN NEAR DISTRICT COURT, SHIVAJI NAGAR, HINGOLI 27-4-2016
1239 DISHA SHIKSHAN AND SAMAJ KALYAN SAMITI B-474/9A SAKET NAGAR, NEAR AIIMS HOSPITAL, BHOPAL 22-11-2016
1240 DISHA SIKSHAN AVAM KALYAN SAMITI BRILLIANT COMPUTER, TRILOKI NAGAR, NEAR RAILWAY STATION, CHHINDWARA MP 21-6-2016
1241 DITC MANAGING TRUSTEE HO-PLOT NO-1149,15 GOVIND VIHAR,BOMIKHAL,BHUBANESWAR,ODISHA TRAINING CENTER-DITC ITI & DIPLOMA ENGG.COLLEGE,AT-KHUNTUNI,PO-RADHAKISHOREPUR,SUB-AATHAGADA,DIST-CUTTACK,ODISHA,PIN-754029 8-1-2016
1242 DITC MANAGING TRUSTEE 5,JANPATH,BAPUJI NAGAR,BHUBANESWAR-9 29-2-2016
1243 DIVASWAPNA SARVJANIK TRUST PROJECT OFFICE-: DIVASWAPNA SARVJANIK TRUST NEAR BUS STOP,MURALIDHAR NA KHNACHA MA, AT & PO DAKOR TA. THASRA DIST.KHEDA GUJARAT 15-3-2016
1244 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239 28-9-2016
1245 DIVASWAPNA SARVJANIK TRUST PORDA FAGVEL NEAR ST STAND,MURALIDHAR BHOJANALAY,2ND FLOOR,AT PO DAKOR TA,THASRA,DIST,KHEDA-GUJARAT-9924902239 14-9-2016
1246 DIVINE EDUCATIONAL SOCIETY DISPUR COLLEGE ROAD, GANESHGURI, GUWAHATI, ASSAM 17-8-2015
1247 DIVINE INTERNATIONAL PLOT NO-13, BLOCK NO.-18, EDUCATIONAL AREA SADA, GWALIOR 6-10-2016
1248 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND 12-8-2016
1249 DIVINE INTERNATIONAL FOUNDATION 2ND FLOOR SHRI SAI COMPLEX NEAR HDFC BANK RANIPUR MODE HARIDWAR UTTARAKHAND 26-7-2016
1250 DIVYA BHARTI INFOTECH PRIVATE LIMITED KHASRA NO - 989, MANSA ENCLAVE, NEAR OBEROI FARM, KAPASHERA, DELHI 5-9-2016
1251 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL 17-9-2015
1252 DIVYA DRISHTI SHIKSHA SAMITI 404, JYOTI SHOPPING CENTER ZONE 1 MP NAGAR BHOPAL (M.P.) - 462011 28-9-2015
1253 DIVYA DRIVER TRAINING CENTRE TRUST 1642 ANNAI ANJUGAM NAGAR VENGIKKAL TIRUVANNAMALAI 17-9-2015
1254 DIVYA EDUCATIONAL TRUST H40,PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU 30-11-2016
1255 DIVYA EDUCATIONAL TRUST DIVYA EDUCATIONAL TRUST, H.40 PALLAVAN NAGAR, KANCHIPURAM. TAMILNADU. 9-12-2016
1256 DIVYA PHARMA GRAMODHYOG SANSTHAN 13/503 NEAR MUNSHIPULIA,INDIRA NAGAR LUCKNOW 13-4-2015
1257 DIYASHA ACADEMY 107/1 B.C MUKHERJEE ROAD,POST-TRIBENI,PS-MOGRA,PIN-712503.WEST BENGAL 19-10-2016
1258 D M PHARMA HEALTH CARE C-3, MAHINDRA PARK, PANKHA ROAD, UTTAM NAGAR, NEW DELHI 21-6-2016
1259 DMW CNC CENTRE 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, ERODE 1-7-2014
1260 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, PERUNDURAI ROAD, PERUNDURAI, ERODE 3-11-2016
1261 DMW CNC CENTRE 89A, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE, ERODE ROAD, PERUNDURAI, ERODE 29-12-2016
1262 DMW EDUCATION AND CHARITABLE TRUST 89, ERODE MAIN ROAD, NEAR MAHARAJA WOMEN'S COLLEGE. 25-11-2014
1263 DNYANSAGAR BAHUUDDESHIYA SHIKSHAN SANSTHA 72, PRASHANT COLONY, VIDYA VIHAR, PARATWADA 11-1-2016
1264 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE- INDIA 17-9-2015
1265 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, BANGALORE INDIA 11-1-2016
1266 DOLAR ENGG INDUSTRIES PVT LTD #3,1ST 'A' CROSS, 1ST 'B' MAIN 1ST STAGE,PEENYA, 3-3-2016
1267 DOLAR ENGG INDUSTRIES PVT LTD DOLAR ENGG. INDUSTRIES PVT. LTD. #3, 1ST 'A' CROSS, 1ST 'C' MAIN, 1ST STAGE, PEENYA, BANGALORE - 560 058 7-3-2016
1268 DOMAIN COMPUTER SYSTEM PVT LTD B-5 MURTI KALA COLONY GOPALPURA BYEPASS INFRONT OF TARUN HOTEL JAIPUR 17-9-2015
1269 DON BOSCO TECH SOCIETY DON BOSCO TECH SOCIETY, DON BOSCO YUVA KENDRA, NANGLOI ROAD, NAJAFGARH, NEW DELHI 18-11-2016
1270 DON BOSCO VYAWASAIK PRASHISKAHN KENDRA NEAR ST. ANDREW'S HIGH SCHOOL BALAJI CHOWK CHINCHWAD, PUNE 411019 19-5-2014
1271 DON BOSCO YOUTH MISSION AND EDUCATIONAL SERVICES DON BOSCO INSTITUTE JOYPUR KHARGHULI GUWAHATI ASSAM 7-4-2016
1272 DORIC MULTIMEDIA PVT LTD FIRST FLOOR GULATI MARKET NEAR CMC CHOWK 20-11-2013
1273 DORLING KINDERSLEY INDIA PRIVATE LIMITED A-8(A), 7TH FLOOR, KNOWLEDGE BOULEVARD, SECTOR-62, NOIDA 22-1-2014
1274 DOT NET COMPUTER EDUCATION CENTRE IST AND IIND FLOOR, OPP PNB ATM, JHANSA ROAD, KURUKSHETRA 1-12-2014
1275 DOWN TOWN CHARITY TRUST 7TH FLOOR, 3RD BUILDING, DOWNTOWN HOSPITAL COMPLEX, G.S. ROAD, DISPUR, GUWAHATI (ASSAM) 21-10-2014
1276 DRAMBEDKARJANVIKASSANSTHAN C-2/252, SECTOR-F, JANKIPURAM, LUCKNOW 5-1-2016
1277 DR AMBEDKAR JAN VIKAS SANSTHAN H NO C-2/252 SEC F JANKIPURAM GUDAMBA LUCKNOW 15-9-2015
1278 DR AMRIT LAL ISHRAT MEMORIAL SUNBEAM SOCIETY D 58/520 B , SIGRA MEHMOORANJ ROAD,MEHMOORGANJ, SIGRA, VARANASI, UTTAR PRADESH 18-3-2016
1279 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR ,TEHSIL & DISTRICT HISAR 17-9-2015
1280 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR, HARYANA 14-3-2016
1281 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR, HISAR 4-7-2016
1282 DR AS MEMORIAL EDUCATION SOCIETY VPO ARYA NAGAR DISTRICT HISAR 125001 HARYANA 29-2-2016
1283 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR 16-3-2016
1284 DR BHIM RAV AMBEDKAR GRAMIN SANSTHAN 756, INDRA COLONY 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR 15-3-2016
1285 DR BHIM RAV AMBEDKAR GRAMIV SANSTHAN 756, INDIRA COLONY, 3RD FLOOR, NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR 3-3-2016
1286 DR B R A T AND V T C RUB BY SHIKSHA VISTAR SAMITI DR. B. R. AMBEDKAR TECHNICAL AND VOCATIONAL TRAINING CENTRE (RUN BY SHIKSHA VISTAR SAMITI) VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DIST JAUNPUR UP 15-3-2016
1287 DREAM CATCHERS SOLUTIONS PRIVATE LIMITED H NO-25 WARD NO-7 NAGROTA BAHWAN,DISTT KANGRA HIMACHAL PRADESH 12-1-2017
1288 DREAM INDIA SKILLS ACADEMY PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3, GOREGAON EAST, MUMBAI, MAHARASHTRA 27-6-2016
1289 DREAM INDIA WOMAN S CHARITABLE TRUST CHINNA IKKADU ROAD THIRUVALLUR THIRUVALLUR DIST 3-9-2015
1290 DREAM INDIA WOMEN CHARITABLE TRUST CHINNA IKKADU ROAD DIST. THIRUVALLUR TAMIL NADU 9-9-2015
1291 DREAMLAND IMMIGRATION COMPANY PVT LTD 529/4 D, MATA GATE, GUPTA COLONY, KAITHAL, HARYANA 6-4-2015
1292 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL DISTT- ALIGARH 29-12-2016
1293 DREAMS COME TRUE SOCIAL WELFARE ASSOCIATION VILL & POST- GAHTOLI NIRMAL TEH- ATRAULI DISTT- ALIGARH 21-12-2016
1294 DREAMS INFOTECH 98, B.K PAUL AVENUE. KOLKATA 7-1-2015
1295 DREAM SKILL DEVELOPMENT MULTIPURPOSE SANTHA PLOT NO. 09 MADHYAMIK COLONY NEAR RUPAMAI SCHOOL NAKANE ROAD DEOPUR DHULE 4-11-2016
1296 DREAMSPLUS CONSULTING PVT LTD 75 FIRST FLOOR BURKIT ROAD T NAGAR CHENNAI 17-7-2014
1297 DREAMZ CHARITABLE TRUST PLOT NO-12, JUNIKAMPTEE ROAD, KALAMNA, NAGPUR-441204 MAHARASHTRA 6-8-2015
1298 DREAMZ TRUST WZ-06, 1ST FLOOR, HARI SINGH PARK, NEW MULTAN NAGAR, DELHI 110056 14-8-2015
1299 DRISHTEE FOUNDATION 8TH FLOOR, TOWER- B, KNOWLEDGE BOULEVARD, PLOT - A-8A, SECTOR - 62, NOIDA 29-10-2013
1300 DRISHTEE SKILL DEVELOPMENT CENTRE PVT LTD DRISHTEE SKILL DEVELOPMENT CENTRE PVT LTD, 8TH FLOOR, TOWER-B, KNOWLEDGE BOULEVARD, PLOT-A8A, SECTOR-62, NOIDA, UTTAR PRADESH 6-11-2013
1301 DRISHTI EDUCATION TRUST B-101-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN) 9-12-2016
1302 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN) 23-11-2016
1303 DRISHTI EDUCATION TRUST B-102, SUMER COMPLEX, GAUTAM MARG, C-SCHEME, JAIPUR (RAJASTHAN) 28-10-2016
1304 DR KNMIPER TRUST DR. K. N. MODI INSTITUTE OF PHARMACEUTICAL EDUCATION AND RESEARCH TRUST, MODI BHAWAN, MODINAGAR, GHAZIABAD, UTTAR PRADESH. 6-1-2016
1305 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD. 15-1-2016
1306 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD. 5-2-2016
1307 DR KNMIPER TRUST MODI BHAWAN, MODINAGAR, GHAZIABAD. 12-1-2016
1308 DR K R ADHIKARY COLLEGE OF OPT AND PARA TECHNOLOGY REGISTERED OFFICE - B-13/66,P.O.KALYANI,DIST.NADIA, WEST BENGAL, PIN 741235 SECRETARIAT - 16/1 AND 2, WEST GHOSHPARA ROAD, P.O.BHATPARA, DIST. NORTH 24 PARGANAS, WEST BENGAL, PIN 743123 8-4-2016
1309 DR K R DOSHI TRUST PL. NO 1334/B, NR. T.V.CENTER, NR. DAYARAM PRATHMIK SHALLA, BHAVNAGAR 27-6-2016
1310 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU 24-6-2016
1311 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153,SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI (PO),COIMBATORE 22-6-2016
1312 DR MRS FRANCIS MEMORIAL COMMUNITY CARE FOUNDATION 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU 24-6-2016
1313 DR PADAMASINH PATIL SOCIAL YOUTH FOUNDATION AT POST TQ DS OSMANABAD 27-6-2016
1314 DR RK IITAND RC F-115 , VANKTESHWARA TOWER , NEAR CINE STAR CINEMA , CENTRAL SPINE , VIDHYADHAR NAGAR , JAIPUR 17-4-2015
1315 DR SHIVNANDAN SINGH INTER COLLEGE SAMATI 117/214,A,R,S,PURAM,SARVODAYA NAGAR 27-6-2016
1316 DR SUDHA GUPTA MEMORIAL SOCIETY 3, CIVIL LINES, 2ND BRIDGE, JABALPUR. MADHYA PRADESH 29-12-2016
1317 DR SUDHA GUPTA MEMORIAL SOCIETY 3 CIVIL LINE JABALPUR. 29-6-2016
1318 DR ZAKIR HUSSAIN ANJUMAN MINORITY EDUCATIONAL N PUBLIC WELFARE SOCIETY HARESHWAR SINGH COMPLEX, BYE PASS ROAD, CHAS 14-10-2015
1319 DUBRAJPUR GANDHI INSTITUT FOR RURAL DEVELOPMENT VILL- PURULIA, PO- AHANDA, DIST- BANKURA 30-11-2016
1320 DUKHANA DEVI SEVA SANSTHAN SITAMSARAI,BIDAURI, JALALPUR, JAUNPUR 2-6-2014
1321 DUM DUM NIKHIL BANGIYA VIDYAPEETH VIDYAPEETH BHAWAN, PULIN AVENUE, PO- RAJBARI, KOLKATA-700081 9-4-2015
1322 DURGA GREENING AND WELFARE SOCIETY MATA PULI ROAD SAMALKHA, DISTRICT PANIPAT, HARYANA 31-10-2013
1323 DURGA MAHILA SHISHU KALYAN SANSTHAN ROAD NO.-14 RAJIV NAGAR PATNA BIHAR 13-11-2014
1324 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR,JANAPATH ROAD,KOLKATA-700065 6-1-2016
1325 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065 12-1-2016
1326 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR,POST-RABINDRANAGAR, JANAPATH ROAD,KOLKATA-700065 5-9-2016
1327 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065 21-6-2016
1328 DURGANAGAR TRIROMA SOCIAL WELFARE SOCIETY WEST-DURGANAGAR, POST-RABINDRANAGAR, JANAPATH ROAD, KOLKATA- 700065 14-10-2015
1329 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE BANSKOPA INN COMPLEX,BANSKOPA,POST OFFICE-RAJBANDH,DIST-BURDWAN,WEST BENGAL 12-5-2016
1330 DURGAPUR EMKAYS SOCIETY OF EDUCATION AND WELFARE KANKSA(MASTER PARA)P.O- PANAGARH BAZAR 27-11-2015
1331 DURGAPUR ISPAT PEOPLES SOCIETY 6/7,EINSTEIN AVENUE,B-ZONE,DURGAPUR,WEST BENGAL,-713205 2-9-2016
1332 DURGO CULTURAL ASSOCIATE KAJIPARA, PO+PS - CHINSURAH, HOOGHLY 7-4-2016
1333 DURGO CULTURAL ASSOCIATE KAJIPARA PO + PS CHINSURAH HOOGHLY 9-2-2016
1334 DVR EXPORTS PRIVATE LIMITED 8-2-293/F/29,RD.NO.5,JAWAHAR COLONY, HYDERABAD 4-8-2016
1335 DWAITH INFOTECH PRIVATE LIMITED DWAITH INFOTECH PVT. LTD, PLOT NO:235,SAI SADAN, SURVEY OF INDIAN EMPLOYEE SOCIETY, 1ST FLOOR, KHANAMPET, MADHAPUR(PB) ,HYDERABAD LANDMARK: NEAR YSR STATUE 2-2-2015
1336 DYAN DEEP JANKALYAN FOUNDATION 407, SHUKRAWAR PETH, SHIVAJI ROAD, 7-2-2014
1337 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE 6-4-2016
1338 DYAN DEEP JANKLAYAN FOUNDATION 407, SHUKRAWAR PETH, PUNE 17-5-2016
1339 DYNAMIC STAFFING SERVICES NEW DELHI DYNAMIC HOUSE KH-71 SECTOR-8B, DWARKA, NEW DELHI, 8-6-2016
1340 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71 BAGROLA, SECTOR-8B, DWARKA, NEW DELHI 20-7-2016
1341 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH-71, SECTOR-8B, DWARKA, NEW DELHI 20-7-2016
1342 DYNAMIC STAFFING SERVICES PRIVATE LIMITED DYNAMIC HOUSE, KH.71- BAGROLA,SECTOR-8B, DWARKA NEW DELHI 19-7-2016
1343 DYNAMIC STAFFING SERVICES PVT LTD HEAD OFFICE DYNAMIC HOUSE KH-71, SECTOR 8B, DWARKA, NEW DELHI-110077, INDIA 24-6-2016
1344 DYNAMIC TARANG PRIVATE LIMITED DYNAMIC TARANG PRIVATE LIMITED, SUPPAT MANSION, TIMBER GALI, NEAR HOTEL HOLIDAY HOME,KANKE ROAD, RANCHI,JHARKHAND 4-8-2016
1345 E2 INFO SOLUTIONS 61, ERULAPPAPURAM KOTTAR POST NAGERCOIL 17-9-2015
1346 EAGLE HUNTER SOLUTIONS LIMITED 61C KALU SARAI, SARVAPRIYA VIHAR, NEW DELHI 12-10-2013
1347 EARNEST HR SOLUTIONS PVT LTD 1/G2 LIBERTY PHASE II NORTH MAIN ROAD, KOREGOAN PARK, PUNE 13-9-2015
1348 EARTH AND MOON PRIVATE LIMITED EARTH & MOON GLOBAL SHRIRAM INSTITUTE FOR INDUSTRIAL RESEARCH - TBI (A UNIT OF SHRIRAM SCIENTIFIC AND INDUSTRIAL RESEARCH FOUNDATION) 19, UNIVERSITY ROAD, DELHI - 110007 (INDIA) 4-4-2016
1349 EARTHLINE PRIVATE LIMITED 1 / A, 4TH FLOOR, IST MAIN ROAD, KARIANNAPALYA, BANGALORE - 560 084. 5-11-2015
1350 EARTHLINE SERVICES PRIVATE LIMITED NO.1/A ABIDE WITH ME APARTMENTS 4TH FLOOR 1ST CROSS KARIANNAPALYA BANGALORE 30-11-2015
1351 EASA FOUNDATIONS 42/1-NEW DAMU NAGAR PULLIYAKULAM ROAD COIMBATORE 28-9-2016
1352 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58 SHRI RAM NAGAR CALONEY BUDAUN TRAINING OFF: JAWAHAR PURI BUDAUN TRAINING OFF: A4 PALLAVPURAM PHASE 1 MEERUT 14-10-2015
1353 E ASHRAM INFOTECH PRIVATE LIMITED WORKING OFF: 58, SHRI RAM NAGAR CALONEY, BUDAUN TRAINING OFF: JAWAHAR PURI, BUDAUN TRAINING OFF: A4, PALLAVPURAM PHASE 1, MEERUT 6-1-2016
1354 EASTERN MILL PRIVATE LIMITED HAMID MANZIL, PEERKHANPUR, BHADOHI, SANT RAVIDAS NAGAR 12-5-2016
1355 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI 24-6-2016
1356 EASTERN MILLS PRIVATE LIMITED RAYAN, SURIAWAN ROAD, BHADOHI 9-6-2016
1357 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A, NORTH VELI STREET,SIMMAKKAL,MADURAI 14-9-2016
1358 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO.161A,NORTH VELI STREET,SIMMAKKAL,MADURAI. 6-10-2016
1359 ECAREERPLUZ INFO INDIA PRIVATE LIMITED NO 161A NORTH VELI STREET SIMMAKKAL MADURAI 30-11-2016
1360 ECIL ECIT CENTRE KASARAGOD NADAKKAL HEIGHTS,NEAR KRISHNA THEATRE,KARANTHAKKAD,KASARAGOD 22-12-2013
1361 ECO CLUB WARD NO. 7, SWIANI MANDI, DISTT. BHIWANI 127046 HARYANA 21-9-2016
1362 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT 7-9-2016
1363 ECOLAND FOUNDATION 211/5, RM COMPLEX KARUNGALAKUDI MADURAI DISTRICT 21-9-2016
1364 EDEN DAY SOCIETY H. NO 1365 SECTOR-13 11-5-2016
1365 EDIFY INFOTECH SOLUTION SWAASTIK ROAD NEAR DEVENDERA RESTAURENT SANOLI ROAD PANIPAT HARYANA 14-9-2016
1366 EDLIFE LEARNING PVT LTD PLOT NO. 64, KAUSHIK CHAMBER, SECTOR 19 A, VASHI, NAVI MUMBAI - 400705. 17-12-2013
1367 EDS GADEPAN KOTA 1-6-2016
1368 EDUBRIDGE LEARNING PRIVATE LIMITED 501, SAPPHIRE BUILDING, SV ROAD, KHAR WEST, MUMBAI 21-7-2014
1369 EDUCATING YOUTH FOR EMPOWERMENT TRUST EYE 4/745-2 NO-6 GOKULAM ILLAM ANBU NAGAR EXTN ANNA NAGAR MADURAI TAMILNADU - 625020 11-3-2015
1370 EDUCATIONAL TECHNOLOGIES TRUST 63-A, EXCELSIOR LANE OLD JANIPORA JAMMU 4-3-2016
1371 EDUCATION FOR EMPLOYMENT FOUNDATION EDUCATION FOR EMPLOYMENT FOUNDATION B 267A, FF, GREATER KAILASH-I, OPP. ARCHANA COMPLEX, NEW DELHI 110 048 TEL: + 91 11 4710 4710 EMAIL: EEFGLOBAL@GMAIL.COM WEB: HTTP://WWW.EEFGLOBAL.COM 12-3-2014
1372 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD, HARYANA 16-9-2015
1373 EDUCATION SOCIETY FOR COEIAI 1195, SECTOR-15 FARIDABAD 11-9-2015
1374 EDUCOMP FOUNDATION 1211, PADMA TOWER -1, RAJENDRA PLACE, NEW DELHI. 1-7-2014
1375 EDUCOMP SOLUTIONS LTD REGISTERED OFFICE 1211, PADMA TOWERS 1, 5, RAJENDRA PLACE, NEW DELHI-110 008 PH-011-25755920, 011-25762725, 011-25766484 FAX-011-25766775 CORPORATE OFFICE EDUCOMP TOWERS, 514,UDYOG VIHAR PHASE III GURGAON-122 001 HARYANA 26-3-2014
1376 EDUCORE SOLUTIONS EDUCORE SOLUTIONS, C/O. SAMGOLI OIL STORE, CHANDIGARH ROAD, DERABASSI, MOHAILI, PUNJAB 11-3-2015
1377 EDUGURU INDIA PRIVATE LIMITED OFFICE NO - 314, THIRD FLOOR, MAHALAXMI METRO TOWER, SECTOR - 4, VAISHALI, GHAZIABAD, UTTAR PRADESH 10-10-2013
1378 EDU INSTITUTE ADDRESS 13-5-2014
1379 EDUJOBS ACADEMY PRIVATE LIMITED 388 BLOCK G NEW ALIPORE KOLKATA 22-12-2013
1380 EDULIGHT CAREERS PRIVATE LIMITED 13/E-54, GIRDHAR ROAD, SEC-13, MALVIYA NAGAR, OPP. RELIANCE FRESH, JAIPUR, RAJASTHAN,302017 7-10-2016
1381 EDULIGHT LEARNING SERVICES PVT LTD 7TH FLOOR, CHANDRABHAN SHARMA COLLEGE PREMISES, NEXT TO GOPAL SHARMA SCHOOL, POWAI VIHAR, POWAI, MUMBAI-400072, MAHARASTRA ,INDIA 7-10-2016
1382 EDUPOTION ELEARNING SERVICES PRIVATE LIMITED F-190, THIRD FLOOR, VIKAS PURI 25-11-2014
1383 EDUTECH FOUNDATION EDUTECH FOUNDATION NEAR HENGRABARI LP SCHOOL OPP- GYANBIKASH SCHOOL HENGRABARI GUWAHATI 29-12-2016
1384 EDUTEL TECHNOLOGIES PRIVATE LIMITED #43/13, INDUSTRIAL SUBURB, MARAPPANAPALYA, YESHWANTHPUR, BANGALORE- 560022 30-11-2016
1385 EFGH AND ASSOCIATES PLOT NO. 45/C, MLA'S COLONY, ROAD NO. 12, BANJARA HILLS,HYDERABAD 21-12-2016
1386 EFGH LANDSCAPE AND ENVIRONMENT PRIVATE LIMITED PLOT NO 45/C, MLA COLONY, ROAD NO. 12, BANJARA HILLS, HYDERABAD 14-12-2016
1387 E GRAMIN SERVICES PVT LTD 39, SAPTA SWAHID PATH,DISPUR,GUWAHATI,ASSAM 7-9-2016
1388 EHEREX TECHNOLOGIES PVT LTD 1ST FLOOR RACHNA TRADE CENTER CHUNABHATTI BHOPAL (M.P.) 26-11-2013
1389 EKTA SAMAJIK SHIKSHAN SANSTHA CHAMORSHI ROAD GADCHIROLI 15-9-2015
1390 EKVIRADEVI SHIKASHAN MANDAL JALGAON 98,FIST FLOOR,FULE MARKET JALGAON MAHARASHTRA 18-8-2016
1391 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PRIVATE OPPOSITE CHURCH GANDHI NAGAR JAMMU 5-1-2017
1392 ELECON SKILL SERVICES PRIVATE LIMITED 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU -180004 JAMMU & KASHMIR 29-12-2016
1393 ELECON SKILL SERVICES PRIVATE LIMITED LANE NO.6 EAKTA VIHAR, AIR FORCE LANE KUNJWANI , JAMMU - 180010 (JAMMU & KASHMIR) 14-9-2016
1394 ELECTRONICS CORPORATION OF INDIA LIMITED ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX DHAKURIA,KOLKATA-700068 7-9-2016
1395 ELECTRONICS CORPORATION OF INDIA LIMITED G-15,DAKHINAPAN SHOPPING COMPLEX,DHAKURIA,KOLKATA-700068 21-9-2016
1396 ELECTRONICS TECHNOLOGY AND TELECOMMUNICATION AT - IIIRD FLOOR, CHALACHITRA BHAWAN, BUXI BAZAR, CUTTACK, ODISHA 11-11-2014
1397 ELEMENTARY AND TECHNICAL SKILL COUNCIL OF INDIA 202, MALIK PLAZA, G.T.ROAD, NEAR BANK OF BARODA, PANIPAT-132103 13-1-2017
1398 ELITE FOUNDATION 2ND FLOOR GANESH COMPLAX,AMRELI - 365601 GUJARAT 17-4-2015
1399 ELIXIR TRAINING SERVICES PRIVATE LIMITED GROUND FLOOR, BHAGIRATHI APPT., OFF. GHOLE ROAD, OPP. HOTEL DECCAN RENDEZVOUS, DECCAN, PUNE 17-9-2015
1400 ELYSIUM FOUNDATION 230 CHURCH ROAD ANNA NAGAR MADURAI 14-9-2015
1401 ELYSIUM TECHNOLOGIES PRIVATE LIMITED 230 CHURCH ROAD ANNA NAGAR MADURAI 21-1-2015
1402 EMERGE LEARNING SERVICES PRIVATE LIMITED 60, LUZ CHURCH ROAD, MYLAPORE, CHENNAI, TAMIL NADU 7-11-2013
1403 EMERGE VOCATIONAL SKILLS PRIVATE LIMITED DOOR NO 60, 2ND FLOOR, LUZ CHURCH ROAD,MYLAPORE, CHENNAI 11-9-2014
1404 EMINENT CAREER DEVELOPMENT LINK INSTITUIONS P L HEAD OFFICE NP TOWER WEST FORT NEAR KERALA VARMA THRISSUR 17-9-2015
1405 EMPLOYMENT GENERATION AND MARKETING MISSION TS EMPLOYMENT GENERATION & MARKETING MISSION (EGMM) DEPT. OF RURAL DEVELOPMENT, GOVT. OF TELANGANA D.NO.:6-2-915,4TH FLOOR, REAR BLOCK, HMWSSB, KAIRATABAD, HYDERABAD, TELANGANA 13-5-2016
1406 EMPORIUM TRAINING AND CONSULTANCY PVT LTD 230/B, A.J.C. BOSE ROAD, 3RD FLOOR 12-9-2016
1407 EMPOWERED SKILLS PVT LTD 630, 3RD FLOOR, WEST END MARG, LANE NO 3, KOHINOOE ENCLAVE, SAIDULLAJAB NEW DELHI 13-11-2014
1408 EMPOWER EDUVENTURE PRIVATE LIMITED 12/ 703, MILLENIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY,MULUND (EAST), MUMBAI - 400081 23-5-2016
1409 EMPOWER EDUVENTURE PVT LTD REGD. OFF - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI 24-5-2016
1410 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI 24-5-2016
1411 EMPOWER FOUNDATION OFFICE ADDRESS - A-003, GR. FLOOR, PARIMAL PARK, A WING, HARI OM NAGAR, MULUND (EAST), MUMBAI REGD. OFF ADDRESS - 12/703, MILLENNIUM PARK, HARI OM NAGAR, OFF E E HIGHWAY, MULUND (EAST), MUMBAI 24-5-2016
1412 EMPOWER PRAGATI VOCATIONAL AND STAFFING PVT LTD B 87A KALKAJI, NEWDELHI 24-10-2013
1413 ENCORE DIGITECH PVT LTD 3 LOKENATH APPARTMENT, 1ST FLOOR CANAL STREET, KOLKATA. WEST BENGAL 13-1-2014
1414 ENDEAVOR CAREERS PVT LTD 101 , SUYOJAN TOWER , NEAR PRESIDENT HOTEL , OFF CG ROAD , NAVRANGAPURA , AHMADABAD. 15-1-2015
1415 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON 21-12-2016
1416 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON 14-12-2016
1417 END POVERTY M-48, FIRST FLOOR, SOUTH CITY 1, GURGAON 5-8-2016
1418 ENERGY TOTAL 102, BRIJVATIKA SARFABAD, SECTOR-73 NOIDA U.P 14-3-2016
1419 ENGURU GLOBAL SOLUTIONS PRIVATE LIMITED PLOT NO 44 & 45, FLAT NO 301,JAGRUTHI COLONY,NEAR 8 TH POLICE BETALIAN,KONDAPUR,HYDERABAD 11-1-2016
1420 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS OPP. HABIBGANJ RAILWAY STATION BHOPAL 13-5-2016
1421 ENIZE INFOTECH PRIVATE LIMITED 102 KAMDHENU TOWERS E-2/21 ARERA COLONY BHOPAL 26-4-2016
1422 ENIZE INFOTECH PRIVATE LIMITED 18 SHUBHALAY VIHAR E-8 EXTENTION ARERA COLONY BAWADIYA KALAN BHOPAL MADHYA PRADESH -462026 6-9-2015
1423 ENRICH DEVELOPMENT PRIVATE LIMITED 411, 4TH FLOOR, LUHADIA TOWER, ASHOK MARG, C-SCHEME 11-9-2015
1424 ENTREPRENEURSHIP AND SKILL DEVELOPMENT INSTITUTE 83/130,OLD DISTRICT EMPLOYMENT OFFICE BUILDING,R.S.ROAD,MANGALAPURAM,DINDIGUL 24-6-2015
1425 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES H.NO. 982, 2ND FLOOR, SECTOR -79, MOHALI 29-6-2016
1426 ENTREPRENEURSHIP TRG AND RURAL DEV INITIATIVES #982, 2ND FLOOR, SECTOR 79, MOHALI (PUNJAB) 26-7-2016
1427 ENVIRTA SUSTAINABLE SOLUTIONS INDIA PVT LTD ENVIRTA HOUSE 167/10B VASUNDHARA GHAZIABAD, UTTAR PRADESH 13-9-2015
1428 EOS EDU VENTURES PVT LTD 1626/33, NAIWALA, KAROL BAGH, NEW DELHI 2-9-2016
1429 EOS EDU VENTURES PVT LTD 1626/33 NAIWALA KAROL BAGH, NEW DELHI 22-7-2016
1430 E PARIVARA TRUST DEEVAGADDE, BHIMANAKONE, SAGAR , KARNATAKA - 577401 16-5-2016
1431 ERAYAMANGALAM SRI RANGANATHA PILLAI MEMORIAL EDUCATIONAL TRUST ERAYAMANGALAM SRI RANGANATHA PILLAI MEMORIAL EDUCATIONAL TRUST NO.100,MURUGAPPA REDDY STREET VENKATTAPURAM,AMBATTUR,CHENNAI-6000 53 25-11-2014
1432 ERNST AND YOUNG LLP ERNST & YOUNG LLP GOLF COURSE ROAD, SECTOR 42 , GURGAON 24-6-2015
1433 ERODE ACADEMY 29, THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011 5-1-2017
1434 ERODE ACADEMY THIRU. VI . KA STREET, NEW TEACHERS COLONY, ERODE 638011 9-12-2016
1435 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR, HEPHZIBAH COMPLEX, MANNUTHY,TRICHUR, KERALA 6-4-2016
1436 ESAF MICROFINANCE AND INVESTMENTS PRIVATE LIMITED PB NO 12, 2ND FLOOR HEPHZIBAH COMPLEX, MANNUTHY TRICHUR KERALA 15-3-2016
1437 ESCALADE ENTERPRISES INDIA PVT LTD C-2/2 SECOND FLOOR, JANAKPURI, NEW DELHI 21-10-2016
1438 ESCALADE ENTERPRISES INDIA PVT LTD ESCALADE ENTERPRISES INDIA PVT LTD C-2/2,SECOND FLOOR,JANAKPURI, NEW DELHI-110058 DELHI,INDIA. 22-11-2016
1439 ESCORTS LIMITED ESCORTS CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD 6-10-2016
1440 ESCORTS LIMITED CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD 5-10-2016
1441 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE, 15/5 MATHURA ROAD, FARIDABAD 5-10-2016
1442 ESCORTS SKILL DEVELOPMENT ESCORTS CORPORATE CENTRE 15/5 MATHURA ROAD, FARIDABAD 6-10-2016
1443 ESCUBE IT SERVICES TC 13/1640, AISWARYA , PALM DRIVE LANE, NEAR ST MARY'S CHURCH PATTOM THIRUVANANTHAPURAM KERALA 17-9-2015
1444 ESHWAR TRUST KONDAMPATTI (PO), VADASITHUR (VIA), COIMBATORE 9-4-2015
1445 ESMS ESOURCE CONSULTING PRIVATE LIMITED ESMS ESOURCE CONSULTING PRIVATE LIMITED PLOT NO 18/1, IT PARK, GAYATRI NAGAR, NAGPUR 3-4-2014
1446 ESOLUTIONBPL B-58, KASTURBA NAGAR BHOPAL 1-7-2014
1447 ESSENTIAL AYURVEDEC HEALTHCARE PVT LTD H/O NALETI PO NEHRANPUKHAR TEHSIL DEHRA DISTT, KANGRA HIMACHAL PRADESH 17-4-2014
1448 ESSQUE EDUCATION AND WELFARE TRUST AGI BUILDING OPPOSITE WAVE MALL ,LANE 999 GYM MOHINDER MANSION ,BATHINDI SUNJWAN ROAD,JAMMU 6-10-2016
1449 ESSQUE EDUCATION WELFARE TRUST JAMMU AND KASHMIR AGI BUILDING, SUNJWAN ROAD NEAR WAVE MALL 9-6-2016
1450 ESSQUEE EDUCATION AND WELFARE TRUST JAMMU KASHMIR AGI BUILDING NEAR WAVE MALL SUNJAW ROAD BHANTHINDI 29-6-2016
1451 ESTIRON SOLUTIONS PRIVATE LIMITED 79, SHAMLAL ROAD, DARYAGANJ 13-5-2016
1452 ETERNAL HR SERVICES PRIVATE LIMITED CORP. OFFICE: B-35, SECTOR 57, NOIDA, DISTRICT GAUTAM BUDDHA NAGAR, UTTAR PRADESH 13-1-2014
1453 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED 797, ANNAPURNA, 10TH MAIN ROAD , 4TH BLOCK JAYANAGAR BANGALORE 5-4-2016
1454 ETHNUS CONSULTANCY SERVICES PRIVATE LIMITED NO 33 9TH MAIN ROAD 36TH CROSS, JAYANAGAR, 5TH BLOCK BANGALORE 19-5-2016
1455 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE 30-11-2015
1456 ETHNUS TRAINING AND SKILL DEVELOPMENT PVT LTD NO.797, 10TH MAIN ROAD, JAYANAGAR 4TH BLOCK, BANGALORE 13-4-2016
1457 ETRDI # 982, IIND FLOOR, SECTOR 79, MOHALI (PUNJAB) 6-1-2016
1458 EU JAI VIBISHNAN EDN AND CHARITABLE TRUST 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI 6-9-2016
1459 EVERGREEN EDUCATION TRUST 217,REHARI COLONY,JAMMU 14-10-2016
1460 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU 22-7-2016
1461 EVERGREEN EDUCATION TRUST 149-A, DOGRA HALL, KACHI CHOWNI, JAMMU 14-9-2016
1462 EVERGREEN EDUCATION TRUST Q.NO-217,REHARI COLONY, JAMMU 22-9-2016
1463 EVERGREEN EDUCATION TRUST Q.NO-217, REHARI COLONY, JAMMU (TAWI) J&K 29-9-2016
1464 EVERONN EDUCATION LIMITED SP INFOCITY A BLOCK, I FLOOR # 40 | MGR SALAI KANDANCHAVADI PERUNGUDI, CHENNAI 14-9-2015
1465 EVERONN SKILL DEVELOPMENT LIMITED EVERONN HOUSE, 96-99- INDUSTRIAL ESTATE, PERUNGUDI, CHENNAI, TAMILNADU 28-10-2013
1466 EVERSHINE RESOURCE MANAGEMENT PRIVATE LIMITED G- 303/ 304 SUMER NAGAR BUILDING NO 2, S V ROAD BORIVALI WEST MUMBAI -400092 25-11-2014
1467 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR 9-12-2016
1468 EVERSUN TELELINK INDIA PVT LTD F-148, VAISHALI NAGAR, JAIPUR 14-12-2016
1469 EXALT EDUCATION AND WELFARE SOCIETY PLOT NO. 11, GOMTI COLONY, NEHRU NAGAR, BHOPAL 25-8-2014
1470 EXALTSOFT SOLUTIONS PRIVATE LIMITED PLOT NO.1054, 1059 AND 1060, FLAT NO.503, JNTU ROAD, MANJEERA MAJESTIC, KPHB, KUKATPALLY,HYDERABAD-500072 27-6-2016
1471 EXALTSOFT SOLUTIONS PRIVATE LIMITED # 503, MANJEERA MAJESTIC JNTU ROAD, KPHB, KUKATPALLY, HYDERABAD, TELANGANA -72 9-6-2016
1472 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE - 400604 3-8-2016
1473 EXCEL ADVERTISING PRIVATE LIMITED 3/B, SURYA DARSHAN TOWER, NEAR NITIN CO, ESIS HOSPITAL ROAD, THANE WEST - WAGLE ESTATE, THANE 8-8-2016
1474 EXCEL INFOCOM PVT LTD E-405, CITY CENTER, DC BLOCK, SECTOR -1, SALT LAKE, KOLKATA 30-8-2016
1475 EXCEL INFOCOM PVT LTD E405, CITY CENTRE, DC BLOCK,SECTOR I, SALT LAKE,KOLKATA 2-9-2016
1476 EXCELLENT SOCIAL AND EDUCATIONAL TRUST BHAVANI NILAYA PRASHANTHI NAGAR KOPPAL ROAD. 24-5-2016
1477 EXCELLENT SOCIETY 21 WEST SHIVAJI NAGAR AGRA 23-12-2016
1478 EXCEL TECHNOVATION PRIVATE LIMITED B-101, SUMER COMPLEX, F-174, GAUTAM MARG, BEHIND BAGADIYA BHAWAN, C-SCHEME, JAIPUR 5-1-2017
1479 EXMAN SECURITY SERVICES PRIVATE LTD 14/482,MANIFIT MARKET,PO-TELCO,JAMSHEDPUR,JHARKHAND INDIA 15-1-2015
1480 EXPERTZ SERVICES 325, SHIV PURI BEHIND ITI YAMUNA NAGAR 21-8-2014
1481 EX SERVICEMEN MULTIPURPOSE SERVICES INDIA PVT LTD ESMS(I) PVT LTD. PLOT NO 18/1, IT PARK, GAYATRI NAGAR NAGPUR 22-10-2013
1482 EXTRA EDGE INFOMEDIA PVT LTD 331, SOUTH EX PLAZA2, MASJID MOTH, SOUTH EXTENSION PART 2, DELHI 16-9-2015
1483 FACE FACILITATION AND AWARENESS OF COMMUNITY FOR E 10/1356, BEHIND LOOK HOUSE, SHIV NAGAR REWA M.P. 30-8-2016
1484 FACILITATION AND AWARENESS OF COMMUNITY FOR EMPOWERMENT FACE 10/1329, NEAR LOOK HOUSE, SHIV NAGAR, REWA, M.P. 22-9-2016
1485 FAIR AND THE EXPERT EDUCATIONAL SOCIETY `128/6 C BLOCK KIDWAI NAGAR KANPUR-11 (U.P.) 11-1-2016
1486 FAIR AND THE EXPERT EDUCATIONAL SOCIETY 128/6 C BLOCK KIDWAI NAGAR KANPUR 12-1-2016
1487 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE DT 23-12-2016
1488 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY NO. 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE 21-10-2016
1489 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9 RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE. 29-12-2016
1490 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE. 17-9-2015
1491 FAITH EMPLOYMENT EDUCATIONAL TRAINING SOCIETY 23/9, RAMASAMY DESIGAR STREET, SALAVANPET, VELLORE 9-12-2016
1492 FAKAT NARI SHIKSHAN AND SAMAJIK SANTHAN SAMITI H NO 01 VASSPUSHP MITRA NIWAS ROAD GITA MANDIR ROAD KE PASS RATLAM TESHIL RATLAM DIST RATLAM 11-1-2016
1493 FAKIRA BAHUDDESHIYA SEVABHAVI SANSTHA BALIRAMPUR AT.POST.BALIRAMPUR TQ&DIST.NANDED 28-9-2016
1494 FAKIRA BAHUDDESHIY SAVABHAVI SANSTHA BALIRAMPUR AT.POST.LAHUJINAGAR BALIRAMPUR 29-12-2016
1495 FAKIRA BAHUUDDESHIY SEVABHAVI SANSTHA BALIRAMPUR AT POST LAHUJI NAGAR BALIRAMPUR 15-3-2016
1496 FAKIRA BAHUUDHESHIYA SAVABHIVI SANTHA BALIRAMPUR AT.POST.LAHUJI NAGAR BALIRAMPUR 9-12-2016
1497 FAST DIAL SERVICES PVT LTD A WING ,3RD FLOOR, JAGDAMBA TOWER, SAHDEO MAHTO MARG BORING ROAD 11-11-2014
1498 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM 4-11-2016
1499 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08 ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM 23-11-2016
1500 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANMANAI CAMPUS,ARANMANAI,RAMANATHAPURAM 16-12-2016
1501 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08.ARANMANAI CAMPUS,ARANMANANAI,RAMANATHAPURAM 12-1-2016
1502 FATHIMA EDUCATIONAL AND CHARITABLE TRUST 08,ARANAMNAI CAMPUS,ARANMANAI,RAMANATHAPURAM 11-8-2016
1503 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET KRISHANA COLONY 6-1-2016
1504 FEALTY CONSULTANT PRIVATE LIMITED H NO 193/8, KODA RAM DEPOT STREET, KRISHANA COLONY 24-11-2015
1505 FEDCROT 1A ARUNACHALAM STREET, NORTH GATE S.S.COLONY, MADURAI 11-2-2015
1506 FEMINA INSTITUTE OF COMPUTERS AND FASHION DESIGNIN H.NO. 5-4-145, POCHAMMA GALLI, KHALEELWADI, NIZAMABAD , TELANGANA 8-4-2016
1507 FIDELIS CORPORATE SOLUTIONS PRIVATE LIMITED PRESTIGE TERMINUS - 2, UNIT NO.210 & 211, BUILDING NUMBER - 14, OLD AIRPORT EXIT ROAD, BANGALORE 13-11-2013
1508 FIDELIS IT SOLUTIONS PRIVATE LIMITED 2ND FLOOR SABA COMPLEX NEW BUSSTAND BUDGAM J&K 10-2-2016
1509 FIDELIS IT SOLUTIONS PRIVATE LIMITED NEW BUS STAND BUDGAM J&K 16-11-2016
1510 FIRST EDUINDIA LIMITED 14/3, THIRD FLOOR, ABOVE CHEVROLET SHOWROOM, LANDMARK-OPP. HAVELLS COMPANY, MAIN MATHURA ROAD, FARIDABAD 21-8-2015
1511 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR UTTAR PRADESH. 17-5-2016
1512 FIZA EDUCATION SOCIETY MOHAN KUTI, MAMAN ROAD, BULANDSHAHR 8-1-2016
1513 FIZA EDUCATION SOCIETY MOHAN KUTI MAMAN ROAD BULANDSHAHR 16-3-2016
1514 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI, MAMAN ROAD, BULANDSHAHR U.P 11-5-2016
1515 FIZA EDUCATION SOCIETY BILLAH HOUSE,MOHAN KUTI, MAMAN ROAD, BULANDSHAHR 26-4-2016
1516 FIZA EDUCATION SOCIETY BILLAH HOUSE, MOHAN KUTI,MAMAN ROAD, BULANDSHAHR, UTTAR PRADESH, INDIA 2-6-2016
1517 FLEXIMAX SOFTWARE PRIVATE LIMITED FLEXIMAX SOFTWARE PRIVATE LIMITED FLAT NO 204, SAIDATTA RESIDENCY, JEEDIMETLA VILLAGE, KOMPALLY, HYDERABAD-500062. 25-11-2014
1518 FLORENCE HOME FOUNDATION NO.6,MUTHUKUMARAN STREET, PUDUPALAYAN, CUDDALORE 17-9-2015
1519 FOCUS EDU CARE PVT LTD 119/1, 2ND FLOOR, SRINIDHI COMPLEX, 11TH CROSS ROAD, OPP SAMPIGE ROAD, MALLESHWARAM, BANGALORE 16-1-2014
1520 FOCUS SKILLPRO PVT LTD A3, HILL RIDGE VILLAS, ISB RAOD, GACHIBOULI HYDERABAD 21-10-2013
1521 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO.1, SECTOR-31 B,I,M.T. POST OFFICE (KEHRI SADH)ROHTAK 18-11-2016
1522 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE PLOT NO. 1, SECTOR 31 B, I>M>T> ROHTAK HARIYANA 22-12-2016
1523 FOOTWEAR DESIGNE AND DEVELOPMENT INSTITUTE FDDI,PLOT NO 1,SECTOR 31 B, I.M.T. ROHTAK HARIYANA 5-12-2016
1524 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI 28-12-2015
1525 FORESIGHT EDUTECH PVT LTD 404, AVALON APARTMENTS, MG ROAD, MANGLAPURI, OPP METRO PILLAR 46, NEW DELHI 11-1-2016
1526 FORESIGHT EDUTECH PVT LTD 404,AVALON APARTMENTS, MANGLAPURI, MG ROAD, NEW DELHI 18-1-2016
1527 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELHI 26-7-2016
1528 FORESIGHT SERVICE PRIVATE LIMITED G41-A, 2ND FLOOR, KALKA JI – I, NEW DELH 15-3-2016
1529 FORSAN HEALTHCARE PRIVATE LIMITED E-26 GROUND FLOOR, M BLOCK MARKET ROAD, GREATER KAILASH 1, DELHI - 110048 5-8-2016
1530 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO: 102, 55/71, KARKARDOOMA, DELHI 14-12-2016
1531 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO. 102, 55/71, KARKARDOOMA , DELHI 4-11-2016
1532 FORTUNE BATH AND INTERIORS PRIVATE LIMITED OFFICE NO : 102, 55/71, KARKARDOOMA, DELHI 9-12-2016
1533 FORUM FOR INTEGRATED DEVELOPMENT AND RESEARCH PLOT-27, FOREST PARK, BHUBANESWAR 18-9-2015
1534 FORUS HEALTH PVT LTD 2234, 23RD CROSS, BANASHANKARI 2ND STAGE, BANGALORE- 560 070, INDIA. 2-2-2015
1535 FOUNDATION FOR INFRASTRUCTURE AND NATIONAL DEVELOP H.NO. 450/33, GROUND FLOOR, STREET NO. 33, ONKAR NAGAR C., TRI NAGAR, DELHI 23-10-2015
1536 FOUNDATION OF MODERN STUDIES AND SOCIAL WELFARE INSTITUTE OF OF MODERN STUDIES A-128, SEWAK PARK, DWARKA MOR,UTTAM NAGAR, NEW DELHI 23-10-2015
1537 FOURGEE INFOTECH NEW PLOT, NEAR PRIMARY SCHOOL, TAHARABAD ROAD, SATANA, TAL.BAGLAN DIST.NASHIK STATE-MAHARASHTRA PIN-423301 23-6-2015
1538 FOXFIRE SERVICES AND IT SOLUTION PRIVATE LIMITED SAKET SADAN, KITAB BHAWAN LANE, NORTH S K PURI, PATNA 15-9-2015
1539 FREEDOM 2, HIMSURA BHAWAN, ASHOK NAGAR, PULBOGDA, RAISEN ROAD, BHOPAL, M.P. 1-6-2016
1540 FREEDOM SOCIETY FREEDOM CAMPUS, PLOT NO. 1, 2ND & 3RD FLOOR, DIL KUSHA BAGH, RAISEN ROAD, PUL BOGDA, BHOPAL (M.P.)-23 14-9-2015
1541 FRIENDS COMPUTER EDUCATION SOCIETY NEAR EDGAH POLICE CHOWKI SHAMLI ROAD MUZZAFFAR NAGAR 9-12-2016
1542 FRIENDS COMPUTER EDUCATION SOCIETY R/O- B-28/2,KH 367, ABDUL FAZAL ENCLAVE-II, PLOT NO 085, T.NO.JHA SHAHEEN BAGH, DELHI-110025 CORRESPONDING ADDRESS:- NEAR EIDGAH POLICE CHOWKI, SHAMLI ROAD, MUZZAFFARNAGAR 22-12-2016
1543 FRONTLINE GLOBAL SERVICES PAHARI MANDIR LANE, RATU ROAD, RANCHI - 01 15-9-2015
1544 FRONTLINE GLOBAL SERVICES PRAGATI COLLEGE CAMPUS, PAHARI MANDIR LANE, RATU ROAD, 2-6-2014
1545 FRONTLINE NCR BUSINESS SOLUTIONS PRIVATE LIMITED B-48,FRONTLINE HOUSE, NARAINA INDUSTRIAL AREA, PHASE II, NEW DELHI. 21-10-2014
1546 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE (VIP ROAD), KRISHNAPUR, KOLKATA 23-11-2016
1547 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA 21-12-2016
1548 FROSTEES EXPORT INDIA PVT LTD FROST HOUSE, PP 101, NAZRUL ISLAM AVENUE(VIP ROAD), KRISHNAPUR, KOLKATA 9-12-2016
1549 FUNCTIONAL VOCATIONAL TRAINING RESEARCH SOCIETY # 19, 3RD CROSS, HUTCHINS ROAD, ST. THOMAS TOWN POST, BANGALORE 11-6-2014
1550 FUNFIRST GLOBAL SKILLERS PRIVATE LIMITED B-4/596, SAI BABA CHSL, SAI BABA COMPLEX, GOREGAON (E)MUMBAI 8-11-2013
1551 FUTURE COMPUTER EDUCATION TRUST NO.546, 1ST FLOOR, SELVA PRABHA COMPLEX, PUBLIC OFFICE ROAD, VELIPALAIYAM, NAGAPATTINAM. 9-4-2015
1552 FUTURE CORPORATE RESOURCES LIMITED TOWER C, 247 PARK, 8TH FLOOR, LBS MARG, VIKHROLI WEST, MUMBAI 17-10-2013
1553 FUTURE EDUCATIONAL AND EMPOWERMENT SOCIETY HIG-07, OPP: SBI BANK, APHB COLONY, MIRYALAGUDA - 508207, NALGONDA DISTRICT ANDHRA PRADESH 7-1-2016
1554 FUTURE EDUCATION SOCIETY 603 FUTURE EDUCATION SOCIETY C/O HARTRON COMPUTER CENTER GOHANA ROAD NEAR RAIN TALAB JIND HARYANA 23-5-2016
1555 FUTURE SHAPE SOCIAL EDUCATIONAL SOCIETY 1,2 CHANAKYAPURI NEAR M.B INTER COLLEGE BELOW BANK OF BARODA NAINITAL ROAD BAREILLY 243014 17-9-2015
1556 FUTURE SHARP SKILLS LIMITED FUTURE RETAIL HOME OFFICE, 8TH FLOOR, TOWER C, 247 PARK, L.B.S. MARG, VIKHROLI WEST, MUMBAI 16-10-2013
1557 FUTURESKILL SOLUTIONS PRIVATE LIMITED 1ST FLOOR, EDUCOMP TOWERS, PLOT NO - 514, UDYOG VIHAR, PHASE - 3, GURGAON 14-10-2015
1558 FUTURE TECHNICAL EDUCATION SOCIETY NH2, BHIRINGI MORE, OPPO. CISF CAMP, DURGAPUR 15-3-2016
1559 FUTURE VISION AIDE PRIVATE LIMITED ROOM NO.101, 1ST FLOOR 37A BENTICK STREET, KOLKATA 12-9-2015
1560 FUTURE WIZ ADVERTISING PRIVATE LIMITED FUTURE WIZ ADVERTISING PRIVATE LIMITED 1ST FLOOR, NRI PLAZA, MAIN ROAD, RAJEEV NAGAR PATNA, BIHAR 29-3-2014
1561 FYNE CUBE LEARNING PRIVATE LIMITED 124 (60) B.L.SAHA ROAD,TOLLYGUNGE, KOLKATA 3-1-2014
1562 G4S SECURE SOLUTIONS INDIA PVT LTD 82 A PANCHWATI SECTOR 18 GURGAON 14-7-2014
1563 GAAT FOUNDATION TRUST SATYAJALAY RUPPUR PO JEMO RAJBATI PS KANDI DIST MURSHIDABAD WEST BENGAL 5-9-2016
1564 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40 B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR 23-2-2016
1565 GAAYATHRIDEVI WOMENS DEVELOPMENT TRUST 40B, BUILDING SOCIETY, PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR 5-1-2016
1566 GAAYATHRI WOMENS DEVELOPMENT TRUST NO:-40B PANCHAYATH UNION OFFICE ROAD, CHINNAMANUR 12-9-2015
1567 GAGAN INFOTECH SERVICES PVT LTD 21, SANGANAK BHAWAN, PANCHAYAT SAMITI COLONY, GOVINDPUR ROAD, GONDIA 8-4-2016
1568 GAIT ICTL EDUCATION SOCIETY GAIT ICTL EDUCATION SOCIETY NEAR KANWATIA HOSPITAL OPP. SONKHYA HOSPITAL SHASTRI NAGAR JAIPUR - 302016 RAJASTHAN MOB - 09828063784 29-6-2016
1569 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELA MAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA 9-8-2016
1570 GAJALAKSHMI SOFTWARE SYSTEMS PVT LTD FLAT NO. 501 TO 503, SRI VIGNESH TOWERS, TIRUMALA BYPASS ROAD, NEAR LEELAMAHAL JUNCTION, TIRUPATI - 517501, ANDHRA PRADESH, INDIA 8-7-2016
1571 GAJANAN SHIKSHA SAMITI FOR AITM RAJNANDGAON SHITAL CHHAYA RESTORENT GRAM- TORANKATTA POST- SOMNI DISST- RAJNANDGAON PIN-491441 4-1-2016
1572 GALAXY THE GLOBAL 150, NEAR MAIN ROAD, MADHPARA P/O+P/S+DIST-PAKUR STATE-JHARKHAND 26-4-2016
1573 GALSI MODERN COMPUTER MISSION VILL,PO,PS-GALSI, DIST-BURDWAN, PIN-713406 28-9-2016
1574 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI, DIST-BURDWAN, PIN-713406, WEST BENGAL 9-2-2016
1575 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI 9-9-2016
1576 GALSI MODERN COMPUTER MISSION VILL+PO+PS-GALSI 28-1-2016
1577 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI 9-9-2016
1578 GALSI RURAL EDUCATIONAL SOCIETY VILL+PO+PS-GALSI 29-11-2016
1579 GANAPATI FOUNDATION TRUST AT-GOPINATHPUR,MATHASAHI,BHAIRPUR,JAGATPUR,CUTTACK-754200 13-1-2017
1580 GANAPATI FOUNDATION TRUST AT-GOPINATHAPUR,MATHA SAHI,BHAIRPUR,JAGATPUR 17-1-2017
1581 G AND G EDUCATION SOCIETY MAIN BAZZAR , NEAR POST OFFICE RAIPUR RANI DISTT-PANCHKULA, HARYANA-134204 21-10-2016
1582 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME COMPLEX, RAIPUR RANI PANCHKULA, HARYANA-134204 9-12-2016
1583 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME, COMPLEX RAIPUR RANI 6-10-2016
1584 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, PANCHKULA,HARYANA 3-11-2016
1585 G AND G SKILLS DEVELOPERS PRIVATE LIMITED GUPTA NURSING HOME,COMPLEX RAIPUR RANI, DISTT- PANCHKULA, HARYANA-134204 21-9-2016
1586 GANDHI CHARITABLE TRUST C/O GANDHI ASHOK,GANDHI HOSPITAL,KADA TQ.ASHTI DIST-BEED (MAHARASHTRA) 13-7-2016
1587 GANDHI FOUNDATION 33, GANDHIPURAM (OPP. TO GOVT. HOSPITAL) TIRUVALLORE -602001 TAMILNADU 11-8-2014
1588 GANDHI MANAV KALYAN SOCIETY 19,KAMLA NAGAR ,100 FT SHOBHAGPURA ROAD, NEW BHOPALPURA,UDAIPUR.(RAJASTHAN) 22-12-2013
1589 GANTAVYA SEWA SANSTHAN H-6, NEW PENTION BADA, BLOCK-DHARSIWA, DISTT RAIPUR, CHHATISGARH 12-5-2016
1590 GARDENIA INFRA LLP GARDENIA INFRA LLP ; PLOT NO 9 ; SECTOR 75 ; NOIDA 23-6-2016
1591 GARDENIA INFRA LLP GARDENIA INFRA LLP; PLOT NO 9 ; SECTOR 75 ; NOIDA 26-7-2016
1592 GA SOFTWARE TECHNOLOGIES PRIVATE LIMITED NO.24,LEVEL 1,1ST CROSS,MAGRATH ROAD, BANGALORE 23-12-2013
1593 GATES FINISHING SCHOOL GATES FINISHING SCHOOL,17-1-2011/3/B/3 SANTOSH NAGAR COLONY SAIDABAD POST OPP SRINIVASA HOSPITAL HYDERABAD 20-7-2016
1594 GATES FINISHING SCHOOL 17-1-211/3/B/3 SANTOSH NAGAR SAIDABAD HYDERABAD 9-8-2016
1595 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A-43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR 4-8-2016
1596 GATEWAY EDUCATIONAL AND WELFARE SOCIETY A- 43 GURU NANAK COLONY, BACK SIDE NAINA DEVI MANDIR, NEAR BUS STAND, SANGRUR Mob. : 98780-00928, 9216800926 26-8-2016
1597 GATI ACADEMY GATI ACADEMY, PLOT NO: 17, ROAD NO: 42, PHASE III, BEHIND APSRTC BUS DEPOT, JEEDIMETLA, HYDERABAD - 500055. 5-6-2014
1598 GAUTAM BUDDHA EDUCATIONAL TRUST VILLAGE - NAGRA (BABAI) , POST - ITTAHIYA , DIST.- JALAUN 8-5-2015
1599 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD,TUNDLA 14-10-2015
1600 GAUTAM BUDH WELFARE SOCIETY NH-2, AGRA ROAD, MOHAMDABAD, TUNDLA 4-1-2016
1601 GAYATRI COLLEGE BHATA CHOUK GARIA DIH 8-9-2014
1602 GAYATRI EDUCATIONAL SOCIETY #164 PRAKASAM ROAD, TIRUPATI 3-4-2014
1603 GAYATRI EDUCATION AND TRAINING FOUNDATION 1, SHAKTIPARK SOCIETY, BEHIND DEVDARSHAN COMPLEX, RAJMAHEL ROAD, PATAN GUJRAT 5-9-2016
1604 GAYATRI EDUCATION AND TRAINING FOUNDATION 01, SHAKTIPARK B/H DEVDARSHAN COMPLEX RAJMAHEL ROAD PATAN 15-9-2016
1605 GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL JETPUR ROAD, GONDAL 11-5-2016
1606 GAYATRI INFRASTRUCTURE LTD GAYATRI HOUSE NR MAITRI AVENUE ASHOK VIHAR SABARMATI GANDHINAGAR HIGHWAY MOTERA AHMEDABAD 23-6-2016
1607 GAYATRI PARIVAR SEWA SAMITI 247,1ST FLOOR,MANAS ENCLAVE,LUCKNOW 3-2-2014
1608 GAYTRI MAHILA BALGYAN SAMITI QTR NO 175 , WARD NO. 2 , GRAM PANCHYAT MOWA , TAHSIL DIST RAIPUR CG 14-9-2015
1609 GCS COMPUTER TECH PVT LTD REGISTERED OFFICE : SCF-34,DUKHNIWARAN SAHIB MARKET, PATIALA-147001, CORPORATE OFFICE:-SCO- 162-163,SECTOR 9-C,CHANDIGARH-160017 9-11-2013
1610 GDR EDUCATIONAL SOCIETY RUNGTA BHAWAN, G.E. ROAD, GANJPARA, BLOCK & DISTRICT - DURG STATE : CHHATTISGARH 17-1-2017
1611 GEETA ADARSH EDUCATIONAL RESEARCH SOCIETY VILL:MEHRA, PO:BAKALI, TEHSIL:LADWA, DISTT:KURUKSHETRA 4-1-2016
1612 GEMS EDU TECH SERVICES PVT LTD SCF 28, IIND FLOOR, SECTOR 65, MOHALI 29-4-2015
1613 GEMS SKILLS INDIA PRIVATE LIMITED 401 B WING, FOURTH FLOOR, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, CTS NO 185-1/3 17-5-2016
1614 GEMS SKILLS INDIA PRIVATE LIMITED 401, B WING, 4TH FLOOR, CTS NO 185-1/3, LOTUS CORPORATE PARK, OFF WESTERN EXPRESS HIGHWAY, GOREGAON WEST, MUMBAI 30-5-2016
1615 GENERAL MOVEMENT FOR RURAL EDUCATION AND ENVIRONMENT GREEN 22, SAMYKULAM 4TH STREET, CHINNAMANUR - 625 515, THENI DISTRICT, TAMIL NADU INDIA 25-11-2014
1616 GENUINESOFT ST.HINDUCOLLEGE ROAD 17-9-2015
1617 GENUINESOFT 110/2-HOLYCOTTAGE, MARAVANKUDIERUPPU, NAGERCOIL-2, TAMILNADU, INDIA-629002 3-2-2015
1618 GENUINESOFT TRUST 142E, ST.HINDU COLEGE ROAD, CHETTIKULAM JUNCTION, NAGERCOIL - 2, KANYAKUMARI DISTRICT. TAMILNADU, INDIA 19-8-2015
1619 GENUINESOFT TRUST ST.HINDUCOLLEGE ROAD OPP KURUNCHI HOTEL BEACH ROAD CHETTIKULAM JUNCTION TAMILNADU, KANYAKUMARI DISTRICT NGERCOIL-629002 15-9-2015
1620 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64,GES HOUSE, SAHAKAR NAGAR KHATIPURA ROAD JHOTWARA JAIPUR 18-9-2015
1621 GEOMATICS ENVIRONMENTAL SOLUTONS PRIVATE LIMITED 64, SAHAKAR NAGAR, KHATIPURA ROAD, JHOTWARA, JAIPUR - 302012 18-9-2015
1622 GFEN SERVICES PRIVATE LIMITED HEAD OFFICE -M-3, A10 -11 BHANDARI HOUSE COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI - 110009, REGIONAL OFFICE - C/O TINKU KUMAR, RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA, POSTAL PARK, PATNA-800001 29-11-2016
1623 GFEN SERVICES PRIVATE LIMITED H.O - M-3, A10-11 BHANDARI HOUSE, COMMERCIAL COMPLEX, DR. MUKHARJEE NAGAR, DELHI 110009 R.O - RAM NAGAR, FLAT NO - 112, STREET NO - 01, BANGALI TOLA , POSTAL PARK, PATNA 5-10-2016
1624 GFHDYHDBAH VSGYCGDHFGSDY 13-5-2016
1625 GFHDYHDBAH QSDWEFWE 11-5-2016
1626 GHAZIABAD MECHFAB PRIVATE LIMITED E35/1 , KAVI NAGAR INDUSTRIAL AREA, SECTOR - 17, GHAZIABAD 7-1-2015
1627 GIAN SAGAR EDUCATIONAL AND CHARITABLE TRUST RAM NAGAR, RAJPURA, PATIALA, PUNJAB, KALOMAJRA- 16-3-2016
1628 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA - 700124 11-1-2016
1629 GIGABYTE INFOCOMM PVT LTD 233/1, KALPATARU APARTMENT, 1ST FLOOR, TAKI ROAD, BARASAT, KOLKATA- 700124, WEST BENGAL 5-2-2016
1630 GIRIJA INFRASTRUCTURE PVT LTD OFFICE NO.02, MANGAL MURTI DARSHAN CHSL, GANESH WADI, NEAR KAUSHALYA HOSPITAL. THANE -W 12-8-2015
1631 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150 27-9-2016
1632 GIR PACHHAT JATI VIKAS SEVA SAMITI NEAR BASSTEND AT-MADHUPUR TA-TALALA DIST-GIRSOMNATH 362150 6-10-2016
1633 GITA GRAMIN VIKAS SANSTHAN BEHIND SHAKTI FILLING CENTER DELHI ROAD SAHARANPUR 7-1-2016
1634 GITANJALI GEMS LIMITED OFFICE NO. A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051 13-1-2017
1635 GITANJALI GEMS LIMITED OFFICE NO A-1, 7TH FLOOR, LAXMI TOWER, BANDRA KURLA COMPLEX, BANDRA (E), MUMBAI 400 051 19-1-2017
1636 G K CHARITABLE EDUCATIONAL TRUST UNIVERSE INDUSTRIAL SCHOOL 153, KATPADI ROAD, VIRUTHAMPET, VELLORE. VELLORE DISTRICT. TAMILNADU. 25-8-2015
1637 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA 14-10-2015
1638 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA JAMMU 17-5-2016
1639 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA 6-10-2016
1640 G K EDUCATIONAL TRUST DURGA VIHAR TOLL POST NAGROTA 9-12-2016
1641 G K EDUCATIONAL TRUST TOLL POST NAGROTA 11-11-2016
1642 GKERD TRUST 75A, PUTHUKKUDDY STREET, (UP STAIR) NAGERCOIL 7-1-2016
1643 G K INSTITUTE OF TRAINING AND RESEARCH JAMMU 22-6-2015
1644 GLOBAL CAREER MAKERS FOUNDATION DASHMESH NAGAR, STREET SETIA RESTAURANT, NEAR PHERUMAN CHOWK, KOTKAPURA 5-4-2016
1645 GLOBAL COMPUTER INFORMATION TECHNOLOGY IST FLR, PANCHAYATH SHOPPING COMPLEX AROOR P O ALAPPUZHA, KERALA 30-4-2015
1646 GLOBAL COMPUTER INSTITUTIONS NO.136, SYED COMPLEX, T V MALAI ROAD 6-4-2016
1647 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA 25-7-2016
1648 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA 6-4-2016
1649 GLOBAL EDUCATION PRIVATE LIMITED LEVEL 11, UNIT 1102, PENINSULA BUSINESS PARK , SENAPATI BAPAT MARG, LOWER PAREL , MUMBAI-400013, MAHARASHTRA, INDIA 31-8-2016
1650 GLOBAL ENERGY PRIVATE LIMITED 6TH LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI 26-7-2016
1651 GLOBAL GOLD FOUNDATION PVT LTD GLOBAL GOLD FOUNDATION PVT LTD, 344,KONNUR HIGH ROAD, AYANAVARAM 9-9-2015
1652 GLOBAL HEALTH ALLIANCE B-11, HILANSH APARTMENTS, SECTOR-10, DWARKA, NEW DELHI 24-8-2016
1653 GLOBAL HOTEL MANAGEMENT AND EDUCATIONAL SOCIETY # 2-5-678,OPP: SUBEDARI POST OFFICE,SUBEDARI,HANAMKONDA,WARANGAL,ANDHRA PRADESH -506001 20-11-2013
1654 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA 30-10-2015
1655 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR ODISHA 7-1-2016
1656 GLOBAL INFOTECH AT/PO-JARAKA VIA-DHARMASALA DIST-JAJPUR 14-10-2015
1657 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA 8-12-2015
1658 GLOBAL INSTITUTE OF MANAGEMENT AT - HANSPAL, PO - NAHARKANTA, BHUBANESWAR, DIST -KHORDHA, PIN -752101 BLOCK - BALIANTA 14-10-2015
1659 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR, ASANSOL 16-1-2017
1660 GLOBAL NATIONAL INSTITUTE OF TECHNOLOGY CHINAKURI BAZAR,ASANSOL 13-1-2017
1661 GLOBAL REACH IT CONSULTANTING SERVICES PVT LTD 2ND FLOOR, NAWANDAR HOUSE,1156,OPP. PENOSH BUILDING, SAIFI STREET, 1000 OKS HOTEL, M G ROAD, PUNE 411001 16-6-2016
1662 GLOBAL RURAL DEVELOPMENT ORGANIZATION VILL USMANPUR, POST PATIYALI, DISTT KASGANJ 11-9-2015
1663 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHASTRI NAGAR, BAWER ROAD, NEAR P.D. GIRLS INTER COLLAGE, MOHAMMADABAD 12-5-2016
1664 GLOBAL RURAL DEVELOPMENT ORGANIZATION SHANTI NAGAR, SANJAY GANDHI COLONY 26-4-2016
1665 GLOBAL SKILL DEVELOPMENT TRUST 1865, SUBAM CLINIC BUILDING, SECOND FLOOR, CANARA BANK UPSTAIRS, RAMANATHAPURAM, TRICHY ROAD, COIMBATORE 23-11-2016
1666 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI 11-11-2016
1667 GLOBAL SUCCESS FOUNDATION 5TH FLOOR, TOWER A, AGGARWAL TRADE CENTRE, SECTOR 11, CBD BELAPUR, NAVI MUMBAI 19-10-2016
1668 GLOBAL TALENT TRACK PVT LTD 6TH FLOOR, DELTA II, GIGASPACE, VIMAN NAGAR, PUNE 3-2-2014
1669 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR 16-2-2016
1670 GLOBE AT-JAMUNIYA, PO-MAJHARIYAKISHUN, PS-JAGDISHPUR, DIST-WEST CHAMPARAN, BIHAR 11-3-2016
1671 GLOBE AT-JAMUNIYA, PO-MAJHARIYA KISHUN, PS-JAGDISHPUR 30-11-2015
1672 GLOBE SECURITY SERVICES PLOT NO 109, VIJAY VIHAR, ADJOINING PARK CENTRA, GURGAON 10-11-2014
1673 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA 14-10-2015
1674 GLOBE SECURITY SOLUTIONS PRIVATE LIMITED PLOT NO.-109, VIJAY VIHAR, GURGAON, HARYANA 14-9-2015
1675 GLOBSYN TECHNOLOGIES LIMITED GLOBSYN CRYSTALS, 1ST FLOOR, XI/11 & 12, BLOCK EP, SECTOR-V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA 31-10-2013
1676 GLOCAL KNOWLEDGE AND SKILLS INTEGRATION SYSTEMS PRIVATE LTD 3A-202, ECOSPACE BUSINESS PARK ACTION AREA-II RAJARHAT KOLKATA 700156 17-3-2016
1677 GLOSSARYSOFTTECH PVT LTD FLAT NO 509,5TH FLOOR,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER ,SECUNDRABAD 16-3-2016
1678 GLOSSARYSOFTTECH PVT LTD FLAT NO #509,5TH FLOOR ,NAVAKETHAN COMPLEX,OPPOSITE CLOCK TOWER,SECUNDRABAD 15-3-2016
1679 GLOSSARYSOFTTECH PVT LTD CHANDRA MOULI NAGAR 4/2,NEAR IIT BHASHYAM SCHOOL,BEHIND IDBI BANK,GUNTUR 23-6-2016
1680 GLOSSARYSOFTTECH PVT LTD NAVAKETHAN COMPLEX,5TH FLOOR,509,OPPOSITE CLOCK TOWER,SECUNDRABAD 4-4-2016
1681 GMK SKILLS FLAT NO301, SAI ABHINAY ENCLAVE, RAMAGIRI, NALGONDA 30-11-2016
1682 GMR VARALAKSHMI FOUNDATION 3RD FLOOR, AERO TOWERS, RGIA CAMPUS, SHAMSHABAD, RANGAREDDY (DT) AP, INDIA 22-12-2013
1683 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374, BHARATHI NAGAR,1ST STREET, VENGAIVASAL, CHENNAI 600073 3-3-2016
1684 G M SHIPTECH TRAINING PRIVATE LIMITED 1/374,BHARATHI NAGAR, 1ST STREET, VENGAIVASAL, CHENNAI 6-1-2016
1685 GNANADEEPAM TRUST 1029-6 SOUTH STREET , VIRALIMALAI , ILLUPUR -TALUK PUDUKOTTAI - DISTRICT TAMILNADU INDIA 17-9-2015
1686 GNANAMMAL INTEGRATED RURAL WOMEN DEVPT SOCIETY J. N. ROAD, TIRUVALLUR 15-9-2015
1687 GNANA SUDHA EDUCATIONAL SOCIETY GNANA SUDHA EDUCATIONAL SOCIETY # 17-1-388/61/A, LAXMI NAGAR, SAIDABAD HYDERABAD.A.P CONTACT NO : + 91-9246864680 EMAIL: GNANASUDHA2010@GMAIL.COM 30-1-2014
1688 GOBINDAPUR SEPHALI SAMAJ SEBA SAMITY VILL. GOBINDAPUR, PO. KELETI, PS. AUSHGRAM, DIST. BURDWAN, WEST BENGAL - 713128 17-8-2016
1689 GOD ORGANIZATION TRUST 4178,EAST 2ND ST, PUDUKKOTTAI 14-9-2015
1690 GOKALDAS EXPORTS LIMITED NO.70, MISSION ROAD, BANGALORE, KARNATAKA 4-3-2016
1691 GOKULAM EDUCATIONAL TRUST NO:9/15-B, VIJAYALAKSHMI STREET,KAMARAJ NAGAR,PEERKANKARANAI 11-8-2016
1692 GOLDEN FUTURE EDUCATIONAL NETWORK PRIVATE LIMITED H.O- 262/A, DHIRPUR, MAIN ROAD, NIRANKARI COLONY, NEAR GURUDWARA, NORTH CAMPOUS, SELHI, PIN- 110009 RESIONAL OFFICE- 2ND FLOOR, ROOP BHAWAN, RAMSUCHIT MISHRA PATH, NEAR MAHENDRA INSTITUTE, EAST BORING CANAL ROAD, PATNA 9-4-2015
1693 GOLDEN FUTURE FOUNDATION OF INDIA 241/23, BHAGAT SINGH CHOWK, CIRCULAR ROAD, ROHTAK 21-9-2015
1694 GOLDEN FUTURE FOUNDATION OF INDIA CHAMARIA, ROHTAK (HARYANA) 13-9-2015
1695 GOLDEN GREENOPPORTUNITIES NO.147/2 KALLAI MAIN ROAD, INDIAN BANK UPSTAIRS, SANKARAPURAM AND POST, VILLUPURAM DISTRICT, TAMILNADU, INDIA. AUTHORISED PERSON: MS.A FARITHA BANU MOBILE: +91-9360345777 PHONE: 04151-235267, FAX: 04151-235151 11-8-2014
1696 GOLDEN INSTITUTE OF TECHNOLOGY PRIVATE LIMITTED NAMDHARI COMPLEX NEAR MANDAV HOSPITAL JAIL ROAD 1-7-2014
1697 GOLS TECHNICAL AND VOCATIONAL EDUCATION PVT LTD 301 SHREE KRISHNA NIWAS, SHRADHANAND ROAD EXT, VILE PARLE (EAST) 12-11-2014
1698 GOODWILL FOUNDATION PC LIANCHUNGNUNGA BUILDING, OPP: AIZAWL WEST COLEGE, DAWRPUI VENGTHAR, AIZAWL, MIZORAM 6-1-2016
1699 GOPABANDHU DEVELOPMENT SOCIETY MALKANGIRI ODISHA AT- MV2 PO- DNK COLLONY DIST- MALKANGIRI 17-5-2016
1700 GOPALAN FOUNDATION GOPALAN SKILL ACADEMY #92/9, 3RD FLOOR, 80 FEET ROAD, KATHRIGUPPA, BANASHANKARI 3RD STAGE, BANGALORE, KARNATAKA, INDIA 560085. 14-7-2016
1701 GOPAL DUTT SHIKSHAN SAMITI SHARMA NIWAS CHAUKHUTIYA, POST OFFICE GANAI, BLOCK AND TEHSIL- CHAUKHUTIYA, DISTT- ALMORA, UTTARAKHAND-263656 INDIA 11-11-2014
1702 GOPAL SHIKSHAN AVAM GARMIN VIKAS SANSTHAN VILLAGE & POST - JONIHA FATEHPUR(U.P)-212635 15-3-2016
1703 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST- JONIHA FATEHPUR 28-10-2016
1704 GOPAL SHIKSHAN EVAM GRAMIN VIKAS SANSTHAN VILL & POST-JONIHA FATEHPUR-212635 U.P 18-9-2015
1705 GOVERNING BODY KALPATARU INSTITUTE OF ENTREPRENEUR MISHRA MENSION, N S AVENUE, RANGIRKHARI, SILCHAR-5 27-11-2015
1706 GOVERNMENT TOOL ROOM AND TRAINING CENTRE RAJAJINAGAR INDUSTRIAL ESTATE BANGALORE 6-11-2013
1707 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED “GOYAL HOUSE”, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA 6-5-2016
1708 GOYAL FASHIONS PRIVATE LIMITED GOYAL FASHIONS PRIVATE LIMITED GOYAL HOUSE, 24, AJMER ROAD JAIPUR-302006, RAJASTHAN, INDIA 10-5-2016
1709 GP SKILL DEVELOPMENT CENTRE LLP NO:593, SRS TOWERS, FIRST FLOOR, BHAVANI, ERODE DISTRICT 14-3-2016
1710 GRACE EDUCATIONAL AND CHARITABLE TRUST GRACE HOSPITAL AND NURSING HOME COMPLEX, P.P.M.JUNCTION KANYAKUMARI DISTRICT, TAMIL NADU 1-9-2014
1711 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM 14-3-2016
1712 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH 10-5-2016
1713 GRAFX IT SOLUTIONS PVT LTD # 47-3-29/2, FIRST FLOOR , DWARAKANAGAR 5TH LANE,VISAKHAPATANAM, ANDHARA PRADESH 9-5-2016
1714 GRAMA DHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT 1-11-2016
1715 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR, KAMARAJAR COLONY, MELUR ROAD, SIVAGANGAI. 9-12-2016
1716 GRAMADHANA NIRMANA SANGAM 5/357 SOLAI NAGAR,KAMARAJAR COLONY,MELUR ROAD,SIVAGANGAI,SIVAGANGAI DISTRICT 13-7-2016
1717 GRAM BHARTI MAHILA MANDAL M.Q. 334, SHOBHAPUR COLONY] PATHAKHERA, DIST. BETUL (MP) 24-11-2015
1718 GRAMEEN EVAM SHAHRI WELFARE SANSTHAN 17/194F/2 PUSHP VIHAR COLONY,MATHURA ROAAD 13-11-2014
1719 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO.1, SHANKAR NAGAR, NEAR GOVT. SSP COLLAGE WARASEONI, DISTRICT-BALAGHAT M.P.-481331 5-1-2016
1720 GRAMIN AANCHLIK KRISHAK SAMAJ SAMITI WARD NO 01 SHANKAR NAGAR NEAR GOVT. S.S.P. COLLEGE WARASEONI TH WARASEONI DIST BALAGHAT M.P. 14-3-2016
1721 GRAMIN SAMAJ VIKAS KENDRA F-28 GANGA NAGAR, MEERUT UTTAR PRADESH 18-9-2015
1722 GRAMIN SEWA SANSTHAN 19, FIRST FLOOR, OPPOSITE NURSES HOSTEL TOWN HALL GORAKHPUR 29-9-2016
1723 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW 21-9-2015
1724 GRAMIN SHIKSHAN EVAM UTTHAN SAMITI 448/199/19 NAGARIYA KALYANPURI THAKURGANJ LUCKNOW 11-9-2015
1725 GRAMIN UTTHAN SAMITI 111/A M.G MARGE NEAR K.P GROUND GARAGE TOWN ALLAHABAD (U.P) 15-1-2016
1726 GRAMIN UTTHAN SAMITI 111/A M.G MARG MEDICAL CAWRAHA ALLAHABAD 5-2-2016
1727 GRAMIN VIKAS ANEM MANAV SEWA SANSTHAN 543 NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR 27-6-2016
1728 GRAMIN VIKAS AVEM MANAV SEWA SANSTHAN 543, NORTH CIVIL LINE SAKET ROAD MUZAFFARNAGAR 26-7-2016
1729 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH 28-9-2015
1730 GRAMIN VIKAS EVAM SAMAJIK SEVA SANSTHAN WATER TANK ROAD, RAVANTILA CHAURAHA, NAURANGABAD ALIGARH 17-9-2015
1731 GRAMINVIKASSAMITIRAIPURCG COLLEGE WARD-54, ROHNIPURAM DAGANIA RAIPUR C.G. 6-1-2016
1732 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,PAROO,MUZAFFARPUR(BIHAR)843112 11-3-2016
1733 GRAMIN VIKAS SEVA SANSTHAN PAROO KASBA TOLA,PAROO,MUZAFFARPUR 7-1-2016
1734 GRAMIN VIKAS SEVA SANSTHAN AT-PAROO KASBA TOLA,POST+PS-PAROO,DIST.:-MUZAFFARPUR(BIHAR)843112 8-4-2016
1735 GRAMIN VIKAS TRUST KRIBHCO BHAWAN, 5TH FLOOR, A-WING, A-10, SECTOR-1, NOIDA (UP) 4-10-2013
1736 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI 6-4-2016
1737 GRAMIUM 9 PERIYAR ST CAUVERY NAGAR KULITHALAI 26-4-2016
1738 GRAMODYOG SANSTHAN MANADEHI POST MAHARAJPUR DISTRICT MANDLA STATE MP 25-11-2016
1739 GRAMODYOG SANSTHAN VILLAGE MANADEHI POST MAHARAJPUR DISTRICT MANDLA MADHYA PRADESH 12-1-2016
1740 GRAM PRAUDYOGIK VIKAS SANSTHAN CHOWDHURY COLONY, COLLEGE ROAD, NEAR GAYATRI MANDIR 11-1-2016
1741 GRAM SEVA TRUST KURENDA ROAD, PARASAWADA, BAIHAR TEHSIL, DISTRICT BALAGHAT, MADHYA PRADESH 8-11-2013
1742 GRAM SEVA TRUST F-170, SWASTIK APT., GALI MIRJAWALI, FLAT NO. - 206, LADO SARAI, NEW DELHI 4-10-2013
1743 GRAM SEVA TRUST KURENDA ROAD, TAHSIL + P.O. : PARASWADA, DISTT. : BALAGHAT 4-4-2016
1744 GRAM TARANG EMPLOYABILITY TRAINING SERVICES HIG 5 | BDA DUPLEX PHASE I | POKHARIPUT | BHUBANESWAR 17-10-2013
1745 GRAM UTTHAN AT/P.O. PIMPURI, VIA: RAJKANIKA, DISTRICT: KENDRAPARA, ODISHA 14-9-2015
1746 GRAM VIKAS PLOT 72 B, FOREST PARK 11-11-2014
1747 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 27/1040,PARSAD COLONY, MANIK CHOUK OSMANABAD 413501 29-6-2016
1748 GRAMVIKAS BAHUUDDUSHIYA SEVA MANDAL 24/1040 PRASAD COLONY, MANIK CHOUK OSMANABAD 7-9-2016
1749 GRAM VIKAS CHARITABLE TRUST AT KHAREDI TA JAMBIGHODA DIST PANCHMAHAL 18-9-2015
1750 GRAMVIKAS SANSTHA BH 1/28, THAKARE NAGAR N-2, CIDCO AURANGABAD 26-9-2016
1751 GRAM VIKAS SEVA SANSTHAN ADARSH COLONY, SILARI ROAD, PIPARCITY 26-4-2016
1752 GRAS EDUCATION AND TRAINING SERVICES PVT LTD C-56A/28,4TH FLOOR, SECTOR - 62, ABOVE UNION BANK OF INDIA, NOIDA - 201301. UTTARPRADESH 22-1-2014
1753 GRASS ROOT ORGANISATION FOR UPLIFTMENT OF THE POOR 7-2-129 BAIRAMALGUDA KARMANGHAT VYSHALINAGAR POST SAROOR NAGAR MANDAL GREATER HYDERABAD RANGA REDDY DISTRICT TELANGANA STATE 21-1-2015
1754 GRAZIANO TRASMISSIONI INDIA PRIVATE LIMITED PLOT NO. 14 UDYOG KENDRA , GREATER NOIDA 24-4-2014
1755 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2 BULANDSHAHR UTTAR PRADESH 14-9-2015
1756 GREAT HIGHT ACADEMY EDUCATIONAL SOCIETY 11/144 AVAS VIKAS 2ND BULANDSHAHR UTTAR PRADESH 27-4-2016
1757 GREEN FIELD NUTRITIOUS PVT LTD VILL – SOMASPUR , P.O + P.S DHANIAKHALI, HOOGHLY, WEST BENGAL 17-8-2016
1758 GREEN HILLS EDUCATIONAL DEVLOPMENT SOCIETY H NO 102/DS, SEC - C, KURSI ROAD, LUCKNOW 5-2-2015
1759 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL 5-12-2016
1760 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL, TAMILNADU-637405 1-11-2016
1761 GREEN INDIA FOUNDATION 5/71.MANAYARAN STREET, MUTHUGAPATTY, NAMAKKAL. 22-11-2016
1762 GREEN KITCHEN PVT LTD A-136 SEC-63 NOIDA 1-7-2016
1763 GREEN LINE SYSTEM PRIVATE LIMITED OPP TO PG COLLEGE, NEAR RAI NURSING HOME, AGRA ROAD, DAUSA 15-9-2015
1764 GREESHA LABORATORIES PVT LTD PLOT NO 16 , IDA, KOTHUR , SHADNAGAR, MAHABUBNAGAR DISTRICT, TELANGANA, INDIA 8-5-2015
1765 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE, TAMILNADU 4-11-2016
1766 GRG TRUST PSGR KRISHNAMMAL COLLEGE FOR WOMEN, PEELAMEDU, COIMBATORE, TAMILNADU 18-10-2016
1767 GROOM INDIA SALON AND SPA PRIVATE LIMITED NO: 10, ANNA ENCLAVE, INJAMBAKKAM, CHENNAI 6-4-2016
1768 GROUP NO 5 ALLIED SECURITY SOLUTIONS PRIVATE LTD JAYADEV BIHAR COLONY PURNA ROAD NEAR IN COLLEGE,ORISSA,JHARSUGUDA 11-8-2016
1769 GSJ ENVO LTD 51,HEMKUNT COLONY 30-10-2013
1770 G TEC EDUCATION PRIVATE LIMITED HOUSE OF G-TEC, INDUS AVENUE, KALLAYI ROAD, CALICUT, KERALA, INDIA- 673002 9-4-2015
1771 G T RURAL WELFARE EDUCATIONAL TRUST 693 BAZZAR STREET, ATTUR(T.K), SALEM 27-6-2016
1772 G T TRUST 693 BAZAR STREET, ATTUR (T.K), SALEM DISTICT 13-1-2017
1773 G T TRUST 693 BAZAR STREET, ATTUR,SALEM, TAMILNADU 12-9-2016
1774 GUIDE TRUST GUIDE TRUST, 58(4)/147E SV MAHAL OPPOSITE, BLS PETROL BUNK BACKSIDE, SIVAGANGAI 15-9-2015
1775 GUJARAT INFOTECH LIMITED A-2, 2ND FLOOR, JAY TOWER, ANKUR COMPLEX, ANKUR X ROAD,NEAR ANKUR BUS STOP, NARANPURA, AHMEDABAD 14-9-2015
1776 GUJARAT LAW SOCIETY GLS CAMPUS, OPP. LAW GARDEN, ELLISBRIDGE, AHMEDABAD 14-9-2015
1777 GUJARAT LOKSEVA CHARITABLE TRUST GUJARAT FIRE AND SAFETY ACADEMY, AT & PO. NADISAR, TALUKA - GODHRA. DISTRICT - PANCHMAHAL STATE - GUJARAT 15-9-2015
1778 GULHAN MEMORIAL INSTITUTE VILL+PO: JEMO RAJBATI, PS: KANDI, DISTRICT: MURSHIDABAD, PIN: 742140, WEST BENGAL 22-8-2016
1779 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,SUB DIV+BLOCK+PS-KANDI,DIST-MURSHIDABAD,PIN-742140,WEST BENGAL 26-4-2016
1780 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI,PS KANDI,DIST MURSHIDABAD,WEST BENGAL 24-6-2016
1781 GULHAN MEMORIAL INSTITUTE JEMO RAJBATI, SUB DIV+BLOCK+PS- KANDI, DIST- MURSHIDABAD, PIN- 742140, STATE- WEST BENGAL 6-4-2016
1782 GULHAN MEMORIAL INSTITUTE VILL+P.O-PURANDARPUR,P.S-KANDI 4-1-2016
1783 GULHAN MEMORIAL INSTITUTE VILL+PO JEMO RAJBATI,P.S+SUB DIV KANDI,DIST MURSHIDABAD,WEST BENGAL 11-5-2016
1784 GULHAN MEMORIAL INSTITUTE VILL: JEMO RAJBATI, SUB DIV + PS: KANDI, DIST: MURSHIDABAD, PIN: 742140, WEST BENGAL 14-9-2016
1785 GUMBI SOFTWARE PRIVATE LIMITED # 45/13, INDUSTRIAL SUBURB, YESHWANTHPUR 2-6-2014
1786 GURU BAHUUDESHIYA SAMAJIK SANSTHA UMBARE KOTHA NEAR D. PHARMACY COLLEGE OSMNABABAD 13-7-2016
1787 GURUDEV SEVABHAVI BAHUUDESHIYA SANSTHA MURTIZAPUR C/O IGM COMPUTER EDUCATION, SAMTA NAGAR, NEAR BHARAYIYA DNYANPEETH SCHOOL, MURTIZAPUR, DIST. AKOLA 6-4-2016
1788 GURU HARKRISHAN EDUCATIONAL SOCIETY B-V, 103/104, BHATIA NAGAR, CHOTTI LINE, OPP. CHAUHAN PAPERS, YAMUNA NAGAR (HARYANA) 12-9-2015
1789 GURU INFOTECH 1ST FLOOR, ABOVE URBAN CO-OPERATIVE BANK, BARSAT ROAD, NOORWALA, PANIPAT 12-5-2016
1790 GURU INFOTECH EDUCATIONAL TRUST GURU INFOTECH, FIRST FLOOR, ABOVE THE PANIPAT URBAN CO-OP BANK, BARSAT ROAD NOORWALA, PANIPAT 22-7-2016
1791 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 600026 30-8-2016
1792 GURU INTEGRATED SERVICES PVT LTD NEW NO 203/1, OLD NO 109/1, NSK SALAI, ARCOT ROAD, VADAPALANI, CHENNAI 6-10-2016
1793 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH 246746 CONTACT NO 01344252588 14-12-2016
1794 GURUKUL COMPUTER EDUCATION GURUKUL COMPUTER EDUCATION GURUKUL COMPLEX MOH JOSHIYAN NEAR BIRLA COLLEGE SEOHARA BIJNOR UTTAR PRADESH 12-5-2016
1795 GURUKUL JYOTI WELFARE SOCIETY 11, MAHAKAUSHAL NAGAR, SARASWATI SHISHU MANDIR KE PICHE, ADHARTAL, JABALPUR (M.P.) 13-11-2014
1796 GURUKUL MANAGEMENT STUDIES HB 203, SALT LAKE, SECTOR- III, KOLKATA- 700106 14-9-2016
1797 GURUKUL SHIKSHA AVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW 14-9-2015
1798 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW 2-3-2016
1799 GURUKUL SHIKSHA EVAM GRAMIN VIKAS SANSTHAN 459/786, MEHTAB BAGH, OPP. SHEESH MAHAL TALAB, DURGA DEVI MARG, CHOWK, LUCKNOW 6-4-2016
1800 GURUKUL SIKSHA SOCIETY PLOT NO-478,PANJABARI,BAGHARBARI,GUWAHATI 17-9-2015
1801 GURU NANAK EDUCATIONAL TRUST 20 B.T. ROAD, KOLKATA, WEST BENGAL 12-9-2016
1802 GV CHARITY TRUST REGD.OFF: 13/17-A, E.K.SANKAR RAJA STREET, RAJAPALAYAM. ADMIN.OFFICE: O/O ASIATIC ITS, NEAR NEW BUS STAND, SANKARANKOIL ROAD, RAJAPALAYAM, 21-4-2015
1803 G V MEDITECH PRIVATE LIMITED B-36/46-H,RAMAN NIWAS, MAHMOORGANJ, VARANASI 26-3-2014
1804 GYANAKIRAN INSTITUTE OF INTEGRAL STUDIES PANDA COMPLEX, NEAR RLY. LEVEL CROSSING, UTTARESWAR, SORO, DIST: BALASORE 18-8-2016
1805 GYAN BHARTI SAMITI GYAN BHARTI SAMITI GYAN BHARTI HIGH SCHOOL SHEETLA JI ROAD SADAT ROAD SAIDPUR. 9-8-2016
1806 GYANJYOTI FOUNDATION #12, BHASKAR NAGAR, R.G. BARUAH ROAD, GUWAHATI, ASSAM 5-1-2016
1807 GYANJYOTI FOUNDATION 12, BLOCK-A, BHASKAR NAGAR, R.G.BARUAH ROAD, GUWAHATI-781021 5-2-2016
1808 GYANODAYA INFORMATION AND EDUCATION SOCIETY 211, VARDAAN APARTMENT , BHARAT BHAVAN ROAD, SHYAMLA HILLS, BHOAPL (MP) 3-3-2015
1809 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO 3B, SAI NAGAR COLONY, BSNL LANE, LANE OPPOSITE AMBEDKAR STATUE, SECUNDERABAD , PICKET 6-5-2016
1810 GYAN PRERNA SIKSHA AVAM KALYAN SANSTHA PLOT NO.3B, SAI NAGAR COLONY BSNL OFFICE LANE, OPPOSITE TO AMBEDKAR STATUE PICKET, SECUNDERABAD-500009 TELANGANA 6-4-2016
1811 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA BHOPAL MP 16-3-2016
1812 GYARASPUR LODHI SHIKSHA EVAM SAMAJ KALYAN SAMITY SHIVAJI CHOWK MAIN ROAD BERASIA IN BRIGHT FUTURE EDUCATIONAL INSTITUTE 4-4-2016
1813 GYAYAK RUPARI DEVI DHULJI BHAI CHERITABLE TRUST 110-111, SARVARTHSIDDHI APARTMENT BHAWANPURA, KHANDU COLONY, BANSWARA RAJASTHAN 22-12-2013
1814 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR WEST BENGAL 4-4-2016
1815 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, DIST- PASCHIM MEDINIPUR, PIN- 721101 WEST BENGAL 12-1-2016
1816 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, P.S- KOTWALI, 9-2-2016
1817 HADIA INSTT OF MGT IT AND EDUCATIONAL TRAINING P-31/1 SARATPALLY, MIDNAPORE, P.O- MIDNAPORE, DIST- PASCHIM MEDINIPUR, 2-3-2016
1818 HAM INSTITUTE OF TECHNOLOGY AND MANAGEMENTS BESIDE HANUMAN MANDIR,RAUTH PARA JAGDALPUR 11-8-2016
1819 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, BPO- SANTHEL, PO/PS MAYANG IMPHAL, DISTT. : THOUBAL 6-10-2013
1820 HANGUL UNITED DEVELOPMENT ASSOCIATION HANGUL, IDGAH ROAD, MAYANG IMPHAL POST OFFICE, POLICE STATION MAYANG IMPHAL, THOUBAL DISTRICT, MANIPUR 26-10-2013
1821 HANSIKA MOTWANI HANSIKA MOTWANI GROUP ROAD 123 CHENNAI 21-8-2014
1822 HAPPY SCHOOL EDUCATIONAL SOCIETY STREET 69, SECTOR 6, BHILAI, CHHATTISGARH 21-1-2015
1823 HAPPY WALFARE SOCIETY B-85, NEHRU BIHAR, KANCHNA BIHARI MARG, LUCKNOW 14-9-2015
1824 HAR DEO DHARAM DEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD 14-9-2015
1825 HARDEO DHARAMDEO MEMORIAL TRUST BARAMURI, B.POLYTECHNIC, DHANBAD, 25-7-2016
1826 HARDICON LIMITED D-28, FLATTED FACTORIES COMPLEX, JHANDEWALAN, NEW DELHI-110 055 12-9-2015
1827 HARIBALA DRIVING SCHOOL 10A,RAJALAKSHMI COMPLEX, ARANMANAI VALAGAM, SIVAGANGAI, TAMILNADU 3-2-2015
1828 HARI LEELA EDUCATIONAL SOCIETY CORPORATE OFFICE- HARI LEELA EDUCATIONAL SOCIETY, TECHNO PEARL PLOT NO. 6/2 & 6/3, HUDA TECHNO ENCLAVE, PHASE II, HITEC CITY, MADHAPUR, HYDERABAD,TELANGANA-500081, INDIA. 13-9-2015
1829 HARIOM SHAKTI CHARITABLE TRUST SANT ROSHAN LAL EDUCATION CAMPUS , DHANI MAHU 14-7-2014
1830 HARISHCHANDRAPUR PALLY UNNAYAN SAMITY VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL 5-9-2016
1831 HARISHCHANDRAPUR THANAPARA WELFARE SOCIETY VILL+PO+PS - HARISHCHANDRAPUR, DIST - MALDA, WEST BENGAL. 12-9-2016
1832 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST T.S.NO: 3608, SANTHANATHAPURAM V STREET, 2 FLOOR, NEAR , NEW BUS STAND, PUDUKKOTTAI – 622 001. 17-9-2015
1833 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM VTH STREET, 2ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001. 1-10-2015
1834 HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST HARISHMALAI EDUCATIONAL AND CHARITABLE TRUST , T.S.NO:3608, SANTHANATHAPURAM V STREET, 2 ND FLOOR, NEAR NEW BUS STAND, PUDUKKOTTAI . 622 001. 28-9-2015
1835 HARI TELEMATICS PRIVATE LIMITED 9, CHANDRALOK MARKET, NILADRI VIHAR, BHUBANESWAR 2-10-2013
1836 HARI VIKAS VARDHINI NEAR NAHRU GARDEN, MALIWADA, PANCHAVATI, NASHIK 13-9-2015
1837 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD 6-8-2015
1838 HARLIN ESTATES PRIVATE LIMITED T-3, THIRD FLOOR, ADITYA MEGACITY MALL, VAIBHAV KHAND, INDIRAPURAM, GHAZIABAD 7-8-2015
1839 HARSHAL GRAMIN VIKAS BAHU SANSTHA HARSHAL GRAMIN VIKAS BAHU. SANSTHA WATCHAL BHAWAN VIVEK NAGAR MUL ROAD, CHANDRAPUR 24-5-2016
1840 HARSHAL GRAMIN VIKAS BAHUUDDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR 1-6-2016
1841 HARSHAL GRAMIN VIKAS BAHUUDESHIYA SANSTHA WATCHAL BHAWAN VIVEKNAGAR MUL ROAD CHANDRAPUR 31-5-2016
1842 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001 26-10-2016
1843 HARYANA THALASEMIA SOCIETY N-153, MODEL TOWN NEAR JINDAL HOSPITAL HISAR, HARYANA- 125001 2-11-2016
1844 HAWKMAN TECHNOLOGIES PRIVATE LIMITED 30 E SECOND FLOOR ROAD NO 2 PATLIPUTRA 13-1-2017
1845 HAZARATH MAHABOOB SUBHANI EDUCATION SOCIETY SHETTIHALLI MAIN ROAD TUMKUR KARNATAKA 16-3-2015
1846 HAZRAT BABA LATIF SHAH EDUCATION SOCIETY C.P 108 AVAS VIKAS COLONEY MIRZAPUR 14-9-2015
1847 HB MANAGEMENT AND ENGINEERING CONSULTANTS PVT LTD 7A, 4TH BLOCK, VIJAYSHANTHI APARTMENTS ARCOT ROAD, VADAPALANI CHENNAI 14-9-2015
1848 HCL INFOTECH LIMITED E-4,5,6 SECTOR-11, NOIDA, U.P., INDIA 19-2-2016
1849 H COMPUTER SERVICES MAN POWER CONSULTANCY H COMPUTER SERVICES OPP: CENTRAL BANK OF INDIA CHURCH COMPOUND COMPLEX, NALGONDA 26-2-2016
1850 HEAD TRUST W4-B7, CHAIRMAN RATHINAM NAGAR, PERIYAKULAM ROAD, THENI. 5-2-2015
1851 HEALING FIELDS FOUNDATION HEALING FIELDS FOUNDATION 5-9-22, MANASAROVAR COMPLEX, SECRETARIAT ROAD, HYDERABAD - 500 063 (AP) TELEFAX: +91 40 23232841/42 26-3-2014
1852 HEALTHCARE SERVICES PROVIDER PLOT NO. 3-4-136, BARKATPURA, HYDERABAD 6-12-2016
1853 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGHRAPAR, NALBARI, ASSAM 8-4-2016
1854 HEALTH EDUCATION AND RURAL DEVELOPMENT SOCIETY BAGHMARA, GHOGRAPAR NALBARI, ASSAM 16-3-2016
1855 HEALTH ENVIRONMENT AND SOCIOECONOMIC LITERACY PRJ VEDAVATHI NAGAR, HIRIYUR,DIST CHITRADURGA, KARNATAKA 11-9-2015
1856 HEAVEN ON MERCYFUL EARTH NO.2 .IYYAPPAN NAGAR, SELERI VILLAGE, VEMBAKKAM POST & TALUK , TIRUVANNAMALAI DISTRICT, TAMIL NADU, INDIA 17-5-2016
1857 HEAVEN ON MERCYFUL EARTH NO.2. IYYAPPAN NAGAR, SELERI VILLAGE VEMBAKKAM POST& TALUK, TIRUVANNAMALAI DISTRICT. TAMIL NADU 5-5-2016
1858 HEAVEN ON MERCYFUL EARTH NO.2 IYYAPPAN NAGAR SELERI VILLAGE ,VEMBAKKAM POST AND TALUK, TIRUVANNAMALAI DISTRICT, TAMILNADU 14-3-2016
1859 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT [HEART] HELEN SYSTEMS 18, SATHIYAMOORTHY STREET SIVAGANGAI, TAMILNADU INDIA 26-7-2016
1860 HELEN EDUCATION AWARENESS AND RURAL DEVELOPMENT TRUST 18, SATHYAMOORTHY STREET SIVAGANGAI - 630 561 TAMILNADU INDIA 28-9-2016
1861 HELIOS AND MATHESON IT BANGALORE LIMITED 1281, 21ST MAIN, PHASE 2, J P NAGAR BANGALORE 18-10-2013
1862 HELPAGE YOUTH FOUNDATION 2/311 VIKAS KHAND GOMTI NAGAR LUCKNOW 18-3-2015
1863 HERAUD TRAINING AND EDUCATION INDIA PVT LTD E-96,PHASE 7, INDUSTRIAL AREA. MOHALI. PUNJAB 1-11-2016
1864 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA 3-3-2016
1865 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, KHURDA, ODISHA, PIN - 752050 11-1-2016
1866 HERITAGE CHARITABLE TRUST RAMCHANDRA PUR COLLEGE ROAD POST BOX 20 JATNI KHORDHA ORISSA 752050 2-3-2016
1867 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATNI, KHURDA 15-9-2015
1868 HERITAGE CHARITABLE TRUST SOPHITORIUM CAMPUS, COLLEGE ROAD, JATANI, ODISHA 4-1-2016
1869 HERITAGE CHARITABLE TRUST RAMACHANDRAPUR BAJAR, JATNI, KHURDA, ODISHA 3-3-2016
1870 HGXDNG CBGNCBNMCNFMHXFVM 17-3-2015
1871 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR,KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH 21-9-2016
1872 HIGHLINE EDUCARE INDIA PRIVATE LIMITED B-58, 2ND FLOOR, KASTURBA NAGAR, NEAR CHETAK BRIDGE, BHOPAL, MADHYA PRADESH 4-8-2016
1873 HIGHTECH COMPUTER EDUCATION SOCIETY 3A, GANDHI GRAM G.T. ROAD KANPUR NAGAR 22-7-2016
1874 HIMACHAL CONSULTANCY ORGANISATION LIMITED NEW BRIDGE VIEW ESTATE THE MALL,SHIMLA 14-9-2015
1875 HIMALAYAN JYOTI SAMITI CHAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND 11-1-2016
1876 HIMALAYAN JYOTI SAMITI CHAAR DUKAN, LANDOUR CANTT, MUSSOORIE, DISTRICT DEHRADUN, UTTARAKHAND STATE, INDIA 2-12-2015
1877 HIMALAYA VIKAS SANSTHAN VILLAGE AND P O-BALAWALA --OBC BALAWALA DISTT DEHRADUN UTTARAKHAND 8-1-2016
1878 HIMATSINGKA LINENS HIMATSINGKA LEARNING ACADEMY,HIMATSINGKA LINENS, (A DIVISION OF HIMATSINGKA SEIDE LTD),PLOT NO 01, K I A D B INDUSTRIAL AREA,GORUR ROAD,HANUMANTHAPURA POST,HASSAN,HASSAN DISTRICT,KARNATAKA. 17-2-2016
1879 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, WEST BENGAL 12-1-2016
1880 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL 15-1-2016
1881 HIMCHI RURAL WELFARE CENTRE VILL-HIMCHI, P.O.-BHAGABATIPUR, P.S.-MATHURAPUR, DIST.-SOUTH 24 PARGANAS, PIN-743399, WEST BENGAL 5-2-2016
1882 HIMITEX ENGINEERS PRIVATE LIMITED D-165 NAND NAGRI DELHI INDIA 18-9-2015
1883 HINDAVI SWARAJYA SANSTHA KOLEGAON AT POST KOLEGAON TQ DIST OSMANABAD 27-6-2016
1884 HIND EDUCATION SOCIETY MAHADEV BULLDING SHIV NAGAR.SOUTH 6-4-2016
1885 HINDI SAHITYA SARJAN SANSTHAN 363/196 HASANGANJ BAVLI SAHADATGANJ LUCKNOW UP 5-1-2016
1886 HINDUSTAN INSTITUTE OF ENGINEERING TECHNOLOGY NAVALUR ROAD, VELLARITHANGAL VILLAGE, SERAPANANCHERI POST, KANCHIPURAM DISTRICT, PIN CODE-601 301 13-11-2014
1887 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HLFPPT, SECOND FLOOR B-14 A, SECTOR 62, NOIDA 21-8-2015
1888 HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST HINDUSTAN LATEX FAMILY PLANNING PROMOTION TRUST, B-14 A, SECTOR 62, NOIDA 15-9-2015
1889 HIRANANDANI FOUNDATION 514, DALAMAL TOWER F P J MARG, NARIMAN POINT MUMBAI, MAHARASHTRA 14-10-2016
1890 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI 28-10-2016
1891 HIRANANDANI FOUNDATION 514, DALAMAL TOWER , 5TH TOWER NARIMAN POINT , MUMBAI 22-9-2016
1892 HITAJE CONSULTANTS 385/2 SS KULAM, CODEA PARK, KURUMPABALAYAM, COIMBATORE - 107 30-11-2016
1893 HI TECH CHARITABLE TEST HIIT, UMERI HI TECH NAGAR JEYPORE - 764 003 KORAPUT 5-4-2016
1894 HITECH NET PARK 11 VILLIANUR MAIN ROAD, THATTANCHVADI V VILLIANUR PONDICHERRY 12-5-2016
1895 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL 14-10-2016
1896 HITESHRI SAMAJIK SANSTHA MIG 30/4B SAKET NAGAR BHOPAL 28-10-2016
1897 HMT MACHINE TOOLS LIMITED HMT MACHINE TOOLS LIMITED,BANGALORE COMPLEX, JALAHALLI, BANGALORE-560013 30-11-2015
1898 HOLBIZ PRIVATE LIMITED C-419,UDHNA UDYOGNAGAR SANGH, UDHNA, NEAR DIVYA BHASKAR OFFICE, SURAT 14-9-2015
1899 HOLISTIC FOUNDATION BHILAI HOLISTIC FOUNDATION SUN ENGINEERING COLLEGE GRAM CHANDKHURI, BALOD ROAD, DIST DURG 7-1-2015
1900 HOLY CHARITABLE TRUST H.NO.30-2-496, MADIKONDA, KAZIPET,HANAMKONDA WARANGAL 19-1-2017
1901 HOLY FAITH INTERNATIONAL PVT LTD GULAB BHAWAN, 6,BSZ MARG, ITO, NEW DELHI 14-9-2015
1902 HOLY LORD EDUCATION SOCIETY HOLY LORD EDUCATION SOCIETY (HLES), RAMABALLAV ROAD, V. I. P. ROAD, PURI, ODISHA 21-12-2015
1903 HOLY MISSION FOR CHILDRENS WELFARE RURAL DEVELOPM 8/4, R. B. C. ROAD, DUM DUM, KOLKATA - 700028 11-11-2014
1904 HOLY TRINITY EDUCATIONAL SOCIETY H.NO. 7-1-282, B K GUDA, S R NAGAR, HYDERABAD, ANDHRA PRADESH 10-2-2015
1905 HOPE EDUCATIONAL AND CHARITABLE TRUST PUDUR, KARUPPU REDDIYUR (PO), NANGAVALLI MAIN ROAD METTUR (TK) SALEM (DT) 16-11-2016
1906 HOPE INDIA FOUNDATION 87/39, PIDARI SOUTH STREET, (OPP: HOTEL SAMPOORNA) SIRKALI, NAGAPATTINAM DIST, TAMILNADU 23-12-2016
1907 HOPE ORGANIZATION FOR PEOPLE EMPOWERMENT SOCIETY F5, GREEN HOUSE APARTMENT, MCCDONALDSROAD, CANTONMENT, TIRUCHIRAPPALLI, TAMIL NADU - 620001 26-7-2016
1908 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN 27-5-2016
1909 HORNETINFOTECH PRIVATE LIMITED 404, PARIMALA CHANDRA VIHAR ROAD NO 4 CHANDRA PURU COLONY, L B NAGAR, HYDERABAD 9-5-2016
1910 HORNETINFOTECH PRIVATE LIMITED D.NO:188 FLAT NO.404, PARIMALA CHANDRA VIHAR CHANDRAPURI COLONY, ROAD NO:4, L.B.NAGAR HYDERABAD TG 500070 IN 17-5-2016
1911 HOTEL SWOSTI PRIVATE LIMITED 103, JANPATH ROAD, BHUBANESWAR 14-9-2015
1912 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI 5-1-2017
1913 HP PROFESSIONAL SERVICES PRIVATE LIMITED 5TH INDUSTRIAL AREA 2ND FLOOR TILAK NAGAR NEW DELHI 29-12-2016
1914 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI 16-12-2016
1915 HP PROFESSIONAL SERVICES PRIVATE LIMITED HP PROFESSIONAL SERVICES PRIVATE LIMITED 2ND FLOOR TILAK NAGAR NEW DELHI 23-12-2016
1916 HR CHAMBERS OUTSOURCING PVT LTD FLAT # 204, 02ND FLOOR, BHAVYA SRI SAILAM ARCADE, ABOVE FOOD WORLD, DHARAM KARAM ROAD AMEERPET, HYDERABAD 13-10-2014
1917 HR SQUARE PLOT NO.8, DURGA NAGAR COLONY, PUNJAGUTTA, HYDERABAD 20-1-2015
1918 HSADALO FFSE 6-12-2016
1919 HSB EDUCATION TRUST HSB HOUSE, RABINDRAPALLY, P.O.+P.S. - SURI, DIST - BIRBHUM, WEST BENGAL 12-8-2016
1920 HSB EDUCATION TRUST HSB HOUSE, RABINDRA PALLI, NEAR RED CROSS, SURI, BIRBHUM, WEST BENGAL - 731101 18-8-2016
1921 HUMAN BENEVOLENCE SOCIETY GARIAGAON P.O- BARALIMARI DIST-MORIGAON(ASSAM) 17-5-2016
1922 HUMANDEVELOPMENT AND RESEARCH FOUNDATION AHMEDABAD 57,5TH FLOOR,CITY CENTER, NR. SWASTIK CROSS ROAD, C.G.ROAD,NAVRANGPURA, AHMEDABAD 8-1-2016
1923 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO. 15/6 G.S.T.ROAD, FIST FLOOR, MADURANTAKAM, KANCHEEPURAM DISTRICT, TAMIL NADU STATE, PIN 603306. 2-3-2016
1924 HUMANITARIAN ORGANISATION FOR RURAL DEVELOPMENT NO.15/6.G.S.T.ROAD, IST FLOOR,MADURANTAKAM,KANCHIPURAM DIST,TAMILNADU 8-6-2016
1925 HUMAN MERCY JANHIT SEWA SANSTHAN 76-A/30/24 NEAR AMAN HOSPITAL THORNHILL ROAD , CIVIL LINES ALLAHABAD 15-9-2015
1926 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PH: 09810288775 7-1-2016
1927 HUMAN RESEARCH AND DEVELOPMENT ORGANISATION HRDO, (GANESH DUTT) BLDG# 69, 3RD FLOOR, SEWAK PARK, DWARKA MOR, NEAR DWARKA MOR METRO STATION PILLAR NO 776, UTTAM NAGAR, NEW DELHI, PHONE 09810288775 14-12-2015
1928 HUMAN RESOURCE FOUNDATION HRF 16/40,SHIELD ROAD, PERIYAKULAM COLONY,SIVAKASI, VIRUDHUNAGAR DISTRICT, TAMILNADU. 27-6-2016
1929 HUMAN WELFARE ORGANIZATION YATEEM TRUST BUILDING GANIE MOHALLA KHONMOH DISTRICT - SRINAGAR 5-8-2016
1930 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, A.P.M. CHEMBER, IIND FLOOR, FREEGANJ, UJJAIN 14-10-2015
1931 HUMAN WELFARE SOCIETY 15, GHATKARPAR MARG, APM CHAMBER II FLOOR FREEGANJ UJJAIN 11-9-2015
1932 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD 6-1-2016
1933 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL VEERABHADRAGIRI SINDANKERA CROSS NH 9 ROAD HUMNABAD 12-1-2016
1934 HYDERABAD KARNATAKA DEVELOPMENT EDUCATION TRUSTS SHAKUNTALA PATIL RESIDENTIAL SCHOOL SINDANKERA CROSS N.H-9 ROAD 8-12-2015
1935 IACM SMART LEARN LIMITED D-66, SOUTH EXTENSION PART-I, NEW DELHI 2-5-2016
1936 IACT EDUCATION PVT LTD D-306& 307 03RD FLOOR , WEST VINOD NAGAR,I.P EXTENSION DELHI-110092. 14-9-2015
1937 IACT EDUCATION PVT LTD D-306,307, 3RD FLOOR, ABOVE PNB BANK, WEST VINOD NAGAR 14-10-2015
1938 IAP COMPANY PRIVATE LIMITED CORPORATE OFFICE: 3RD FLOOR, PALAM TRIANGLE, PALAM VIHAR, GURGAON, HARYANA-122017 1-9-2014
1939 IAPMO INDIA IAPMO INDIA, NO22, 12TH B MAIN, HAL 2ND STAGE, INDIRANAGAR 30-10-2013
1940 ICA EDU SKILLS PRIVATE LIMITED 27, N S ROAD, 4TH FLOOR, KOLKATA 11-8-2016
1941 I CAN EDUCATIONAL AND WELFARE TRUST I CAN, #1, 120 FEET ROAD, SURVEYOR COLONY, MATTUTHAVANI, MADURAI 14-9-2015
1942 I CARE LEARNING PVT LTD I CARE LEARNING PVT. LTD THE CAPITAL, A WING, BANDRA-KURLA COMPLEX BANDRA EAST, MUMBAI 11-1-2016
1943 I CARE LEARNING PVT LTD THE CAPITAL, A WING, 406, BANDRA KURLA COMPLEX, BANDRA(E), MUMBAI, MAHARASHTRA 8-1-2016
1944 ICFAI THE ICFAI UNIVERSITY TRIPURA, AGARTALA 20-12-2016
1945 ICFE SKILLS SOLUTION PRIVATE LIMITED 6TH FLOOR,ADITYA TOWER,LAXMINAGAR DISTRICT CENTRE,LAXMINAGAR 12-2-2015
1946 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHABHAIRAB DAILY BAZAR. DARRANG COLLEGE ROAD 7-9-2016
1947 ICON ACADEMY OF PROFESSIONAL STUDIES DARRANG COLLEGE ROAD OPP MAHABHAIRAB DAILY BAZAR 4-4-2016
1948 ICON ACADEMY OF PROFESSIONAL STUDIES OPP MAHA BHAIRAB BAZAR, DARRANG ROAD,TEZPUR.DISTRICT-SONITPUR.ASSAM. 17-3-2015
1949 ICON FACILITIES MANAGEMENT SOLUTIONS PVT LTD ICON FACILITIES MANAGEMENT SOLUTIONS PVT. LTD. OPP : INDIAN OVERSEAS BANK, NORTH EXTENSION LAYOUT, SEETHAMMADHARA, VISAKHAPATNAM. A.P. INDIA 8-9-2014
1950 ICRDCE TRUST INDIAN CENTRE FOR RESEARCH AND DEVELOPMENT OF COMMUNITY EDUCATION, 30 VEERASAMY STREET, CHENNAI 26-2-2014
1951 ICTPMU DDUGKY TEST NEW DELHI 30-12-2016
1952 ICTPMU TEST11 NEW DELHI110001 30-12-2016
1953 IDAKSHA TRAINING ACADEMY PRIVATE LIMITED IDAKSHA TRAINING ACADEMY PRIVATE LIMITED 42 ALKAPURI , HABIBGANJ BHOPAL 18-1-2017
1954 IDEAL EDUCATIONAL AND CHARITABLE TRUST KARUMANAMKURUSSI, CHERPULASSERY, PALAKKAD, KERALA 23-6-2016
1955 IDEAL EDUCATIONAL AND CHARITABLE TRUST CHAPPANANGADI P.O, KOTTAKKAL, MALAPPURAM DISTRICT, KERALA 15-3-2016
1956 IDEAL EDUCATION PRIVATE LIMITED 401, 4TH FLOOR,IDEAL HOUSE, UMA SMRUTI BLDG, S V ROAD, NEAR FILMISTAN STUDIO, GOREGAON (W), MUMBAI, MAHARASHTRA 7-10-2013
1957 IDEAL EDUCATION SOCIETY 9TH KM STONE, DELHI-MEERUT ROAD,DUHAI, GHAZIABAD 24-1-2014
1958 IDEAL IMPRESSIONS PRIVATE LIMITED 9984, SWAMI RAM BEHARI ROAD, SARAI ROHILLA, NEW DELHI 8-2-2016
1959 IDEMI INSTITUTE FOR DESIGN OF ELECTRICAL MEASURING INSTRUMENT, S T TOPE MARG, SION P O, CHUNABHATTI MUMBAI 25-12-2013
1960 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR 22-8-2016
1961 IDS LOGIC PRIVATE LIMITED 40 SECOND FLOOR ,SECTOR 6 NOIDA GAUTAM BUDH NAGAR 4-8-2016
1962 ID TECH SOLUTIONS PRIVATE LIMITED 610,ID TECH SOLUTIONS PVT.LTD.UDYOG VIHAR,PHASE 5 GURGAON, HARYANA-122016 23-11-2016
1963 ID TECH SOLUTIONS PRIVATE LIMITED ID TECH SOLUTIONS PVT.LTD. PLOT NO 610,UDYOG VIHAR PHASE 5 GURGAON,HARYANA 28-10-2016
1964 IFC INFOTECH COMPUTER EDUCATION SRS TOWERS, IST FLOOR, NEAR CANARA BANK, NEW BUS STAND, BHAVANI 11-1-2016
1965 IFFCO KISAN SANCHAR LIMITED IFFCO HOUSE BEHIND SATYAM CINEPLEXES 34, NEHRU PLACE NEW DELHI, DELHI 7-9-2016
1966 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA 22-7-2016
1967 IGENUINE SOFT SOLUTIONS PRIVATE LIMITED IGENUINE SOFT SOLUTIONS PRIVATE LIMITED 153-II FLOOR, KARUNEEGAR STREET,, ADAMBAKKAM, CHENNAI - 600088, TAMIL NADU, INDIA 23-6-2016
1968 IHT NETWORK LIMITED 3852/9 2ND FLOOR KANHAIYA NAGAR, TRI NAGAR DELHI 4-11-2016
1969 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA 18-11-2016
1970 IIB EDUCATION PRIVATE LIMITED IIB EDUCATION PRIVATE LIMITED, 3RD FLOOR, CORPORATION SHOPPING COMPLEX, NADUVILAL, THRISSUR, KERALA 21-12-2016
1971 IICT SOFTWARE SOLUTIONS 84-C LAKSHMI COMPLEX,RAMESH THEATRE BUS STOP,TRICHY ROAD,NAMAKKAL 2-2-2015
1972 IIP FOUNDATION 4852/24, ANSARI ROAD, DARYA GANJ, NEW DELHI 29-2-2016
1973 IITTSD PRIVATE EDUCATION TRUST BARI CO-OPERATIVE COLONY,PLOT NUMBER -424,POST - SECTOR-12,DIST-BOKARO,STATE-JHARKHAND,PIN-827012 8-1-2016
1974 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA 4-1-2016
1975 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA 14-10-2015
1976 IKF TECHNOLOGIES LIMITED 2ND FLOOR, PLOT J1/12, BLOCK EP & GP, SECTOR V, SALT LAKE, KOLKATA 15-9-2015
1977 ILEAD FOUNDATION 316 BANGUR PARK, P.O- RISHRA, DISTRICT- HOOGHLY 26-7-2016
1978 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA 22-8-2016
1979 ILEAD FOUNDATION 113J, MATHESWARTALA ROAD, TANGRA, KOLKATA, WEST BENGAL 700046 24-8-2016
1980 ILEAD FOUNDATION 113 J,MATHESHWARTOLA ROAD,TOPSIA 24-8-2016
1981 ILFS EDUCATION AND TECHNOLOGY SERVICES LIMITED ILFS FINANCIAL CENTRE, 3RD FLOOR, PLOT NO C-22, G BLOCK, BANDHRA KURLA COMPLEX, BANDHRA, MUMBAI 30-9-2013
1982 ILFS SKILLS DEVELOPMENT CORPORATION LIMITED 2ND FLOOR, NIRYAT BHAWAN, RAO TULA RAM MARG, OPP TO ARMY HOSPITAL RESEARCH AND REFERRAL, NEW DELHI 8-5-2014
1983 ILOCUS CONSULTING PVT LTD 12 FACTORY ROAD UPPER SOURA, SRINAGAR, JAMMU AND KASHMIR 21-10-2016
1984 IMAGE CREATIVE EDUCATION PRIVATE LIMITED HEAD OFFICE: 61/32, T.T.K. ROAD, ALWARPET, CHENNAI - 600018 REGD OFFICE: OLD NO.12, NEW NO.15, 16TH AVENUE, ASHOK NAGAR, CHENNAI - 600083 3-2-2015
1985 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI 18-5-2016
1986 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI 12-5-2016
1987 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI 17-5-2016
1988 IMARQUE SOLUTIONS PVT LTD 9 AND 10 THEYAGARAYA RAOD T NAGAR CHENNAI 26-4-2016
1989 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL) BUIDLING, SAHAR ROAD, ANDHERI EAST. 29-11-2016
1990 IMARTICUS LEARNING PRIVATE LIMITED 5TH FLOOR, B WING, KALEDONIA (HDIL)BUILDING, VIJAY NAGAR, SAHAR ROAD, ANDHERI EAST, MUMBAI 11-11-2016
1991 IMPACT NE KAMALABARI, MAJULI, JORHAT, ASSAM 8-1-2016
1992 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17, MIAN WALI NAGAR MAIN ROHTAK ROAD PASCHIM VIHAR NEW DELHI 24-5-2016
1993 IMPACT PARAMEDICAL AND HEALTH INSTITUTE RR-17 MIAN WALI NAGAR ROHTAK ROAD PASCHIM VIHAR NEW DELHI 11-5-2016
1994 IMPETUS HEALTHCARE SKILLS PRIVATE LIMITED NO: 2, BLOCK - 5- B, HARINI PARADISE, 25TH STREET, ASTHALAKSHMI NAGAR, ALAPAKKAM, CHENNAI 15-9-2015
1995 IMPROVE NETWORKING TECHNICAL EDUCATION PVT LTD INT COMPUTER CENTRE PAWAN PLAZA, SUBHASH CHOWK ATLAS ROAD, DIST-SONIPAT, HARYANA 21-10-2016
1996 IMS HEALTH INFORMATION AND CONSULTING SERVICES INDIA PRIVATE LIMITED IMS HEALTH INFORMATION AND CONSULTING SERVICES INDIA PRIVATE LIMITED, ICC CHAMBERS II, 4TH FLOOR, SAKIVIHAR ROAD, POWAI, MUMBAI 3-2-2014
1997 IMS PROSCHOOL PVT LTD 529,COMMODITY EXCHANGE MARKET BUILDING, PLOT NO 2,3,4, SECTOR 19A,VASHI, NAVI MUMBAI 10-10-2013
1998 INDIAA E/I/1, JYANGRA SOUTH MATH, BAGUIATI, KOLKATA 27-9-2016
1999 INDIACAN EDUCATION PRIVATE LIMITED 6TH FLOOR, KNOWLEDGE BOULEVARD, A-8(A), SECTOR 62, NOIDA 30-9-2013
2000 INDIAEDUNEXT 16, NEW KAILAS NAGAR, NEAR RAMDUT HANUMAN MANDIR, NAGPUR, MAHARASHTRA - 440027 23-6-2016
2001 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, BESIDE SBH BANK, OPP.MEENAKSHI GARDENS,ADDANKI 22-7-2016
2002 INDIA EVANGELICAL ANDEDUCATIONAL RURAL DEVELOPMENT D.NO.34-22, OPP.MEENKASHI GARDESN, BESIDE SBH BANK, ADDANKI-523201 17-5-2016
2003 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 5-2-2016
2004 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE, BUILDING, NEHRU PLACE, NEW DELHI 6-4-2016
2005 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 26-2-2016
2006 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 14-12-2016
2007 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50 RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 10-11-2016
2008 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406,59-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 20-12-2016
2009 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 21-12-2016
2010 INDIA FOUNDATION FOR RURAL DEVELOPMENT STUDIES ROOM NO. 406, 49-50, RED ROSE BUILDING, NEHRU PLACE, NEW DELHI 15-3-2016
2011 INDIAN CENTRE FOR ADVANCEMENT OF RESEARCH AND EDUCATION HALDIA ICARE COMPLEX, HIT CAMPUS, P.O. HATIBERIA, DIST. PURBA MEDINIPUR, PIN - 721 657 6-10-2016
2012 INDIAN CHILD WELFARE SERVICE ICWS, TIRUNAVALUR 607 204, TAMIL NADU, INDIA 14-7-2014
2013 INDIANEYE SECURITY PVT LTD 6TH FLOOR, LE MERIDIEN COMMERCIAL TOWER RAISINA ROAD, NEW DELHI 8-5-2014
2014 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA 29-6-2016
2015 INDIAN INSTITUTE FOR PRODUCTION MANAGEMENT NEAR L&T CAMPUS, KANSHBAHAL, ROURKELA, ODISHA 5-8-2016
2016 INDIAN INSTITUTE OF COMPUTER SCIENCE MANAGEMENT OPP. OF DEGREE COLLEGE, ANTU ROAD, AMETHI 26-7-2016
2017 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI, 28-9-2016
2018 INDIAN INSTITUTE OF ENTREPRENEURSHIP BASISTHA CHARIALI, N.H-37 BYPASS, NEAR GAME VILLAGE, LALMATI 16-11-2016
2019 INDIAN INSTITUTE OF ENTREPRENEURSHIP IIE BHAWAN, BASISTHA CHARIALI, LALMATI, GUWAHATI-29 28-10-2016
2020 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI 8-4-2016
2021 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOT PALAM EXTENSION SECTOR-7 DWARKA NEW DELHI 26-4-2016
2022 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA, NEW DELHI 14-9-2015
2023 INDIAN INSTITUTE OF HIGH EDU AND RESEARCH TRUST D-409 FIRST FLOOR PALAM EXTENSION SECTOR-7 DWARKA NEWDELHI 19-5-2016
2024 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHN NO 16 2ND FLOOR GARDEN HOTEL COMPLEX BH ROAD NELMANAGALA 5-1-2016
2025 INDIAN INSTITUTE OF MULTIMEDIA AND ANIMATION TECHNOLOGY NO.15, 2ND FLOOR, GARDEN HOTEL COMPLEX, OPP KSRTC BUS STAND, B H ROAD, NELAMANGALA. BANGALORE. 18-10-2016
2026 INDIAN INSTITUTE OF NATURAL RESOURCES MANAGEMENT C-29 , 1ST FLOOR , OPP POCKET 1 , ACHARYA NIKETAN, MAYUR VIHAR PHASE 1 , DELHI 10-10-2013
2027 INDIAN INSTITUTE OF SKILL DEVELOPMENT PVT LTD B-13, INFOCITY PART -I, NEAR HERO HONDA CHOWK, SEC -34 GURGAON 122001 (HARYANA) 11-10-2013
2028 INDIAN MEDICAL AND ORPHAN FELLOWSHIP DR NO:12-8-14,RAYE PETA,NIDADAVOLE,WEST GODAVARI DIST,A.P 7-1-2015
2029 INDIAN RURAL DEVELOPMENT ASSOCIATION NO.15, NEW BUS STAND, KATTUMANNAR KOIL, CUDDALORE DISTRICT 13-9-2015
2030 INDIAN RURAL DEVELOPMENT ASSOCIATION #15 NEW BUS STAND COMPLEX, KATTUMANNAR KOIL TALUK, CUDDALORE DISTRICT, TAMIL NADU 14-10-2015
2031 INDIAN SOCIAL SERVICE H.NO: 11-16-77, KASHIBUGGA, WARANGAL 8-12-2013
2032 INDIAN SOCIETY FOR DEVELOPMENT OF EDUCATION 34/41, DELHI- ROHTAK ROAD, NH- 10, ASODHA, BAHADURGARH, HARYANA- 124507. 22-12-2016
2033 INDIAN SOCIETY OF AGRIBUSINESS PROFESSIONALS 23, ZAMRUDPUR COMMUNITY CENTRE, KAILASH COLONY EXTENSION, DELHI 4-10-2013
2034 INDIRA GANDHI COMPUTER SHAKSHARTA MISSION IGCSM BHAWAN 36B/1 SECOND FLOOR GOVINDPURI KALKAJI NEW DELHI 8-12-2013
2035 INDIRA WOMEN ORGANIZATION FOR VOLUNTARY ACTION AT. SIANBAHAL,POST. TASLADIHI,DIST. SUNDERGARH,ODISHA,770002 13-5-2016
2036 INDO AUTOTECH LTD PLOT NO 332 338 SECTOR 24 FARIDABAD HARYANA 27-12-2013
2037 INDO DANISH TOOL ROOM M-4 (PART) PHASE-VI, TATA KANDRA ROAD, GAMHARIA,JAMSHEDPUR 12-1-2016
2038 INDO DANISH TOOL ROOM M-4 (PART),PHASE -VI TATA KANDRA ROAD, GAMHRIA,JAMSHEDPUR 5-1-2016
2039 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM, VISAKHAPATNAM 2-12-2015
2040 INDO GERMAN INSTITUTE OF ADVANCED TECHNOLOGY #38-22-29, INDUSTRIAL ESTATE, KANCHARAPALEM VISAKHAPATNAM, ANDHRA PRADESH, INDIA 28-9-2015
2041 INDO GLOBAL SOCIAL SERVICE SOCIETY NDO-GLOBAL SOCIAL SERVICE SOCIETY 28, LODI ROAD INSTITUTIONAL AREA NEW DELHI 14-9-2015
2042 INDO GLOBAL SOCIAL SERVICE SOCIETY IGSSS 28, LODHI ROAD 4-11-2015
2043 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 14-10-2015
2044 INDRA EDUCATIONAL AND WELFARE SOCIETY NEAR SAGHAN KSHETRA KIDWAI NAGAR PUKHRAYAN KANPUR DEHAT 209111 17-9-2015
2045 INDRAPRASTHA ACADEMY FOUNDATION C-50 SECTOR-62 NOIDA 24-8-2015
2046 INDUCTUS CONSULTANTS PRIVATE LIMITED HO - C - 927, PALAM EXTENSION, SECTOR - 7, DWARKA, NEW DELHI - 110045. RO - 311, 3RD FLOOR, N.P CENTER, NEW DAK BUNGLOW ROAD, PATNA - 800001 22-1-2014
2047 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA 15-3-2016
2048 INDUS EDUCATIONAL AND CHARITABLE TRUST 52 FOREST PARK, BHUBANESWAR, ODISHA 6-4-2016
2049 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE 19-10-2016
2050 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGALA BANGALORE 19-10-2016
2051 INDUS EDUTRAIN PVT LTD NO 9 AVS COMPOUND 80 FEET ROAD KORAMANGLA 19-10-2016
2052 INDUSINFO MANAGEMENT PRIVATE LIMITED 256/D, FOREST PARK, BHUBANESWAR 19-10-2016
2053 INDUS INTEGRATED INFORMATION MANAGEMENT LIMITED HEAD OFF:BE 103, SALT LAKE CITY 1, KOLKATA 700064 BRANCH OFF: LEELAVRAT CENTRAL APARTMENT, 1ST FLOOR, NEAR ALPANA MARKET, PATLIPUTRA COLONY, PATNA BIHAR 3-1-2014
2054 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE, 5-4-2016
2055 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE, HSR LAYOUT SECTOR 2, NEAR UBER OFFICE ,BEHIND DHL WAREHOUSE, 15-3-2016
2056 INDUSTREE SKILLS TRANSFORM PVT LTD 35/6, SOMASUNDRAPALYA , AGR INDL ESTATE,HSR LAYOUT SECTOR 2, NEAR UBER OFFICE. BEHIND DHL WARE HOUSE 16-3-2016
2057 INFLIGHT AIRWAYS TRAINING PRIVATE LTD KASHI CLASSES 17/317-3,BESIDE POLICE CHAUKI NADESAR,VARANASI 11-1-2016
2058 INFO DOSKEY SOFTWARE PRIVATE LIMITED FLAT NO-1-101 KC TOWER,NEAR HP PETROL PUMP, KANKARBAGH MAIN ROAD PATNA 4-4-2016
2059 INFO INTERNATIONAL EDUCATIONAL AND WELFARE SOCIETY "INFO BUILDING", 246, BANKHANDI ROAD NEAR RAILWAY STATION, RISHIKESH, DISTT.- DHRADUN. UTTARAKHAND - 249201 22-1-2014
2060 INFORMATION TECHNOLOGY RESOURCE CENTER 113 THE HORIZON. NATH MANDIR ROAD. 11/5 SOUTH TUKOGANJ. INDORE. M.P. 1-9-2014
2061 INFOSOFT COMPUTER EDUCATION DOOR NO 4-10-18/10, BESIDES BSNL EXCHANGE, JANAKIRAM NAGAR COLONY, SRIKAKULAM 18-10-2016
2062 INFOSYS FEDERATION AND EDUCATIONAL COUNCIL 672/8, SHARDA NAGAR, RATTAN GARH ROAD, MANAV CHOWK, AMBALA CITY.-134003, HARYANA 14-9-2015
2063 INFOSYS INSTITUTE OF TECHNOLOGY 81, SOUTH MAIN STREET, SUDHARSAN COMPLEX, TIRUVARUR 12-11-2014
2064 INFOVA CONSULTANCY SERVICES LIMITED CORPORATE OFFICE ASIA- PACIFIC- INFOVA, 4TH FLOOR, STATESMAN HOUSE BUILDING, BARAKHAMBA ROAD, CONNAUGHT PLACENEW DELHI-110001 (INDIA) TELL- +91 11 30446489, FAX-91 11 30446500 11-5-2015
2065 INFOVALLEY EDUCATIONAL AND RESEARCH PVT LTD LEVEL 4, PURNIMA COMMERCIAL COMPLEX, CHRISTIAN BASTI, G.S.ROAD 14-12-2016
2066 INFRASTRUCTURE SKILL DEVELOPMENT ACADEMY PLOT NO.32, ANAND INDUSTRIAL ESTATE, MOHAN NAGAR 5-12-2013
2067 INGENIOUS LEARNING SOLUTION PVT LTD Q-5/2, DLF PHASE-2, GURGAON, HARYANA. 5-1-2016
2068 INGENIOUS LEARNING SOLUTIONS PVT LTD Q-5/2, DLF PHASE-2, GURGAON 15-9-2015
2069 INIFD COCHIN CAMPUS 2ND FLOOR VATTOLY BUILDING SRM ROAD ERNAKULAM 22-6-2015
2070 INIYAUDAIYAM CHARITABLE TRUST 2, AZAGIRISAMY STREET PERIYAR NAGAR AVADI CHENNAI 14-9-2015
2071 INNASIMUTHU MICHEAL ANTONY CHARITABLE TRUST 2-240 ,KALAIYAR KARISAL KUALM WEST ARUPPUKOTTAI TK VIRUDHUNAGAR DT 12-9-2015
2072 INNOVATE VENTURES INDIA PRIVATE LIMITED REGD :37,OFFICE LANE,AGARTALA CORP:NO:4,MANTRIBARI ROAD,AGARTALA 2-6-2014
2073 INNOVATIVE BASAL MANAGEMENT PVT LTD #4, SALKIA SCHOOL ROAD, NEAR GOLABARI POLICE STATION, HOWRAH, WEST BENGAL 7-1-2015
2074 INNOVATIVE FOUNDATION INNOVATIVE FOUNDATION INNOVATIVE VOCATIONAL AND SKILL DEVELOPMENT CENTER RAJARAJESHWARI NAGAR 4TH CROSS RANEBENNUR DIST HAVERI 11-11-2014
2075 INNOVISION LIMITED 68/273,1ST,2ND&3RD FLOOR, SUKHRALI,MG ROAD,GURGAON(HR). 25-8-2014
2076 INNOVIZE THERMAL SOLUTIONS PRIVATE LIMITED 904, 9TH FLOOR, BLDG A2, PHASE 1, S.NO 15/1 & 16/2/1, THE LAKE DISTRICT, YEOLEWADI, PUNE 411048, MAHAEASHTRA 6-1-2016
2077 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI 14-8-2015
2078 INOPEN TECHNOLOGIES PRIVATE LIMITED 202, DELTA, HIRANANDANI GARDENS, POWAI, MUMBAI 11-8-2015
2079 INSTITUTE FOR INTEGRATED RURAL DEVELOPMENT IIRD IIRD COMPLEX,BYE PASS ROAD, SHANAN,SANJAULI, SHIMLA-6, H.P. 3-1-2014
2080 INSTITUTE OF COMPUTER ENGINEERING VILL - GOBARDHANPUR, P.O. - KAKDWIP, P.S. - KAKDWIP HARWOOD POINT COASTAL, DIST - SOUTH 24 PARGANAS, STATE - WEST BENGAL 14-10-2016
2081 INSTITUTE OF CONTINUING EDUCATION RES AND TRAINING 472 PEPEE COMPOUND, RANCHI, JHARKHAND, INDIA 17-5-2016
2082 INSTITUTE OF CONTINUING EDUCATION RESEARCH AND TRG 472 PEPEE COMPOUND RANCHI 20-7-2016
2083 INSTITUTE OF EDUCATION TRAINING AND DEVELOPMENT TECHNOLOGY BHAVAN PB NO : 30 , NP ROAD , IRITTY KANNUR DISTRICT 14-3-2016
2084 INSTITUTE OF ENGINEERING AND MANAGEMENT TRUST 120, SDF BUILDING SALT LAKE, SECTOR-V, KOLKATA 14-9-2015
2085 INSTITUTE OF ENTREPRENEURSHIP DEVELOPMENT U P A-1 & A-2 SAROJINI NAGAR INDUSTRIAL AREA, KANPUR ROAD, LUCKNOW 19-5-2014
2086 INSTITUTE OF FIRE SAFETY AND DISASTER MANAGMENT S VILLAGE NAVAGAMA, POST-JAROD,TAL-WAGHODIA, DIST-VADODARA,GUJARAT,INDIA 8-11-2013
2087 INSTITUTE OF INSURANCE STUDIES 7-1-212/A/58/A, 1ST FLOOR, MASTERBLISS APARTMENT, PLOT NO 73/A, SHIVABAGH COLONY, AMEERPET, HYDERABAD 25-7-2014
2088 INSTITUTE OF LEADERSHIP DEVELOPMENT 6/2 JAMDOLI JAIPUR 2-6-2014
2089 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR,KANTHI SHIKARA ,PANJAGUTTA,HYDERABAD 28-10-2016
2090 INSTITUTE OF PERFECT SAFETY AND SURVEILLANCE 6-3-668/9/5,G-BLOCK,2ND FLOOR, KANTHI SHIKARA,PANJAGUTTA,HYDERABAD-500082 19-10-2016
2091 INSTITUTE OF SCIENCE AND MANAGEMENT ISM CAMPUS, PUNDAG RANCHI 30-10-2013
2092 INSTYLE EXPORTS PRIVATE LIMITED PLOT NO 32-33 SEC-4 MANESAR 15-9-2015
2093 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY F-46,HRANTHANGA BUILDING, LOWER CHANMARI,AIZAWL 30-11-2016
2094 INTEGRATED DEVELOPMENT AND ENVIRONMENTAL AWARENESS SOCIETY IDEAS F-46,HRANTHANGA BUILDING LOWER CHANMARI, AIZAWL 18-11-2016
2095 INTEGRATED DEVELOPMENT ORGANISATION 12-180, VIHARI TOWERS, HNR ROAD, KODADA - 508206, NALGONDA DIST, A.P. 29-3-2014
2096 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP 1-9-2016
2097 INTEGRATED HUMAN DEVELOPMENT ORGANIZATION INTEGRATED HUMAN DEVELOPMENT ORGANIZATION, 22-86, PATHAPETA, BANK STREET, NUZVID, KRISHNA DISTRICT, AP 30-8-2016
2098 INTEGRATED RURAL DEVELOPMENT CENTRE CTS NO: 712, BABALADI GALLI, SYNDICATE BANK ROAD HUKKERI. DIST: BELGAUM PI: 591309 14-9-2015
2099 INTEGRATED VOCATIONAL EMPLOYMENT EXCHANGE PRIVATE 301,SURAJ MANSION,AMEERPET,HYDERABAD 20-9-2016
2100 INTELLECT HR SERVICES PRIVATE LIMITED T-136/4, 1ST FLOOR, ABC BUILDING, SHIVALIK MAIN ROAD, MALVIYA NAGAR, NEW DELHI 9-11-2013
2101 INTELLIGENCE MANPOWER SERVICES PVT LTD 303-304 , JOP PLAZA , SEC -18 , NOIDA , UTTAR PRADESH 17-1-2017
2102 INTELLIGENCE MANPOWER SERVICES PVT LTD 303/304, JOP PLAZA, SECTOR-18, NOIDA, UTTAR PRADESH 29-12-2016
2103 INTELLIGENCE MANPOWER SERVICES PVT LTD CORPORATE OFFICE- 303/304 JOP PLAZA, SECTOR 18, NOIDA, UTTAR PRADESH DISTRICT GAUTAM BUDH NAGAR 28-9-2016
2104 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC”18, NOIDA, UTTAR PRADESH, INDIA 8-6-2016
2105 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SEC-”18, NOIDA, UTTAR PRADESH, INDIA DISTRICT: GAUTAM BUDDHA NAGAR STATE: UTTAR PRADESH 20-7-2016
2106 INTELLIGENCE MANPOWER SERVICES PVT LTD JOP PLAZA, 303-304, SECTOR 18, NOIDA, UTTAR PRADESH, INDIA 24-6-2016
2107 INTELLI PLUS EDUCATIONAL AND TRAINING SERVICES IETS WZ-54, THIRD FLOOR; OPPOSITE METRO PILLAR NO.219, NR.WEST PATEL NAGAR, NEW DELHI 22-9-2016
2108 INTERACT HR CONSULTANTS 382/4, IIND FLOOR, SULTANPUR, NEAR AVALON HOTEL, NEW DELHI 9-9-2016
2109 INTERACTIVE INSTITUTE OF JOBSKILLS PVT LTD NO 167 HENNUR MAIN ROAD BANGALORE 17-4-2015
2110 INTERNATIONAL CHAMBER FOR SERVICE INDUSTRY 121, FIRST FLOOR, ANSAL BHAWAN, KASTURBA GANDHI MARG, CONNAUGHT PLACE, DELHI 18-9-2015
2111 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA , WEST BENGAL , 741202 16-3-2016
2112 INTERNATIONAL COLLEGE NASRA , RANAGHAT , NADIA W.B , 741202 12-5-2016
2113 INTERNATIONAL COLLEGE 108/2 BIDHAN SARANI SHYAMBAZAR KOLKATA 6-1-2016
2114 INTERNATIONAL COLLEGE NASRA RANAGHAT NADIA 741202 5-4-2016
2115 INTERNATIONAL COMPUTER INSTITUTE 187, UDYOG KENDRA 1, GREATER NOIDA 5-12-2013
2116 INTERNATIONAL INSTITUTE OF TECHNOLOGY TRAINING 10-3-160/2 2ND FLOOR OPP SAROJNI DEVI EYE HOSPITAL HUMYUN NAGAR MEDHIPATNAM 5-9-2016
2117 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022 22-6-2016
2118 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, Vijay Plaza, Opp. Abad Dairy, Kankaria, Maninagar, Ahmedabad- 380022 26-4-2016
2119 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022 29-4-2016
2120 INTERNATIONAL RURAL HEALTH ASSOCIATION F- 34, VIJAY PLAZA, OPP. ABAD DAIRY, KANKARIA, MANINAGAR, AHMEDABAD- 380022 12-5-2016
2121 INTROSPECTIVE DETECTIVES PRIVATE LIMITED 2/228, VISHWASH KHAND GOMTINAGAR, LUCKNOW 3-2-2014
2122 INVOLUTE AUTOMATION PRIVATE LIMITED D3, PHASE IV, EXTN IDA, JEEDIMETLA HYDERABAD 13-1-2014
2123 INVOLUTE INSTITUTE OF TECHNICAL TRAINING PRIVATE LIMITED 2ND FLOOR, PLOT 35, TECHNOCRATS INDUSTRIAL ESTATE, BALANAGAR 24-1-2014
2124 IPSR IPSR SOLUTIONS LTD., MERCHANT'S ASSOCIATION BUILDING, M. L. ROAD, KOTTAYAM 8-12-2013
2125 IQBAL NARAIN SRIVASTAVA MEMORIAL SOCIETY B-73, NIRALA NAGAR LUCKNOW 8-12-2013
2126 IQBRI TELECOM PRIVATE LIMITED 2ND FLOOR, SCF-112, PHASE-3B2, MOHALI(SAS NAGAR), PUNJAB(160059) 6-4-2016
2127 IQRA HANIF SANSTA WARD NO 13 RATAN NAGAR DIST CHURU 6-7-2016
2128 IQRA HANIF SANSTA NEAR UCO BANK, OPP PARKH BALIKA SCHOOL, BHARTIYA LINK ROAD, CHURU (RAJ.) 331001 12-5-2016
2129 IQRA HANIF SANSTHA NEAR UCO BANK, OPP. PARKH BALIKA SCHOOL, BHARTIYA HOSPITAL ROAD, CHURU (RAJASTHAN) 331001 26-4-2016
2130 IRAITHAMIZH MANITHA VALA MEMBATTU ARAKATTALAI 13 MUTHU NAGAR THIRUKANDESWARAM NELLIKUPPAM 18-9-2015
2131 IRC ACADEMY NIRMALA CENTRE, THIRD FLOOR,NEAR LATHA THEATRE, THODUPUZHA ROAD,MUVATTUPUZHA-686661 23-5-2016
2132 IRIS LEARNINGS 1ST FLOOR, ABOVE PNB, GOBINDPURI BRANCH, OPP. GANGA PETROL PUMP 6-1-2016
2133 IRL ENTERPRISES 7/A REKHANKIT HSG SOC, D.K. NAGAR, GANGAPUR ROAD, NASHIK 18-7-2014
2134 ISHA DISTRIBUTION HOUSE PVT LTD 5 KUSTIA ROAD, KEOLA BHAWAN, NEAR KOHINOOR MARKET, 18-9-2015
2135 ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST EAST SINGHBHUM STATE: JHARKHAND PIN: 832101 16-12-2016
2136 I SHARE BUSINESS SERVICES INDIA PVT LTD 406, ARCHANA ARCADE ST. JOHN'S ROAD, SECUNDERABAD TELANGANA - 500025 INDIA 22-2-2016
2137 ISHWARYA TECHNO SOLUTIONS DOOR NO: 68-1-10,BEHIND RAVI SWEETS, PATAMATA, VIJAYAWADA 17-3-2015
2138 ISIT A DIVISION OF CYBER SYNERGY PRIVATE LTD ISIT BLDG,H/B-1,CITY CENTRE,SECTOR IV, BOKARO STEEL CITY 13-9-2015
2139 ISMART ISHAN SATPATHY SOCIAL MOVEMENTS FOR ACADEMICS AND RURAL TECHNOLOGY. (ISMART) JAMIRDIHA,(BAHARAGORA) PO – CHANDRAPUR, ON MATIHANA CHAKULIYAROAD, DIST – EAST SINGHBHUM 9-9-2016
2140 ISOL TALENT CONSULTING PRIVATE LIMITED #36,3RD FLOOR, REVE PABBATHI BUILDING,SOUTH END ROAD,BASAVANAGUDI, BANGALORE. 15-1-2015
2141 ISTAR SKILL DEVELOPMENT PVT LTD 1ST FLOOR, "AKSHAYA", 63/2, 18TH CROSS, MALLESWARAM, BANGALORE, KARNATAKA 560055 5-1-2016
2142 ISWARYAM COMMUNITY DEVELOPMENT TRUST 4/24, SOUTH STREET, OLD BATLAGUNDU POST, NILAKOTTAI TALUK, DINDIGUL DISTRICT 13-11-2014
2143 I T ACADEMICS PRIVATE LIMITED 3RD FLOOR DHAN NIRMAN COMPLEX 15 ASHOK MARG LUCKNOW 17-12-2013
2144 ITCON SKILL DEVELOPMENT FOUNDATION 2554, SEC E SUDAMA NAGAR, INDORE M.P. 15-4-2014
2145 ITCOT CONSULTANCY AND SERVICES LTD 50-A GREAMS ROAD, CHENNAI 4-10-2013
2146 ITECC EDUCATION PRIVATE LIMITED B-20-2607, STATE BANK OF HYDERABAD BUILDING, IST FLOOR, FEROZEPUR ROAD, LUDHIANA, PUNJAB 13-1-2014
2147 ITFT CONSULTANCY PVT LTD SCO 1-2-3, SECTOR-17-D, LEVEL-III, OPPOSITE RBI, CHANDIGARH 4-10-2013
2148 IT MASTER COMPUTER EDUCATION 3-326, S.R.R. COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL TELENGANA 20-1-2015
2149 IT MASTER COMPUTER EDUCATION IT MASTER COMPUTER EDUCATION 3-326 MAIN ROAD BHUPALPALLY, WARANGAL 20-1-2015
2150 ITM EDUTECH TRAINING PRIVATE LIMITED 10TH FLOOR, PLATINUM TECHNOPARK, OPP. VASHI RAILWAY STATION, VASHI, NAVI MUMBAI 4-4-2016
2151 ITSC TECHNOLOGIES PVT LTD 507, BDA COMPLEX 7 NO. STOP, SHIVAJI NAGAR, BHOPAL 4-3-2016
2152 IT SHASTRA INDIA PVT LTD ITSHASTRA (INDIA) PVT LTD. 3RD FLOOR, ICE FACTORY BUILDING, NEAR BPL GALLERY, GOKHALE RD, NAUPADA,THANE (WEST), INDIA - 400 601 11-8-2014
2153 I T TRAINING INSTITUTE RANE APARTMENT, JOY KRISHNA BAZAR, BESIDE AXIS BANK, TARAKESWAR, HOOGHLY, WEST BENGAL 8-9-2016
2154 I T TRAINING INSTITUTE BUS STAND MARKET COMPLEX. TARKESWAR, HOOGHLY 14-9-2015
2155 ITUNES TRAINING SOLUTIONS PRIVATE LIMITED 6/623 OPP KSEB SUBSTATION PAVANGAD CALICUT ATHOLY RD KOZHIKKODE KERALA-673021 13-11-2014
2156 IT WORLD MANDIR MARG, DESH BANDHU ROAD ,PURULIA 1-6-2016
2157 IVALUE CONSULTING PRIVATE LIMITED 314,QUTUB PLAZA, DLF CITY, PHASE -1,GURGAON, HARYANA 30-1-2016
2158 IVALUE CONSULTING PRIVATE LIMITED 314, 3RD FLOOR, DLF QUTAB PLAZA, DLF CITY, PHASE 1, GURGAON, HARYANA 11-1-2016
2159 I VINTAGE SOLUTIONS PRIVATE LIMITED BHASHYAM KAMINENI RESIDENCY, YUSUFGUDA, HYDERABAD, ANDHRA PRADESH 17-12-2013
2160 IZAD ROAD NO.13-C, RAJENDRANA NGAR,PATNA-800016,BIHAR 29-6-2016
2161 JABALPUR VYVSAYIK PRASHIKCHAN SAMAJ KALYAN SAMITI JDA BUILDING PLAN NO.19 ,FOUR LANE NH-7/NH-12 MADAN MAHAL CHOWK JABALPUR MADHYA PRADESH,INDIA 2-5-2014
2162 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE,OOTY ROAD,PERINTHALMANNA 14-9-2015
2163 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST K P ARCADE ,OOTY ROAD,PERINTHALMANNA,MALAPPURAM DISTRICT,679322,KERALA STATE 8-9-2016
2164 JACOB AND MARGARET MEMORIAL CHARITABLE TRUST KP ARCADE, OOTY ROAD, PERINTHALMANNA, MALAPPURAM DISTRICT 19-10-2016
2165 JAGDAMBI PRASAD YADAV SMRITI PRATISHTHAN MIG-153,LOHIYA NAGAR, KANKARBAGH COLONY PATNA ,BIHAR. 1-12-2014
2166 JAGO BISWA 3/6-A, KATAGANJ, P.O.- KATAGANJ, P.S.- KALYANI, DIST.- NADIA, WEST BENGAL 30-11-2016
2167 JAGRITI ABHIYAN JAGRITI ABHIYAN, C/O MR. SHANKAR PODDAR, VILLAGE-SIWRI, P.O-MANJHOL, BEGUSARAI, BIHAR 3-4-2014
2168 JAGRITI EDUCATION SOCIETY 1/205, SAKET NAGAR BEAWAR 21-12-2016
2169 JAGRITI JAN KALYAN SAMITI JILA PRATHMIKSHIK SHAK SHANG SIYARAMNAGAR,BHIKAHNPUR,BHAGALPUR 2-2-2015
2170 JAGRITI SOCIAL WELFARE SOCIETY H.NO. 72, GROUND FLOOR, BHERA ENCLAVE,PASHIM VIHAR, NEW DELHI-110087 29-6-2016
2171 JAGRUTHI RURAL AND URBAN DEVELOPMENT SOCIETY JAGRUTHI RURAL & URBAN DEVELOPMENT SOCIETY # 6-3-1148, SAVARKAR NAGAR, NEAR S.T.HOSTEL, RAMGIRI,NALGONDA DIST.AP. EMAIL: LAXMINARAYANA_SINGAM@YAHOO.COM CELL: 9059893329 7-5-2014
2172 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA 29-6-2016
2173 JAGRUTI EDUCATION AND WELFARE SOCIETY KOHEDA ROAD, CHINTHAPALLYGUDA (V), IBRAHIMPATNAM (M), RANGAREDDY DIST, HYDERABAD, TELANGANA 27-6-2016
2174 JAGRUTI FOUNDATION FOR RURAL DEVELOPMENT SANKARAM , BATLAPUDI , ANAKAPALLI MANDAL , VISAKHAPATNAM , ANDHRA PRADESH 30-9-2013
2175 JAGRUTI GRAMIN BAHUUDDESHIYA VIKAS SANSTHA GARGOTI A/P:SUDARSHAN NAGAR, GARGOTI 1-3-2016
2176 JAHANVI 217, RAM VIHAR, NEAR BHARAT NATIONAL PUBLIC SCHOOL, KARKARDOOMA, DELHI 22-12-2013
2177 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN 29-6-2016
2178 JAI BHAIRAV WELFARE SOCIETY SRI VIDHYAPEETH CAMPUS OUTSIDE NATHUSAR GATE BEHIND NAVAL STUDIO BIKANER RAJASTHAN 17-5-2016
2179 JAI BHARATH COLLEGE OF MANAGEMENT AND ENGINEERING TECHNOLOGY JAI BHARATH COLLEGE, JB CAMPUS ARACKAPPADY, VENGOLA P.O PERUMBAVOOR , COCHIN KERALA 683 556 INDIA 18-9-2015
2180 JAI BHARTI SHIKSHA KENDRA 1326, NEAR POST OFFICE MAJHAGAWAN,MAJHAGAWAN,SIHORA, JABALPUR,MADHYA PRADESH 3-4-2014
2181 JAIDEV EDUCATION SOCIETY EMPRESS MILL ROAD NO. 1, MARWADI CHAWL, SANTRA MARKET,NAGPUR 30-10-2015
2182 JAI JUI CHARITABLE TRUST AT - GHANWAD POST: GARDI,TALUKA: KHANAPUR, DIST: SANGLI (MAHARASTRA) 4-10-2013
2183 JAI MAHAKALI SHIKSHAN SANSTHA AGNIHOTRI COLLEGE CAMPUS, BAPUJI WADI, RAMNAGAR, WARDHA-442001 (MAHARASHTRA) 7-1-2016
2184 JAI MAHAMAYA PRATHAMIK UPBHOKTA SHAKARI BHANDAR MARYADIT BEHIND GOVERNMENT SCHOOL, MADHUBAN ROAD, DAYALBAND 17-1-2017
2185 JAIN WELFARE TRUST 107 OLD DHAN MANDI, SRI GANGANAGAR, RAJASTHAN 3-11-2016
2186 JAIPRAKASH SEWA SANSTHAN 63,BASANT LOK, VASANT VIHAR, NEW DELHI 15-4-2014
2187 JAIPUR ZILA VIKAS PARISHAD 80/179, MAHARSHI GAUTAM MARG, MANSAROVAR, JAIPUR. 3-1-2014
2188 JANAJAGARAN KENDRA AT/PO- BELAPADA, VIA- GADASILA, DIST- DHENKANAL, ODISHA 8-4-2016
2189 JANAJAGARAN KENDRA AT/PO- BELAPADA,VIA- GADASILA, DIST- DHENKANAL, ODISHA 5-4-2016
2190 JANAKALYAN AT/PO-HALADIA,VIA-N.KOILI,DISTT-CUTTACK 14-12-2015
2191 JANAKALYAN PARISHAD VILLAGE:NAYAPARA,PO-DHARMANAGAR,NORTH TRIPURA DISTRICT 12-9-2016
2192 JANAKALYAN PRATISTHAN SIVANANDA NAGAR, D.F.O. OFFICE ROAD, PARLAKHEMUNDI, DIST. GAJAPATI, ODISHA 29-3-2014
2193 JANAKALYAN SAMITEE AT- RAMCHANDRAPUR PO-GULNAGAR DIST- KENDRAPARA 1-9-2014
2194 JANASADHANA AT-PLOT NO-30, SURYANAGAR, UNIT-7, BHUBANESWAR, DIST - KHORDHA,ODISHA 14-9-2015
2195 JANA SWASTHYA SEVA SANSTHA AT/PO. MEDINIPUR VIA. BHAWANIPATNA DIST. KALAHANDI ODISHA 22-12-2013
2196 JAN CHETNA COMPUTER EDUCATIONAL SANSTHA 128 DHARAMPUR CHOWK NEAR CITY BOARD SCHOOL DEHRADUN 14-3-2016
2197 J AND J HOTMAX PRIVATE LIMITED PLOT NO-270L, ROAD NO 10, JUBILEE HILLS, HYDERABAD, TELANGANA 20-8-2015
2198 JANG BAHADUR CHHABI SUNRISE EDUCATIONAL SOCIETY BILASPUR JBC SUNRISE EDUCATIONAL SOCIETY VIJAYNAGAR DEORIKHURD BILASPUR CHHATTISGARH 25-11-2014
2199 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI 1-11-2016
2200 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PET ROAD DHARMAPURI DT 30-8-2016
2201 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAI PETTAI ROAD DHARMAPURI 14-10-2016
2202 JAN HEAVY DRIVING SCHOOL 15/7 SANTHAIPETTAI ROAD DHARMAPURI 30-11-2016
2203 JAN HEAVY DRIVING SCHOOL 15/7, SANTHAIPETTAI ROAD, DHARMAPURI 21-12-2016
2204 JANHIT SANSKRITIK KALA KENDRA QR. NO.-CD-529, SIDE V, SECTOR-II, DHURWA, RANCHI (JHARKHAND) 13-9-2015
2205 JANHIT SEWA SANSTHA SHAKTI PURAM COLONY RAMPUR 18-9-2015
2206 JANHIT SEWA SANSTHAN SHAKTI PURAM COLONY RAMPUR UP 14-3-2016
2207 JAN JAGRAN KENDRA NEAR P.T.C.ROAD, HAZARIBAGH, JHARKHAND-INDIA 28-7-2016
2208 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD OFFICE -41,KHANNU STREET,BAREILLY. FUNCTIONAL CENTRE : KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL BAHERI DISTT: BAREILLY (U.P) 3-2-2016
2209 JAN JAGRAN SHAIKSHIK UTTHAAN SEVA SAMITI REGD: OFFICE -41,KHANNU STREET ,BAREILLY (U.P) FUNCTIONAL CENTRE - KHWAJGAAN GLOBAL SCHOOL VILLAGE JAM SAWANT TEHSIL-BAHERI DISTT-BAREILLY (U.P) 11-1-2016
2210 JAN JAGRITI SEWA SAMITI WARD NO.8, SITARGANJ DISTRICT- UDHAM SINGH NAGAR UTTARAKHAND 17-2-2015
2211 JANKALAYAN BAHUUDDESHIYA SEVABHAVI SANSTHA KAIJ GANESH NAGAR KAIJ TQ. KAIJ DIST. BEED PIN : 431123 4-4-2016
2212 JAN KALYAN SAMITI JAIN 8-12-2015
2213 JAN KALYAN SAMITI BIKRAMGANJ PLOT NO 16 & 17 , ROAD NO 2, RAJEEV NAGAR PATNA, BIHAR-800024 4-8-2016
2214 JAN KALYAN SAMITI BIKRAMGANJ JKSB 1ST FLOOR SASHI ASHA COMPLEX RAJEEV NAGAR ROAD NO 1&2 PATNA 800024 4-11-2016
2215 JAN KALYAN SEWA SAMITI INDRASANI COMPLEX, BALUA GHAT, NEAR HOTEL RIVER VIEW, JAUNPUR(U.P.) 20-8-2015
2216 JAN KALYAN SHIKSHA SAMITI A-1413/3 15-11-2016
2217 JANKI DEVI FOUNDATION FOR EDUCATION AND IND DEVELOPMENT 224/29 E SHIV HOSPITAL, KAJUR WALA ROAD, MOLAR BAND BADARPUR NEW DELHI 4-12-2014
2218 JAN SAHYOG ABAM KALYAN PRATISTHAN C/0 SRI SATYA NAND OJHA, SRI KRISHNA VIHAR COLONY NEAR JAGDISH CEMENT SHOP, BEUR, PATNA-800002, BIHAR 14-9-2015
2219 JANSAHYOG ABAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR NEAR JAGDISH CEMENT SHOP PATNA 5-1-2016
2220 JANSEVA GRAMIN VIKAS AND SHIKSHAN PRATISHTHAN RANI LAXMIBAI WARD, PANDHARKAWADA TQ. KELAPUR DIST. YAVATMAL 26-3-2014
2221 JANSEVA GRAMIN VIKAS SANSTHA ULUP AT POST ULUP TQ BHOOM DS OSMANABAD 23-6-2016
2222 JAN SEWA PARISHAD HAZARIBAG JAN SEWA PARISHAD HEAD POST OFFICE ROAD, JULU PARK, HAZARIBAG 26-7-2016
2223 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK 19-10-2016
2224 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK SIVAGANGAI DISTRICT 6-10-2016
2225 JAN SHIKSHAN SANSTHAN PLOT NO. 841/521, SECTOR 8, CDA, CUTTACK, ODISHA 25-7-2016
2226 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI 9-12-2016
2227 JAN SHIKSHAN SANSTHAN SANTHAIPETTAI STREET KUNDRAKUDI 30-11-2016
2228 JAN SHIKSHAN SANSTHAN SANTHAI PETTAI STREET KUNDRAKUDI THIRUPPATHUR TALUK 4-8-2016
2229 JAN SHIKSHAN SANSTHAN KEDES, VANCHI CLAY MINES, CHATHANNOOR, KOLLAM 17-12-2013
2230 JAN SHIKSHAN SANSTHAN BAGESHWAR PINDARI GLACIER ROAD,NEAR DEGREE COLLEGE,KATHYATBARA,BAGESHWAR 3-4-2014
2231 JAN SHIKSHAN SANSTHAN ERNAKULAM PERUVARAM,NORTH PARAVOOR,ERNAKULAM DISTRICT,KERALA 14-9-2015
2232 JAN SHIKSHAN SANSTHAN MALAPPURAM 2ND FLOOR,PEEVEES BUILDING,MAIN ROAD NILAMBUR,MALAPPURAM DT,KERALA, 23-11-2016
2233 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.) 21-10-2016
2234 JAN SHIKSHAN SANSTHAN SHEOPUR SMT. KAMLA DEVI RAWAT KA MAKAN BLOCK COLONY, KESHAV NAGAR SHEOPUR (M.P.) 3-11-2016
2235 JAN SHIKSHAN SANSTHAN SINDHUDURG MEHANEEL PLAZA,GROUND FLOOR,GANESH NAGAR, KUDAL-MALVAN ROAD, KUDAL DIST-SINDHUDURG 14-9-2015
2236 JANSIRANI EDUCATIONAL TRUST 93,CHOLA TOWER, NETHAJI ROAD, TIRUVARUR. 8-9-2014
2237 JANSWVA SWVABHAVI PRATISHTHAN AT DEONI, TQ. DEONI, DIST., LATUR (MAHARASHTRA) : 413519 2-12-2016
2238 JAN UDAY UTTHAN SANSTHAN BEHIND SINGH MOTOR ,SHIVNAGAR ADHARTAL JABALPUR 27-9-2016
2239 JANVIKAS SEVABHAVI SANSTHA AT-MANGALWARA ,NIRANJANA BABA CHOUCK, HINGOLI TQ.DIST .HINGOLI (MAHARASHTRA0 19-9-2016
2240 JASAHYOG EVAM KALYAN PRATISTHAN C/O SHREE SATYANAND OJHA SHREE KRISHNA VIHAR COLONY BEUR PATNA 14-10-2015
2241 JASMINE RICE MILL PVT LTD VILL – JAGJIBANPUR , P.O- DALAPATIPUR, HOOGHLY, WEST BENGAL 17-8-2016
2242 JASSI PUBLICATIONS 48/40, NORTH CHITRAI STREET, MEENAKSHI KOVIL NORTH TOWER, MADURAI, TAMILNADU 7-1-2015
2243 JATUYA EDUCATION FOUNDATION MASZIDPARA LANE, P.O- DIAMOND HARBOUR P.S- DIAMOND HARBOUR, DIST- SOUTH 24 PGS. WEST BENGAL. 2-9-2016
2244 JAWED HABIB HAIR AND BEAUTY LIMITED 752, 5TH FLOOR, BUILDING NO. 7, SOLITAIRE CORPORATE PARK, ANDHERI (EAST), MUMBAI 24-4-2014
2245 JAYA BHARATA MATE SEVABHIVRUDDHI SAMSTHE JAMKHANDI #5414, BHARPET GALLI JAMKHANDI 13-7-2016
2246 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD 16-12-2016
2247 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN S PLAZA MAULA ALI HYDERABAD 22-12-2016
2248 JAYALAKSHMI EDUCATIONAL SOCIETY ROSHAN PLAZA MAULA ALI ROAD HYDERABAD 16-1-2017
2249 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT BLOCK: ARNI DISTRICT: TIRUVANNAMALAI STATE: TAMIL NADU 11-1-2016
2250 JAYAM CHARITABLE AND EDUCATIONAL TRUST NO 13 ,AZAD STREET ARNI TVM DT 14-9-2015
2251 JAYAM CONSULTANCY 2-3-225, ROAD NO.1, AADARSH NAGAR COLONY, NAGOLE, HYDERABAD, ANDHRA PRADESH-500068 21-7-2014
2252 JAYARAJANNAPACKIAMCOLLEGEFORWOMEN COLLEGECOMMITTEE J.A.COLLEGE FOR WOMEN PERIYAKULAM POST THENI DISTRICT 13-9-2015
2253 JAY GANESH SAMAJIK BHUUDESHIY SANTHA KURDU HINDAVI SHIKSHAN SAMUHA KURDUWADI TAL MADHA DIST SOLAPUR PIN413208 22-6-2016
2254 JAY MATADI FARMERS PRODUCER COMPANY LTD PLOT NO-EB/396,STAGE-II,LAXMISAGAR,BHUBANESWAR 14-3-2016
2255 JB CHARITABLE SOCIETY NEAR BUS STAND , KERALA, MALAPPURAM 5-2-2015
2256 JB EDUCATIONAL SOCIETY BHASKAR NAGAR, MOINABAD MANDAL, R.R. DISTRICT, HYDERABAD, TELANGANA STATE , INDIA-500075 13-11-2014
2257 JBM AUTO LIMITED JBM AUTO LIMITED (SKILL DEVELOPMENT CENTRE) PLOT NO: 16, SECTOR: 20B FARIDABAD 7-1-2016
2258 JBS ACADEMY PVT LTD VISHARAD COMPLEX, NEXT TO OLD HIGH COURT, NAVRANGPURA, AHMEDABAD -380009 GUJARAT, INDIA 4-3-2015
2259 JEEVAKKAL SOCIAL WELFARE YOUTH SOCIETY 1449/1, ENJAR VILLAKKU, SRIVILLIPUTTUR MAIN ROAD, SIVAKASI (W) 25-11-2014
2260 JEEVANA JYITHI GIRIJANA MAHILA MANDALI D NO 5-56 BHANOOR VILLAGE PATANCHERU MANDAL?BLOCK MEDAK DISTRICT TELANGANA STATE INDIA 14-10-2015
2261 JEEVAN DIESELS AND ELECTRICALS LTD JEEVAN DIESELS & ELECTRICALS, 17, GANESH CHANDRA AVENUES. 17-12-2013
2262 JEEVAN JYOTI SEVA TRUST B27 NAKODA TEXTILE TOWER GANDHI NAGAR BHILWARA RAJASTHAN 14-7-2016
2263 JEEVAN JYOTI SEVA TRUST B27 NAKOD TEXTILE TOWER GANDHI NAGAR BHILWARA 4-8-2016
2264 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD 16-3-2016
2265 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UTTAR PRADESH) 23-10-2015
2266 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD (UP) 14-10-2015
2267 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP M M PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, 201204 23-3-2016
2268 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP MM PG COLLEGE, SONDA ROAD, MODINAGAR GHAZIABAD UP 11-1-2016
2269 JEEVAN JYOTI SHIKSHAN AVAM JAN KALYAN SAMITI OPP. MM PG COLLEGE, SONDA ROAD, MODINAGAR, GHAZIABAD, UTTAR PRADESH 15-9-2015
2270 JEEVANTIRTH JUNA KOBA, GANDHINAGAR, 20-1-2016
2271 JEEVAN VIKAS SANSTHAN ADDRESS WITH PIN CODE: DIOCESAN SOCIAL CENTRE, TIMBER DEPOT ROAD, PARATWADA 444 805, AMRAVATI DISTRICT,MAHARASHTRA 8-12-2013
2272 JEEWAN AADHAR C/O- AADHAAR AGRAWAL(DIRECOR) STATION PADA RAJGANGPUR, DIST- SUNDERGARH, ODISHA 26-2-2016
2273 JENNYS EDUCATIONAL AND CHARITABLE TRUST V.V.SHOPPING PLAZA, OPP.TO RATHNAVEL KALYANAMANDAPAM, FAIRLANDS, SALEM. 21-7-2014
2274 JEYAM EDUCATIONAL TRUST 9,MEMBER KANDHASAMY STREET, VELAYUTHAMPALAYAM(PO), VELAYUTHAMPALAYAM, KARUR DT. 2-2-2015
2275 JEYRAM EDUCATIONAL TRUST 7/1A, CHELLAMUTHU NAICKER STREET, ARIYALUR 21-10-2014
2276 JHARKHAND HEALTH AND WELFARE SOCIETY APNA GHAR NEAR RADHA MANDIR, NAMKUM, RANCHI- 834001, JHARKHAND PH: +91 9608080030, 06512562530 19-8-2014
2277 JHARKHAND VIKAS SANSTHA L-104, ARGORA HOUSING COLONY, P.O. - DORANDA 29-3-2014
2278 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FROUNT GOVT. GIRLS PRIMARY MAHAL SCHOOL, WARD NO. 37 JHUNJHUNU 1-6-2016
2279 JHUNJHUNU ZILA PARYAWARN SUDHAR SAMITI IN FRONT GOVT. GIRLS PRIMARY MAHAL SCHOOL WARD NO. 37 JHUNJHUNU 23-6-2016
2280 JIGACHA SMILE WELFARE SOCIETY 6 MAHIARY ROAD, JIGACHA, GIP COLONY, HOWRAH - 711112 6-1-2016
2281 JIL INFORMATION TECHNOLOGY LIMITED 64/4, SITE IV, SAHIBABAD INDUSTRIAL AREA, GHAZIABAD 3-4-2014
2282 JINDAL EDUCATION AND WELFARE SOCIETY JINDAL EDUCATION AND WELFARE SOCIETY, OP JINDAL COMMUNITY COLLEGE, OP JINDAL KNOWLEDGE PARK, GHARGHODA ROAD, PUNJIPATHRA, DISTRICT - RAIGARH, CHHATTISGARH 5-11-2014
2283 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN 17-5-2016
2284 JIRAKPUR SISTER NIVEDITA SEVE MISSION JIRAKPUR R.N BATTACHARJEE ROAD,POST-BASIRHAT RLY.STN 27-4-2016
2285 JIS FOUNDATION 56,JESSORE ROAD KOLKATA 3-1-2014
2286 JK DEVELOPMENTAL ACTION GROUP REGD OFFICE: SHIVPORA SRINAGAR CENTRE: KARAN NAGAR SRINAGAR 22-11-2016
2287 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE, SHIVPORA, SRINAGAR CENTRE, KARANNAGAR, SRINAGAR 16-12-2016
2288 JK DEVELOPMENTAL ACTION GROUP REGISTERED OFFICE: SHIVPORA SRINAGAR. CENTRE ADDRESS: KARAN NAGAR 5-12-2016
2289 JK LAKSHMIPAT UNIVERSITY JAIPUR JK LAKSHMIPAT UNIVERSITY NEAR MAHINDRA SEZ, MAHAPURA, AJMER ROAD, JAIPUR 26-4-2016
2290 JNMS EDUCATION PRIVATE LIMITED 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, WEST BENGAL 29-8-2016
2291 JNMS EDUCATION PVT LTD 53 GHATAK ROAD, KANCHRAPARA, NORTH 24 PARGANAS, PIN-743145 30-8-2016
2292 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED F-610-A, KHAJURI KHAS, MAIN WAZIRABAD ROAD NEW DELHI 26-4-2016
2293 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED 1ST FLOOR RAMA COMPLEX BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND 26-7-2016
2294 JOBTECH TRAINING INSTITUTE PRIVATE LIMITED JTTI 1ST FLOOR. RAMA COMPLEX INFRONT OF SHIVAM CLINIC BARGANDA ROAD MAKATPUR GIRIDIH JHARKHAND 14-3-2016
2295 JOELS INTEGRATED FOUNDATION JIF JOELS INTEGRATED FOUNDATION JIF 8-2-293/165/A, ROAD NO 14, BANJARA HILLS, HYDERABAD, TELANGANA 19-1-2017
2296 JOGENDRA MEMORIAL TRUST PLOT NO. 120-B, K1, KALINGA NAGAR, GHATIKIA, BHUBANESWAR, ODISHA 14-9-2015
2297 JOGINPALLY BR EDUCATIONAL SOCIETY BHASKAR NAGAR, YENKAPALLY, MOINABAD MANDAL R.R. DISTRICT, HYDERABAD, TELANGANA STATE. , INDIA-500075 25-11-2014
2298 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111 11-9-2015
2299 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111 18-9-2015
2300 JOY7 FOUNDATION DOLANG AKUM HOUSE , NYOKUM LAPANG , NR. TOWN BAPTIST CHURCH , ITANAGAR , DIST. - PAPUM PARE ARUNACHAL PRADESH - 791111 28-9-2015
2301 JPS FOUNDATION K-571, SECTOR-K, ASHIANA, KANPUR ROAD, LUCKNOW 7-10-2016
2302 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWA 28-9-2016
2303 JRG CENTRE FOR LEARNING AND EDUCATION PVT LTD PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR 7-9-2016
2304 JRG EDUCATIONAL TRUST GUPTA NIWAS, GUPTA CABLES COMPOUND,BHUBANESWAR CUTTACK ROAD,ORISSA, 14-10-2016
2305 JRG EDUCATIONAL TRUST PLOT 1, BARUNEI INDUSTRIAL ESTATE, KHURDA, BHUBANESWAR 30-9-2016
2306 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA 8-2-2016
2307 JRR CONSTRUCTION PRIVATE LIMITED D/101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR 6, DWARKA-NEW DELHI 6-2-2016
2308 JRR CONSTRUCTION PRIVATE LIMITED D-101, PRAKARTI APARTMENTS, PLOT NO. 26, SECTOR-6, DWARKA 15-2-2016
2309 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KANPUR NAGAR 27-9-2016
2310 J R S TECHNOLOGY PRIVATE LIMITED 128 , NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION)KALYANPUR KANPUR NAGAR UTTAR PRADESH 26-7-2016
2311 J R S TECHNOLOGY PRIVATE LIMITED 128 NEW ASHOK NAGAR (NEAR KALYANPUR RAILWAY STATION) KALYANPUR KANPUR NAGAR 14-10-2016
2312 J R S TECHNOLOGY PRIVATE LIMITED SATISH MARKET OPP- RAILWAY STATION CHAUBEPUR KANPUR NAGAR 28-10-2016
2313 JUBA JYOTI JUBAK SANGHA PLOT NO. -263/1301, SASHTRI NAGAR, UNIT -IV, BLOCK -€“ BHUBANESWAR, PS - KHARVEL NAGAR, BHUBANESWAR, KHORDHA, PIN- 751001 23-10-2015
2314 JUBBA RAMAKRISHNA PILLAI FOUNDATION ISWARYA BUILDING, CHAVARA PO, PANMANA, KOLLAM-691583 KERALA 3-4-2014
2315 JUPITER ADMINISTRATIVE AND SECURITY SERVICES B-112, 2ND FLOOR, LAJPAT NATAR-1, NEW DELHI 3-4-2014
2316 JUPITER INTERNATIONAL LTD "UNNAYANAM", 20-A, ASHUTOSH CHOUDHURY AVENUE,KOLKATA 3-2-2014
2317 JYOTHI GRAPHICS AND MULTIMEDIA COMPUTER EDUCATION H.NO.6-2-332/2, SREENAGAR COLONY, NALGONDA TOWN AND DIST, TELANGANA 4-3-2015
2318 JYOTHI JEEVAPOORNA TRUST ARCHANA WOMEN'S CENTRE, ETTUMANOOR P.O., KOTTAYAM-P.O., KERALA 14-9-2015
2319 JYOTI COMPUTER SERVICES 1817 A WARD SAI CHAMBERS VARUNTIRTHWESH SHIVAJI PETH KOLHAPUR 30-4-2015
2320 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, KALIKAPUR, SONARPUR, PIN - 743330, DIST.- SOUTH 24 PARGANAS, CONTACT NO. - 9831512994, EMAIL ID.- SEEULY@JSB.ORG.IN 5-9-2016
2321 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR, 15-9-2016
2322 JYOTIRMOY EDUCATION AND WELFARE FOUNDATION JYOTIRMOY KNOWLEDGE PARK, TEMATHA, KALIKAPUR SONARPUR. 28-9-2016
2323 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 23-2-2016
2324 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 5-2-2016
2325 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 14-3-2016
2326 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 6-4-2016
2327 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 26-4-2016
2328 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 15-3-2016
2329 KAAVIYAA BEAUTY CHARITABLE TRUST OLD NO:430, NEW NO.253/D, MAG COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT 11-1-2016
2330 KAAVIYAA HERBAL BEAUTY PARLUR 420-D, M.A.G.COMPLEX, MAIN ROAD, PERUNDURAI, ERODE DISTRICT. 14-9-2015
2331 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, P.O.-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR 29-8-2016
2332 KAIGARIA LOTUS WELFARE SOCIETY VILL-KAIGARIA, POST-KAMALPUR SRIRAMNAGAR, P.S.-DASPUR, DIST-PASCHIM MEDINIPUR 12-9-2016
2333 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR, NEREDMET SECUNDERABADB 6-4-2016
2334 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO. 553 KAKATIYA NAGAR NEREDMET SECU NDERABAD 26-4-2016
2335 KAIRALI EDUCATION SOCIETY VTI DIVISION PLOT NO 553 KAKATIYA NAGAR NEDERMET SECUNDERABAD 17-5-2016
2336 KAIRA SOCIAL SERVICE SOCIETY KAIRA SOCIAL SERVICE SOCIETY, ST. XAVIER SCHOOL CAMPUS, SARDARNAGAR-HANSOL, AHMEDABAD-382 475, GUJARAT 3-1-2014
2337 KAI TATYASAHEB PATIL BAHUUDDESHIY SEVABHAVI SANSTH SILICON SYSTEMS, 26, MAHSOOL COLONY, NEAR AMBAD CHOWFULLY, JALNA 27-4-2016
2338 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD, BHOPAL 30-10-2015
2339 KALCHURI SHIKSHA AVAM SAMAJ KALYAN SAMITI 37, 38 NEW CHOUKSEY NAGAR, NEAR KAROND SQUARE, BERASIA ROAD 6-1-2016
2340 KALINGA CAREER ACADEMY 3547,GARAGE CHHAK LINGARJ MANDIR ROAD,OLD TOWN,BHUBANESWAR 3-4-2014
2341 KALINGA INSPIRE SMART SERVICES PLOT NO -708 ,AT/PO- CHHATIPUR , KAIPADAR RAILWAY STATION , KHORDHA, ODISHA . 8-1-2016
2342 KALINGA INSPIRE SMART SERVICES AT-CHHATIPUR PO-CHHATIPUR 30-9-2016
2343 KALINGA INSTITUTE OF INDUSTRIAL TECHNOLOGY KIIT SCHOOL OF RURAL MANAGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA, BHUBANESWAR 15-9-2015
2344 KALPANA EDUCATIONAL TRUST RATHTALA,P.O.KANCHANNAGAR, DIST:BURDWAN. 28-9-2015
2345 KALP SAMAJ SEVI SANSHA AT POST- SUKUL PARA KHAROD, DISTRICT- JANJGIR CHAMPA, CHHATTISGARH 495556 3-4-2014
2346 KALUBAI SEVABHAVI SANSTHA AT/POST-NIMBLAK,TALUKA-PHALTAN,DIST-SATARA 8-6-2016
2347 KALVI TRUST NO.9-1-66, DOUBLE STREET AGRAHARAM, SHOLAVANDHAN, MADURAI 14-9-2015
2348 KALYACHAK MATANGINI MAHILA SAMITI VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR 18-9-2015
2349 KALYACHAK NETAJI SUBHAS SANGHA VILL KALYACHAK PO HARIA DIST PURBA MEDINIPUR 18-9-2015
2350 KALYANI 14-C, BLOCK-C, RJAT VIHAR, SECTOR-62, NOIDA, GAUTAM BUDH NAGAR, UTTAR PRADESH 27-3-2014
2351 KALYANI SKILLS PRIVATE LIMITED C/O BHARAT FORGE LTD, ADMIN BUILDING, 3RD FLOOR, PUNE CANTONMENT, MUNDHWA, PUNE 15-2-2014
2352 KALYANI WELFARE SOCIETY SHAHDOL WARD NO 16,PUNJABI GURUDWARA ROAD,GHARAULA MOHALLA,SHAHDOL 4-8-2016
2353 KAMADENU MAHILA ULITAY GUMPU H.NO 26/19A OPP C.M.C.OLD PB ROAD BIDARI BUILDING FIRST FLOUR NIPANI.TA:- CHIKODI DIS:- BELAGAVI.STATE:- KARNATAKA. 30-10-2015
2354 KAMADHENU EDUCATION AND RRL DVPT CHARITABLE TRUST 51, KG HALLI, JALAHALLI WEST, BANGALORE 26-9-2015
2355 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE 4-4-2016
2356 KAMADHENU EDUCATION AND RURAL DEVELOPMENT CH TRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE 5-4-2016
2357 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST, NO, 51, LAKSHMI PRASANNA BUILDING, NEAR SRI RAMA TEMPLE, K.G.HALLI, JALAHALLI WEST, BANGALORE - 560015 23-2-2016
2358 KAMADHENUEDUCATIONRURALDEVELOPMENTCHARITABLETRUST KAMADHENU EDUCATION AND RURAL DEVELOPMENT CHARITABLE TRUST,#51,LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE 13-9-2015
2359 KAMADHENU EDUCATION RURAL DVPT CHARITABLE TRUST 51, LAKSHMIPRASANNA BLDG, NEAR SRI RAM TEMPLE, KG HALLI, JALAHALLI WEST, BANGALORE 4-1-2016
2360 KAMAIAH ENGINEERING SERVICES PRIVATE LIMITED OPC DOOR NO. 13-2-138/A,, WARD NO. 14, TILAK NAGAR,, PALASA 20-7-2016
2361 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST 1ST FLOOR,5K/3,QUAIDEMILLATH SALAI,PERIYAR NAGAR,UDAIYARGUDI,KATTUMANNARKOIL,CUDDALORE 15-11-2016
2362 KAMALAM AMMAL MEMORIAL SOCIAL WELFARE AND SKILL DEVELOPMENT TRUST IST FLOOR, 5K/3,QUAIDE MILLATH SALAI, PERIYAR NAGAR,UDAYARGUDI,KATTUMANNARKOIL TALUK 17-9-2015
2363 KAMALAM SAMBANDAM ALAGIRI EDUCATIONAL AND CHARITABLE TRUST 1069-THIRUPANINATHAM ,ENNANAGARAM POST,CHIDAMBARAM TALUK,CUDDALORE DIST-608 602 15-1-2015
2364 KAMANI TUBES LTD 32,KAMANI CHAMBERS, RAMJIBHAI KAMANI MARG, BALLARD ESTATE, MUMBAI 1-7-2014
2365 KAMGAR FOUNDATION K.M.COMPLEX,T.P.NAGAR,NEAR ATM BUILDING,KORBA DISTRICT,CHHATTISGARH 26-10-2013
2366 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN 12-5-2016
2367 KAMLA MAHILA HANDICRAFTS UDYOG AVM VIKAS SOCIETY 6 ARVIND MARG NEAR VAISH NURSING HOME DEHRADUN 26-8-2016
2368 KAMLASUKH SIKSHA SANSKAR SEVA SANSTHAN KAMLASUKH SIKHA SANSKAR SEVA SANTHAN BANSWARA ROAD,BAGIDORA(BANSWARA)327601 RAJASTHAN 3-2-2014
2369 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DISTMURSHIDABAD 19-10-2016
2370 KAMONA CHARITABLE SOCIETY 14/1, NITYA BEWA LANE, PO- KHAGRA, CITY-BERHAMPORE, DIST- MURSHIDABAD 6-10-2016
2371 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE AT- NEAR SAI MANDIR RUGUDI PARA, BALNGIR DIST- BALANGIR-767001 11-8-2014
2372 KAMPA BHAI VOCATIONAL TRAINING INSTITUTE LIMITED AT - RUGUDIPARA, SAI MANDIR LANE PO/DIST - BALANGIR STATE - ODISHA 26-7-2016
2373 KAMPTEE EDUCATION SOCIETY BALAJI COMPLEX IIND FLOOR KIRANA OLI KAMPTEE DISTRICT NAGPUR MAHARASHTRA 15-2-2014
2374 KAMTECH ASSOCIATES PVT LTD KAMTECH ASSOCIATES PVT. LTD. G-5, GAJRAJ APARTMENT, SAROJINI MARG, C-SCHEME, JAIPUR CONTACT NO. +91-9414046876 17-9-2015
2375 KANDAVEL EXPORTS 22A (4) VELAMPALAYAM, THANNEER PANTHAL COLONY, AVINASHI ROAD- TITUPUR 24-10-2016
2376 KANNIYAPPA MEMORIAL EDUCATIONAL TRUST 21 , IRUKUM STREET,ARANI,PONNERI TALUCK , THIRUVALLURE DISTRICT,TAMILNADU STATE.PINCODE-601101 8-11-2013
2377 KANTHI PLOT NO: 22/2, INDRA ENCLAVE, FLAT NP: 402, LANE OPP TO ICICI BANK, VIVEKANANDA NAGAR, KUKKATPALLY, HYDERABAD 21-8-2014
2378 Kanumarla Infrastructures Private Limited PLOT NO:22/2, INDRA ENCLAVE, FLAT NO:402, VIVEKANANDANAGAR COLONY, KUKKATPALLY, HYDERABAD 5-9-2014
2379 KAPADWANJ KELAVANI MANDAL C.N. VIDHYALAYA CAMPUS, DAKOR ROAD , KAPADWANJ DI- KHEDA GUJARAT 3-4-2014
2380 KAPOKH FIBERS AND INDUSTRIES LIMITED 401/405,4TH FLOOR,DALAMAL HOUSE,J.BAJAJ ROAD,NARIMAN POINT 23-10-2015
2381 KAPSTON FACILITIES MANAGEMENT PVT LTD #1-98/9/3//23, PLOT NO: 12E, JAIHIND COLONY, MADHAPUR COLONY, HYDERABAD 4-10-2013
2382 KARDA CONSTRUCTIONS LIMITED SHOP NO. UG 109, DREAMS THE MALL, L.B.S.MARG, KANJUR, BHANDUP (W), MUMBAI 12-9-2016
2383 KARGIL SOLDIERS MEMORIAL SOCIETY H NO 1-7-879 SHANTHI HEIGHTS (T6), HUNTER ROAD , HANAMKONDA WARANGAL DISTRICT TELANGANA 14-9-2015
2384 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR ,BIHAR 12-1-2017
2385 KARJEE EDUVENTURES PRIVATE LIMITED PUSA INSTITUTE OF TECHNOLOGY,NEAR CHANDNI CHOWK,MAHMADA,PUSA,SAMASTIPUR 18-10-2016
2386 KARMAVEER KAKASAHEB WAGH EDUCATION SOCIETY HIRABAI, HARIDAS VIDYANAGARI, AMRUTDHAM, PANCHAVATI, NASHIK, MAHARASHTRA 10-2-2016
2387 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX, OPP : NEW BUS STAND, SANALA ROAD - MORBI(GUJARAT) 18-9-2015
2388 KARMYOG EDUCATION TRUST 3RD FLOOR, AJANTA COMPLEX,OPP. NEW S.T. STAND, SANALA ROAD, MORBI (GUJARAT) 15-9-2015
2389 KARNA SUBARNA WELFARE SOCIETY VILL POST JADUPUR, VIA SATUI P.S BERHAMPORE DIST MURSHIDABAD 10-2-2016
2390 KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER SOCIETY SOCIETY FOR KARNATAKA GERMAN MULTI SKILL DEVELOPMENT CENTER,DIRECTORATE OF EMPLOYMENT AND TRAINING, NEAR DAIRY CIRCLE, KAUSHALYA BHAVAN CAMPUS, BANNERUGHATTA ROAD 9-12-2016
2391 KARNATAKA SAHASA KALA ACADEMY NEAR MMU COLLEGE, RAMADEVARA BETTA ROAD, RAMANAGARA 10-11-2016
2392 KARTAVYA CONSULTANTS PRIVATE LIMITED PLOT NO - 587, SAHID NAGAR, BHUBANESWAR, DIST - KHORDHA, ODISHA 12-8-2015
2393 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA 245 sukh vilas colony behind court barwani 7-9-2016
2394 KARTAVYA SAMJIK SHODH EVAM VIKAS SANSTHA BARWANI 28, JAWAHAR MARG BARWANI DIST-BARWANI M.P. 451551 4-8-2016
2395 KARTHIKEYAN EDUCATIONAL TRUST NO32 THIRUVALLUVAR STREET BEERINGMEDU GINGEE 10-2-2015
2396 KARUNAGOWRI EDUCATIONAL AND RURALDEVELOPMENT TRUST NO.36, KK NAGAR, KALAVA KARAI, MANNARGUDI 17-9-2015
2397 KARUNALAYA FOUNDATION MARIYAMMAN KOVIL STREET V.PUDHUPALAYAM VILLAGE ARPISAMPALAYAM-POST VALAVANUR & POST VILLUPURAM-TK & DIST 5-2-2015
2398 KARUPPIAH PILLAI THEIVANAI AMMAL EDUCATIONAL TRUST PLOT NO.320, LATHA MATHAVAN ILLAM,ANNA NAGAR, MADURAI- 625020, TAMILNADU. 17-1-2017
2399 KASHISH NETWORK MARKETING PVT LTD C/O MAIN BAZAR NEAR ZEO OFFICE SURANKOTE 20-7-2016
2400 KASHISH NETWORK MARKETING PVT LTD CORPORATE OFFICE NEAR JAMMU KASHMIR BOARD OF SCHOOL EDUCATION REHARI JAMMU 19-1-2017
2401 KASHYAP COMPUTING AND MANAGEMENT PRIVATE LIMITED 604, SHREE GANESH TOWER-1, NEAR LOYOLA B.ED. COLLEGE, HURLUNG, TELCO, JAMSHEDPUR 21-1-2015
2402 KASTHURI AMMAL EDUCATIONAL TRUST NO: 59/27, MUTHUVINAYAGAR KOIL STREET,TIRUVANNAMALAI, TIRUVANNAMALAI DIST, TAMIL NADU-606601 14-9-2015
2403 KASTHURIAMMAL EDUCATIONAL TRUST NO;59/27, MUTHUVINAYAGAR KOIL STREET, TIRUVANNAMALAI,TIRUVANNAMALAI DIST, TAMIL NADU -606601 18-9-2015
2404 KASTURBA HEMLATA MAHILA SAMAJ KALAYAN SANSTHAN C/O - KIRAN GANGA NIVAS VILL-ANAND VIHAR(MOHANPUR) NEAR PLY FACTORY PO-MOHANPUR DISTT-SAMASTIPUR(BIHAR) 11-9-2015
2405 KATHAR BASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI 21-9-2015
2406 KATHAR BASHA MEMORIAL TRUST KATHAR BASHA MEMORIAL TRUST NO.16, SECOND LANE, AGILANDESWARI NAGAR, LALGUDI TALUK, TRICHIRAPPALLI DISTRICT-621601. 14-9-2015
2407 KATHARBASHA MEMORIAL TRUST 16, SECOND CROSS AKILANDESWARI NAGAR LALGUDI TRICHIRAPPALLI 5-1-2016
2408 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, NO.21/7, SF NO. 187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR - 4 15-1-2016
2409 KATHERINE EDUCATIONAL TRUST KP TOWERS, NO. 21/7, SF NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL,TIRUPUR-4 1-1-2016
2410 KATHERINE EDUCATIONAL TRUST K.P.TOWERS, S.F.NO.187/2, KANGEYAM ROAD, NEAR JMHS SCHOOL, TIRUPUR 12-1-2016
2411 KAUSHALYA GRAMODYOG SANSTHAN 415 SHRI GANESH KUNJ RAILWAY ROAD GANESHPUR ROORKEE 28-10-2016
2412 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE PO, BANNERGHATTA ROAD, BANGALORE 29-6-2016
2413 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O.,BANNERGHATTA ROAD, BANGALORE 18-8-2016
2414 KAUSHALYA VIKAS KENDRA 216, CLASSIC ORCHARDS, SOS VILLAGE P.O., BANNERGHATTA ROAD, BANGALORE 17-5-2016
2415 KAVALYA UPHILL EDUCATIONAL SOCIETY H. NO. 16, SECTOR-9, FARIDABAD HARYANA -121006 14-9-2015
2416 KAVIN RURAL DEVELOPMENT TRUST REGD NO. 33/2013, CUDDALORE MAIN ROAD, VADALUR, CUDDALORE(DT) TAMIL NADU, INDIA. 17-9-2015
2417 KAVYANSH BROADWAYS SERVICES PVT LTD VPO PANDOH TEHSIL SADAR DISTT MANDI HIMACHAL PRADESH 23-6-2016
2418 KAVYA SKILLS PRIVATE LIMITED A 276, FF, HARINAGAR ASHRAM, NEW DELHI 3-8-2016
2419 KAVYA SKILLS PRIVATE LIMITED A 276, FF, ASHRAM, HARINAGAR, NEW DELHI 3-8-2016
2420 KAYAKA COMPUTER EDUCATION PRIVATE LIMITED #10/67, "BASAVA KRUPA", OPP. MEI POLYTECHNIC, 59TH CROSS, 4TH BLOCK, RAJAJINAGAR, BANGALORE-10 17-6-2014
2421 KAYA LIMITED KAYA LIMITED. PLOT NO 23/C, MAHAL INDUSTRIAL ESTATE. MAHAKALI CAVES ROAD, OPPOSITE ANDHRA BANK, NEAR PAPERBOX, ANDHERI(E)MUMBAI 18-8-2015
2422 KBS EDUCATION TRUST DELHI PUBLIC SR. SEC. SCHOOL AGRA - JAIPUR NATIONAL HIGHWAY 11, SEWAR, BHARATPUR 18-9-2015
2423 KDK SOFTWARES INDIA PVT LTD "GOYAL VILLA" A-40, SHYAM NAGAR, NEAR MANU HOSPITAL, AJMER ROAD, JAIPUR, RAJASTHAN 7-10-2013
2424 KDS SERVICES PVT LTD B-7,1ST FLOOR,VIBHUTI KHAND GOMATI NAGAR,LUCKNOW 7-9-2015
2425 KEERTIKA ACADEMY PRIVATE LIMITED 58/114, PRINCE ANWAR SHAH ROAD, KOLKATA 17-7-2014
2426 KELAVANRAJA CHARITABLE TRUST POTHIKULAM VILLAGE, KADALADI TALUK RAMANATHAPURAM DT 6-7-2016
2427 KENDUADIHI BIKASH SOCIETY AILAKUNDI ROAD (BEHIND GOVINDANAGAR BUS STAND) POST OFFICE - KENDUADIHI DISTRICT - BANKURA 30-11-2016
2428 KERALA INSTITUTE OF TOURISM AND TRAVEL STUDIES RESIDENCY COMPOUND, THYCAUD, THIRUVANNATHAPURAM 20-7-2016
2429 KERALA PRAVASI CONGRESS MALAPPURAM SECOND FLOOR, VENGARA COMPLEX NEW BUS STAND, MANJERI 14-9-2015
2430 KERALA SKILL DEVELOPMENT CLUSTER NEAR SAVERA HOSPITAL, EZHUR ROAD, TIRUR 14-9-2015
2431 KERALA SOCIAL SERVICE FORUM KERALA SOCIAL SERVICE FORUM, AMOS CENTRE, ADICHIRA, THELLAKOM P.O. KOTTAYAM 3-1-2014
2432 KESHARWANI SHIKSHA SAMITI RAMANUJGANJ 15-4-2014
2433 KESHAV COMPUTER PRIVATE LIMITED KESHAV COMPUTER PRIVATE LIMITED, OFFICE NO.102,VIKAS PARADISE,OPP. BALRAJESHWAR TEMPLE, LBS MARG, MULUND WEST, MUMBAI - 400080. 13-1-2014
2434 KEYSTROKES EDUCATIONAL SERVICES PVT LTD 1ST FLOOR, A K PATEL HOUSE, ABOVE LG SHOWROOM, OPP PASSPORT SEVA KENRDA, MITHAKHALI SIX ROADS, NAVARANGPURA, AHMEDABAD GUJARAT INDIA 5-1-2016
2435 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD 'S' BLOCK, W-113, M.I.D.C., BHOSARI, PUNE 15-6-2016
2436 KGC ENGINEERING PROJECTS PRIVATE LIMITED KGC ENGINEERING PROJECTS PVT. LTD., 'S' BLOCK, W 113, 1ST FLOOR, BHOSARI MIDC,BHOSARI, PUNE 23-5-2016
2437 KGN WELFARE SOCIETY AABKARI ROAD RAJENDRA WARD BETUL GANJ BETUL 4-3-2015
2438 KGVK NEORI VIKAS RUKKA RANCHI 11-9-2015
2439 KGVK NEORI VIKAS RUKKA RANCHI 4-1-2016
2440 KGVK NEORI VIKAS RUKKA ORMANJHI JHARKHAND 16-9-2015
2441 KHAJA GARIB NAWAZ EDUCATIONAL SOCIETY KANGALA, CHERIKUPALLI MANDAL, GUNTUR DIST.522259 8-12-2013
2442 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED #256, SUKHDEV NAGAR, PANIPAT 14-9-2015
2443 KHALSHA CONSULTANCY SERVICES PRIVATE LIMITED Opposite Arya School ,Near Bus Stand ,Madlauda, District Panipat 30-11-2016
2444 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON 15-6-2016
2445 KHANDESH COLLEGE EDUCATION SOCIETYS JALASRI KCE SOCIETY'S JALASRI WATERSHED SURVEILLANCE AND RESEARCH INSTITUTE, MOOLJI JAITHA COLLEGE CAMPUS, JILHA PETH, JALGAON , MAHARASHTRA STATE 17-5-2016
2446 KHARAGPUR BULBULCHATI WELFARE SOCIETY BULBULCHATI, P.O.-KHARAGPUR, BLOCK-KHARAGPUR-II, DIST-PASCHIM MEDINIPUR, PIN-721301, WEST BENGAL 22-7-2016
2447 KHARAGPUR BULBULCHATI WELFARE SOCIETY C/O-PARITOSH ROUTH, AT-BULBULCHATI, P.O.-KHARAGUR, DIST-PASCHIM MEDINIPUR, WEST BENGAL 22-8-2016
2448 KHATOR FIBERS AND FABRICS LIMITED PLOT NO 12A,M.I.D.C,SARAVALI,KALYAN BHIWANDI ROAD,THANE 12-1-2016
2449 KHATOR FIBRE AND FABRICS LIMITED KHATOR FIBRE AND FABRICS LTD. PLOT NO.12A M.I.D.C SARAVALI,KALYAN BHIWANDI ROAD THANE 5-1-2016
2450 KHERWADI SOCIAL WELFARE ASSOCIATION KHERWADI SOCIAL WELFARE ASSOCIATION,PARISHRAMLAYA,TEEN BUNGLOW ROAD,OPP KHERWADI MUNICIPAL SCHOOL,KHERWADI,BANDRA EAST MUMBAI 14-10-2013
2451 KHODIYARCADCENTERINDIAPVTLTD 3RD FLOOR,ACUMEN COMPLEX NR PASSPORT OFFICE ,UNIVERSITY ROAD ,AHMEDABAD 11-5-2016
2452 KHODIYAR INFOTECH 3RD FLOOR ACUMEN COMPLEX NR PASSPORT OFFICE UNIVERSITY ROAD AHMEDABAD 12-5-2016
2453 KHUSHI EVENTS AND MEDIA MANAGEMENT PRIVATE LIMITED 156 SAHYOG VIHAR, SHAHPURA, BHOPAL 19-10-2016
2454 KHWAHISH LEATHER SKILL TRAINERS AND CONSULTANTS 201 MANGAL PRBHAT APARTMENT 137 MAHADEV TOTLA NAGAR INDORE 8-9-2014
2455 KIIT UNIVERSITY KIIT SCHOOL OF RURAL MANEGEMENT(KSRM), KIIT UNIVERSITY, CAMPUS 7, PATIA 15-9-2015
2456 KINGMAKER EDUCATION SERVICES PRIVATE LIMITED 1ST FLOOR, USHA PLAZA, GANDHI NAGAR, AIRPORT ROAD, INDORE 21-1-2015
2457 KING MANPOWER SOLUTION PRIVATE LIMITED PLOT NO. A/20, N1 AREA, JAYDEV VIHAR, BHUBANESWAR-751015 17-12-2013
2458 KINGS EDUCATIONAL INSTITUTIONS 108, PIDARI SOUTH STREET, SIRKAZHI, 26-4-2016
2459 KINGSTON EDUCATIONAL INSTITUTE VILL: BERUNANPUKURIA, P.O. MALIKAPUR, P.S. DUTTAPUKUR, NORTH 24 PARGANAS 12-9-2016
2460 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD 18-1-2017
2461 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE ROAD 19-1-2017
2462 KINGSTON EDUCATIONAL TRUST PURBASHA, MADHYAMGRAM, JESSORE RD., KOLKATA 13-1-2017
2463 KIPS EDUCATIONAL CHARITABLE TRUST MIG 59, PHASE-1, MODEL TOWN, BATHINDA 151001 5-5-2016
2464 KIPS EDUCATIONAL CHARITABLE TRUST STREET NO 9-B,AJIT ROAD,BATHINDA 28-9-2016
2465 KIRRAN ENTREPRENEURSHIP FOR YOUTH 27/35, SRI KARPAGAM COMPLEX, SALAI ROAD, WORAIYUR, TRICHIRAPPALLI-620003. 12-11-2013
2466 KIRUBA FOUNDATION 20,A RAJA MUTHAIYA NAGAR, THOMAS ROAD, BYPASS ROAD, MADURAI 9-4-2015
2467 KISAN SEWA SANSTHAN VILLAGE & POST BANKATI DISST BASTI 25-7-2016
2468 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATNI,KHURDA, ODISHA 15-9-2015
2469 KISHORE MEMORIAL CHARITABLE TRUST RAMACHANDRAPUR BAZAR, JATANI, KHURDA, ODISHA 14-10-2015
2470 KISNA EDUCATION SOCIETY ZAFFARPUR, GHARODA , BALLBGARH-TIGAON-MANJHAWALI ROAD, FARIDABAD, HARYANA 6-1-2016
2471 KITCO LIMITED FEMITH'S, P.B. NO. 4407 PUTHIYA ROAD, VENNALA KOCHI 15-4-2014
2472 KITES COMPUTERS DOOR NO 18-52, VELAMA THOTA, PENDURTHI, VISAKHAPATNAM 22-6-2015
2473 KITES SOFTWARES PVT LTD IIND FLOOR, JV HOUSE BLDG, NEAR NH BYPASS PIPELINE JN, PALARIVATTOM, EDAPPALLY P.O COCHIN 24 2-2-2015
2474 KITEX CHILDRENSWEAR LTD PB NO.5, KIZHAKAMBALAM P.O, ALUVA, ERNAKULAM-683562 18-8-2015
2475 K K BIRLA MEMORIAL MEMORIAL SOCIETY CHAMBAL FERTILISERS AND CHEMICALS LIMITED, GADEPAN 8-6-2016
2476 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY V RAVEENDRA, D.NO:34-1-16,C/O:KK COMPUTERS, OPP:DISTRICT LIBRARY, COURT CENTER,ONGOLE, PRAKASAM(DST),PINCODE:523001. ANDHRA PRADESH. 11-8-2015
2477 KK EDUCATIONAL AND RURAL DEVELOPMENT SOCIETY 37-1-413 (110A), RAM NAGAR, 5TH LANE, ONGOLE, PRAKASAM DISTRICT, ANDHRA PRADESH 7-10-2016
2478 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH 26-8-2016
2479 K K GROUP OF EDUCATION SOCIETY KODIAGANJ, PILAKHNA, ALIGARH 21-6-2016
2480 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL 26-4-2016
2481 KLEANO HOUSEKEEPING SERVICES PVT LTD SHOP NO 9,PLOT NO 1 SHREE SIDDHI VINAYAK MAHIMA SECTOR 19,NEW PANVEL 2-3-2016
2482 KL INFITECH SERVICES PRIVATE LIMITED 31/17, NO. 2, /GROUND FLOOR, G.C. TOWERS, DURAISAMY ROAD, T.NAGAR, CHENNAI 23-9-2016
2483 KMBB COLLEGE OF ENGINEERING AND TECHNOLOGY DEPARTMENT OF RESEARCH & DEVELOPMENT, KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALAIPUT, NH - 5, KHURDA, ODISHA. 14-9-2015
2484 KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032 1-6-2016
2485 KMC CONSTRUCTIONS LIMITED KMC CONSTRUCTIONS LIMITED 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, RANGAREDDY TELANGANA TEL NO.04023189999 31-5-2016
2486 KMC CONSTRUCTIONS LIMITED DOOR NO. 1-80/40/SP/58-65, SHILPA HOMES LAYOUT, GACHIBOWLI, HYDERABAD, TELANGANA 500032 17-5-2016
2487 KNOWLEDGE PARTNER TECHNOLOGIES PRIVATE LIMITED FIRST FLOOR, SRI JAYALAKSHMI COMPLEX OLD NO.30/NEW NO.62, NORTH BOAG ROAD T. NAGAR, CHENNAI - 600017 TAMIL NADU, INDIA. 1-11-2013
2488 KNOWX INNOVATIONS PRIVATE LIMITED #56, II FLOOR, PUSHPAGIR COMPLEX, 17TH CROSS 8TH MAIN, OPPOSITE TO WATER TANK, VIJAYNAGAR, BANGALORE 8-12-2013
2489 KOHINOOR EDUCATION TRUST KOHINOOR CITY, KIROL ROAD, OFF. L.B.S. MARG, VIDYAVIHAR/KURLA (W) MUMBAI 5-2-2015
2490 KOHINOOR TECHNICAL INSTITUTE PRIVATE LIMITED KOHINOOR CORPORATE OFFICE, SENAPATI BAPAT MARG., DADAR, MUMBAI. 7-1-2015
2491 KOLKATA VOCATIONAL ACADEMY 377/1 PULIN AVENUE, PO- RAJBARI, 11-9-2015
2492 KOPOKH FIBERS AND INDUSTRIES LTD 401,405, 4TH FLOOR, DALAMAL HOUSE, J.BAJAJ ROAD, NARIMAN POINT, MUMBAI 28-9-2015
2493 KOSHISH FOUNDATION 2ND FLOOR, LIMBUWALA COMPLEX, NR. GPO, OPP. KAVITA SHOPPING CENTRE ANANND 11-9-2015
2494 KOTTAPURAM INTEGRATED DEVELOPMENT SOCIETY KIDS KOTTAPURAM INTEGRATED DEVELOPMENT SOCIETY [KIDS] KIDS’ CAMPUS, N.H. 17, KOTTAPURAM KODUNGALLUR THRISSUR DIST., KERALA, INDIA 10-7-2015
2495 KOTTAYAM SOCIAL SERVICE SOCIETY KOTTAYAM SOCIAL SERVICE SOCIETY CHAITHANYA, THELLAKOM P.O. KOTTAYAM - 686630 KERALA, INDIA 17-4-2014
2496 KOYLANCHAL PRABANDHAN SHIKSHA VIKASH TRUST KUMAR MANSION 2ND FLOOR, BESIDE ALLAHABAD BANK, HOUSING COLONY ROAD, BARTAND, DHANBAD 25-11-2014
2497 K P V VOCATIONAL TRAINING CENTRE 1 NO. OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056, WEST BENGAL 5-9-2016
2498 KRISHAK SEWA SANSTHAN GODARA SADAN GANESH COLLONY, PARBATSAR DISTRICT-NAGAUR, RAJASTHAN, PIN-341512 22-1-2014
2499 KRISHI GRAMIN EVUM PARYAVARAN VIKAS SANSATHA 1-C-13, PAWANPURI, HOUSING BOARD 4-12-2014
2500 KRISHNAKALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103 14-10-2016
2501 KRISHNA PATH INCUBATION SOCIETY 13 KM STONE GHAZIBAD MERRUT ROAD NH-58 MURADNAGAR, GHAZIBAD 15-9-2015
2502 KRISHNA PATH INCUBATION SOCIETY TBI 13 KM STONE GHAZIABAD-MEERUT ROAD, MURAD NAGAR, GHAZIABAD, U.P. 10-9-2015
2503 KRISHNAPATNAM SECURITY SERVICES PRIVATED LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT 17-5-2016
2504 KRISHNAPATNAM SECURITY SERVICES PRIVATE LIMITED POST BAG NO 2 GOPALAPURAM(VILL) MUTHUKUR(MDL) SPSR NELLORE DISTRICT 9-2-2016
2505 KRISHNASAI EDUCATIONAL SOCIETY KRISHNASAI EDUCATIONAL SOCIETY C/O GUNTUR ENGINEERING COLLEGE NH-5, YANAMADALA OPP: KATURI MEDICAL COLLEGE, GUNTUR ANDHRA PRADESH 8-5-2014
2506 KRISHNAVENI AMMAL EDUCATIONAL AND RURAL DEVELOPMEN 2 /193 THERADI STREET KOLIYANUR & POST VILLUPURAM 11-9-2015
2507 KRISHNAVENI AMMAL EDUCATIONALAND RURAL DEVLP TRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM TK &DT 18-9-2015
2508 KRISHNAVENIAMMALEDUCATIONALRURALDEVELOPMENTTRUST 2/193,THERADI STREET, KOLIYANUR & POST VILLUPURAM T.K D.T 28-9-2015
2509 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY,TIRUPUR 28-9-2015
2510 KRISHNAVENI GARMENTS N0 7,AVARANGADU THOTTAM, COLLEGE ROAD, NEAR POSTAL COLONY,TIRUPUR 14-10-2015
2511 KRISHNAVENI GARMENTS 7,AVARANGADU THOTTAM,COLLEGE ROAD, POSTAL COLONY, TIRUPUR 16-9-2015
2512 KRISH SERVICES PVT LTD HOUSE NO 9, SILA SADAN,1ST FLOOR BSIDC COLONY,ADRI LANE,BORING ROAD PATNA 3-3-2016
2513 KRISNA KALI VOCATIONAL TRAINING CENTER RABINDRA BHAWAN, KRISHNA KALITALA, PO. MOKDAMPUR, PS. ENGLISH BAZAR, DIST. MALDA, PIN.732103 7-9-2016
2514 KRK EDUCATIONAL TRUST KRK EDUCATIONAL TRUST, NO.40/1, OLD NO.23, ARM AVENUE, BOAT CLUB ROAD, RAJA ANNAMALAIPURAM, CHENNAI, TAMILNADU 25-11-2014
2515 KRUGER BRENT INFOTECH NEAR SAI VIHAR, SUNDARGARH 5-9-2016
2516 K RUKMINI SHIKSHAN KRIDA YUVAK KALYAN PRASARAK MANDAL AT-POST-RANISAWARGOAN,TQ.GANGAKHED DIST-PARBHANI MAHARASHTRA (INDIA) 7-1-2015
2517 KRUPA GOSPEL MINISTRIES PLOT NO.600, ROAD NO.11, VAIDEHI NAGAR, VANASTALIPURAM,HYDERABAD, TELANGANA 4-3-2015
2518 KRUSHI MITRA GRAMEEN ABHIVRUDHI SANSTHE #99, SHIVLINGESHWAR KRUPA MAHALINGESHWAR NAGAR FALLS ROAD GOKAK 18-7-2014
2519 KRUSHI VIKAS VA GRAMIN PRASHIKSHAN SANSTHA A/P TALNI BLOCK MOTALA DIST BULDANA MAHARASHTRA PIN 443102 22-6-2016
2520 KRUSHI VIKAS VA GRAM VIKAS SANSTHAN ABOVE RAMA TRACTORS, ADARSHA NAGAR MALKAPUR, BLOCK MALKAPUR, DIST BULDANA, MAHARASHTRA 23-5-2016
2521 KRYSTAL AVIATION SERVICES PRIVATE LIMITED 15A/17, KRYSTAL HOUSE, SHIVAJI FORT CO-OP HSG LTD., DUNKAN CAUSEWAY ROAD, SION TALAO, SION MUMBAI 400022. 12-9-2016
2522 KRYSTAL INTEGRATED SERVICES PVT LIMITED KISPL 15, KRYSTAL HOUSE, DR. MANIKAR ROAD, SION (EAST) MUMBAI 30-10-2013
2523 KSEDC LTD KERALA STATE ELECTRONICS DEVELOPMENT CORPORATION LTD,KELTRON HOUSE, VELLAYAMBALAM,THIRUVANANTHAPURAM 14-10-2015
2524 KSEDC LTD KELTRON HOUSE, VELLAYAMBALAM, TRIVANDRUM, KERALA 11-9-2015
2525 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON 16-3-2016
2526 K S MULTIFACILITY SERVICES PRIVATE LIMITED CORP OFF:SHOP NO. 30 OPPOSITE SEC-5 SHEETALA MATA ROAD GURGAON REG OFF : H.NO. 31/22, GALI NO. 12, GANDHI NAGAR, GURGAON 6-4-2016
2527 KUHU CONSULTING PRIVATE LIMITED KUHU HOUSE. #97-A, PKT C-1, MAYUR VIHAR - 3, NEW DELHI - 110096 22-1-2014
2528 KULKARNI AND SAHU BUILDCON PRIVATE LIMITED B-495,CROSS STREET 25, SMRITI NAGAR,BHILAI 7-12-2016
2529 KULWANTI SKLILL ACADEMY PRIVATE LIMITED 117/N/10, KAKADEO 26-7-2016
2530 KUMARAN SOCIAL TRUST HIG, 38, JAYAM COMPLEX, 1 ST FLOOR, 80 FEET ROAD, ANNA NAGAR, MADURAI 6-1-2016
2531 KUMARAN SOCIAL TRUST HIG 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI 18-8-2016
2532 KUMARAN SOCIAL TRUST HIG - 38, JAYAM TOWER, 1ST FLOOR, UPSTAIRS TO LAKSHMIVILAS BANK, 80 FEET ROAD, ANNA NAGAR, MADURAI 12-9-2016
2533 KUMAR R 13 SOUTH OPPANI STREET,TENKASI,TIRUNELVELI 1-12-2014
2534 KUMAR TRUST 27,NETHAJI ROAD,S.KODIYUR, JOLARPETTAI - 635 851. TIRUPATTUR(TK), VELLORE (DISTRICT), TAMIL NADU, INDIA. 21-1-2015
2535 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR 14-8-2015
2536 KUNAL LOHACHEM PRIVATE LIMITED A-13 MAHAVIR GOUSHALA COMPLEX K.K. ROAD CHHATISGARH RAIPUR 11-8-2015
2537 KUNJA BINODINI CHARITABALE TRUST PLOT NO. – HIG A/39 (GROUND FLOOR), BARAMUNDA HOUSING BOARD COLONY, NEAR FIRE STATION, BHUBANESWAR 6-10-2016
2538 KUNJA BINODINI CHARITABLE TRUST C/O-HI-TECH INSTITUTE OF TECHNOLOGY KHORDHA INDUSTRIAL ESTATE, NEAR NH-5, KHORDHA BY-PASS, KHORDHA 14-9-2015
2539 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010 23-12-2016
2540 KUNJ ALLOYS PRIVATE LIMITED PLOT NO.9.SEC-A.ZONE-B. MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR-751010 29-12-2016
2541 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASAPURAM MAYILADUTHURAI NAGAPATTINAM TAMIL NADU 5-4-2016
2542 KUNJAMMALMEMORIALEDUCATIONECONOMICALDEVELOPMENTTRU 131, RAJAJI STREET SRINIVASPURAM MAYILADUTHURAI 18-8-2016
2543 KUNWAR AYUSH EDUCATIONAL SOCIETY 636/109, BUDDH VIHAR, TAKROHI, NEAR AMBEDKAR CHAURAHA, LUCKNOW 7-1-2015
2544 KUSHAL EDUCATION TRUST SPONSORING BODY OF JODHPUR NATIONAL UNIVERSITY NARNADI,JHANWAR ROAD,BORANADA JODHPUR (RAJASTHAN) INDIA ADDRESS 65 SARDAR PATEL MARG C SCHEME JAIPUR RAJASTHAN 23-12-2013
2545 KVR INFOSYS PVT LTD PLOT NO. 64, KAUSHIK CHAMBER, SECTOR 19 A, VASHI, NAVI MUMBAI - 400705 17-12-2013
2546 LABOURNET SERVICES INDIA PRIVATE LIMITED 25/1-4,IINDFLOOR,9THCROSS,JPNAGARIIPHASE,BANGALORE-560078.KARNATAKASTATE,INDIA 5-11-2013
2547 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, CTH ROAD, VILLIVAKKAM, CHENNAI 12-9-2016
2548 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEAYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI 9-8-2016
2549 LADDERS TRAINING SOLUTIONS PRIVATE LIMITED JEYAM SAKTHI COMPLEX, 156, FIRST FLOOR, CTH ROAD, VILLIVAKKAM, CHENNAI 14-7-2016
2550 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SANTHI NAGAR, JAGGAYYAPETA,KRISHNA DISTRICT 6-9-2015
2551 LAHARI VOLUNTARY ORGANISATION D.NO:6-1015, SHANTHI NAGAR, JAGGAYYAPET,KRISHANA DISTRICT. 21-9-2015
2552 LAKSH EDUCATIONAL SOCIETY A-13/1, SOUTH SIDE G.T. ROAD, IND. AREA NH-24 HIGHWAY, GHAZIABAD 4-12-2014
2553 LAKSHMI VIDYA SANGHAM LAKSHMI VIDYA SANGHAM (TVS COMMUNITY COLLEGE) NO.8, GOODS SHED STREET MADURAI 11-9-2014
2554 LAKSHYA 4THFLOOR,IDCO TOWER,1,JANPATH,BHUBANESWAR 11-9-2015
2555 LAKSHYABHED EDUCATIONS PVT LTD 5, SAI COMPLEX, BHARAT NAGAR SQUARE, AMRAVATI ROAD 4-4-2016
2556 LALA 5678, NJMORTH STRTEET, LALA NAGAR, NAMAKKAL 15-9-2015
2557 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE FATEHABAD ROAD, BHUNA (FATEHABAD)HARYANA PIN-125111 5-4-2016
2558 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE, NEAR RADHA SWAMI SATSANG BHAWAN FATEHABAD ROAD BHUNA 7-1-2016
2559 LALA KUNDAN LAL MEMORIAL SOCIETY C/O GURU DRONACHARYA GROUP OF INSTITUTE NEAR RADHA SAWAMI SATSANG BHAWAN FATEHABAD ROAD, BHUNA TEH. AND DISTT. FATEHABAD HARYANA 2-3-2016
2560 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA – 700012 14-3-2016
2561 LALANI COMPUTER ACADEMY PRIVATE LIMITED LALANY COMPLEX,1A, KHETRA DAS LANE (BESIDE 25, GANESH CHANDRA AVENUE),KOLKATA, WEST BENGAL 13-4-2016
2562 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA, WEST NENGAL 2-3-2016
2563 LALANI COMPUTER ACADEMY PRIVATE LIMITED 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA,WEST BENGAL 16-3-2016
2564 LALANI COMPUTER ACADEMY PVT LTD 1A KHETRA DAS LANE (BESIDE 25 GC AVENUE), KOLKATA 5-2-2016
2565 LAL BAHADUR SHASTRI SHIKSHA SAMITI SECTOR-1 MAHAVEER NAGAR EXT. KOTA 23-12-2013
2566 LALITA EXCELLENCE EDUCATION SOCIETY 210, ROHIT NAGAR, PHASE-2, BAWADIYA KALAN BHOPAL 5-8-2016
2567 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR, PHASE-2,BAWADIA KALAN, BHOPAL 6-10-2016
2568 LALITA EXCELLENCE EDUCATION SOCIETY 210,ROHIT NAGAR PHASE-2, E-8 EXTENTION, BAWADIYA KALAN,BHOPAL (M.P.) 26-8-2016
2569 LAMBERT SECURITY MANAGEMENT PRIVATE LIMITED 107, IST FLOOR, BALALJI PLAZA, PLOT NO.-26,KP COMMERCIAL COMPLEX, PITAMPURA, DELHI. 5-11-2013
2570 LAQSH JOB SKILLS ACADEMY PVT LTD #14, AVS COMPOUND, BALAJI COMPLEX, 80 FEET ROAD, KORAMANGALA 4TH BLOCK, BANGALORE 3-1-2014
2571 LARSEN AND TOUBRO LIMITED L&T CONSTRUCTION MOUNT POONAMALLEE ROAD MANAPAKKAM, P.B. NO.979 CHENNAI 1-11-2013
2572 LATA FOUNDATION 117K/214B, R.S.PURAM SARVODAYA NAGAR KANPUR 21-6-2016
2573 LATA FOUNDATION 117/214,A,R,S,PURAM,SARVODAYA NAGAR 14-7-2016
2574 LATA FOUNDATION 117-K/214-B, R S PURAM, SARVODAY NAGAR, KANPUR, U.P.- 208025 14-9-2015
2575 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR 28-9-2016
2576 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR,SITAPUR 14-10-2016
2577 LATE MAHABIR PRASAD MEMORIAL SHIKSHAN SANSTHAN VIJAY LAXMI NAGAR , SITAPUR 20-9-2016
2578 LATE MAHAVEER PRASAD SHIKSHA MEMORIAL SANSTHAN VIJAY LAXMI NAGAR, NEAR HEAD POST OFFICE,SITAPUR 5-9-2016
2579 LATE M B SHAH EDUCATION TRUST SHIVALIK 5, MAHALAXMI CROSS ROAD, PALDI, AHMEDABAD 17-7-2014
2580 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION A UG 1 TO 6, JAMBHESHWAR COMPLEX, GANDHI NAGAR, PUR ROAD, BHILWARA, RAJASTHAN 311001 23-2-2016
2581 LATE SHRI MANGI LAL VISHNOI TECHNICAL EDUCATION AN MLV TECS, UG 1-6, JAMBHESHWAR COMPLEX, PUR ROAD, GANDHI NAGAR 4-1-2016
2582 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244 15-9-2015
2583 LATE SHRI SHIV BALAK RAM SWARNKAR SMRITI SHIKSHA P C/O BRILLIANT COMPUTER INSTITUTE BHAGWATI GANJ NEAR DURGA PALACE CHAURAHA DIBIYAPUR AURAIYA 206244 14-10-2015
2584 LAUNCHPAD LEARNING LABS AND CAREER PRIVATE LIMITED NO: 234, SAVADIPALAYAM PUDUR, N.UTHUKULI POST, ERODE, TAMILNADU-638104 15-9-2015
2585 LAURUS EDUTECH PRIVATE LIMITED DP-110, F-19, SECOND PHASE, INDUSTRIAL ESTATE, AMBATTUR, CHENNAI, TAMILNADU 19-10-2016
2586 LAXMI NARAYAN SHARMA SIKSHA EVAM SAMAJ KALYAN SAMITI LINE NO 2 ARYA NAGAR MORAR GWALIOR M.P. 1-5-2015
2587 LBS ACADEMY INTERNATIONAL PRIVATE LIMITED 673, MAHAVEER NAGAR, GOPAL PURA MOD JAIPUR 7-4-2016
2588 LCC INFOTECH LIMITED 2/5A SARAT BOSE ROAD,SUKHSAGAR ESTATE, KOLKATA 22-12-2013
2589 LEADER STAR SECURITY LIMITED 44-A, AYODHYA COLONY, HEERAPURA, NEAR SIKAR BYEPASS, AJMER ROAD, JAIPUR, RAJASTHAN 21-12-2016
2590 LEADING ORGANISATION FOR RURAL DEVELOPMENT AT-MANJURIPADA, P.O-ENDOL VIA-JENAPUR DIST-DHENKANAL,ODISHA 11-11-2014
2591 LEADING SKILL DEVELOPMENT A INNOVATIVE FOUNDATION B-22,JANAK VATIKA ,BHANKROTA -AJMER ROAD JAIPUR -302026 17-9-2015
2592 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY #202,SIRI ESTATES,BATA SHOW ROOM LANE,AMEERPET HYDERABAD 8-4-2016
2593 LEAN ORGANIZATION RURAL DEVELOPMENT SOCIETY PLOT 16A #10-3-3/8B EAST MARREDPALLY,SECUNDERABAD 11-3-2016
2594 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, 514, EDUCOMP TOWER, UDYOG VIHAR PHASE 3, GURGAON 23-10-2015
2595 LEARNING LEADERSHIP FOUNDATION 2ND FLOOR, EDUCOMP TOWER, 514, UDYOG VIHAR PHASE - 3, GURGAON 15-9-2015
2596 LEARNING LEADERSHIP FOUNDATION 514, 2ND FLOOR, EDUCOMP TOWER, UDYOG VIHAR, PHASE - 3, GURGAON, HARYANA 14-10-2015
2597 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA 28-1-2016
2598 LEARNING LINKS TRUST AT/POST- KANTABADA VIA- JANLA, KHURDA-BARANGA ROAD BHUBANESWAR, KHURDA 16-2-2016
2599 LEARNING TOOLS PVT LTD 301, 6TH FLOOR, SHIV KRIPA COMMERCIAL, ABOVE WAMAN HARI PETHE JEWELLERS, B-CABIN ROAD, THANE WEST - 400 602 29-4-2016
2600 LEARNING TREE #501,AISHWARYA GRAND,KRISHNA COLLEGE ROAD,H.B.COLONY,VISAKHAPATNAM,ANDHRA PRADESH 26-7-2016
2601 LEATHER SECTOR SKILL COUNCIL COUNCIL FOR LEATHER EXPORTS, 3RD FLOOR, CMDA TOWER - II, GANDHI IRWIN BRIDGE ROAD, EGMORE, CHENNAI - 600 008 8-9-2014
2602 LEELAS FOUNDATION FOR EDUCATION AND HEALTH CORPORATE OFFICE: NEAR TEACHER'S COLONY, RSS UNIVERSITY CAMPUS, RAIPUR- CHHATTISGARH 7-1-2015
2603 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRA ROAD,TELANGANA,KHAMMAM 14-12-2016
2604 LEE POWER ON SOLUTIONS PRIVATE LIMITED 6-2-6,OPP: HERO SHOW ROOM,NEAR ICICI BANK,WYRAROAD,KHAMMAM,TELANGANA 21-12-2016
2605 LEGEND MARKETING AND SERVICES B 28 PHASE 1 , CHATRASAAL NAGAR PIPLANI BHOPAL 2-3-2016
2606 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI, GUNTUR(DT) 4-1-2016
2607 LEZEND INSTITUTE OF SOFTWARE TRAINING #17, NSR VILLA, NH-5, MANGALAGIRI BYPASS, MANGALAGIRI, GUNTUR(DT) 14-10-2015
2608 LICHHWI MAHATMA GANDHI MARG, NEAR LAXMI CINEMA, PO- KHAGARIA 13-1-2014
2609 LIFE CARE H AT/PO-BABANARPAL,PS-BANARPAL, DIST-ANUGUL 26-4-2016
2610 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN 17, LEVEL 5, T-HUB, IIIT, GACHIBOWLI, HYDERABAD (HEAD OFFICE) 6-12-2016
2611 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-17, T-HUB, IIIT, GACHIBOWLI, HYDERABAD 1-11-2016
2612 LIFE CIRCLE HEALTH SERVICES PVT LTD CABIN-15, 5TH FLOOR, T-HUB, GACHIBOWLI, HYDERABAD 19-9-2016
2613 LIFE FOUNDATION #3-11-177, OPP. KTS, RTC COLONY, LB NAGAR, HYDERABAD 19-11-2015
2614 LIFE LINE CARE ORGANISATION A/234 BHARAT VIHAT,STREET NO-52,NEAR-BADI MAHAZID,KAKROLA,DWARKA,NEW DELHI 2-2-2015
2615 LIFELINE HOSPITAL LIFELINE HOSPITAL GILL ROAD 1-12-2014
2616 LIFE LINE SERVICE SOCIETY 10 CIVIL LINE, NEAR BANK OF INDIA, SAGAR, MP 9-2-2016
2617 LIFE LINE SERVICE SOCIETY 10,CIVIL LINE ,RADHA KUNJ,NEAR BANK OF INDIA SAGAR M.P-47001 5-2-2016
2618 LIFE LIVING WELFARE SOCIETY 424 AVAS VIKAS COLONY YOJANA-2 JHUNSI ALLAHABAD U.P. 21-8-2014
2619 LIFT ACADEMY LLP F-701, REMI BIZCOURT, OFF VEERA DESAI ROAD, NEAR VEERA DESAI ROAD POLICE STATION, ANDHERI WEST, MUMBAI 17-5-2016
2620 LILADHAR SIKSHA PRASARAN SAMITI VILL-PAL CHANDRAHA POST-TADIBADA RASRA DISTT- BALLIA 15-9-2015
2621 LIMRA SOCIAL WELFARE SOCIETY AT-CHOPRA, AZAD NAGAR PO+PS-CHOPRA 17-5-2016
2622 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.) 28-9-2016
2623 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.) 8-6-2016
2624 LIMRA SOCIAL WELFARE SOCIETY AT - VILL- KALIGANJ, P.O.- KHUNIA, P.S.- CHOPRA, DIST- UTTAR DINAJPUR, PIN-733207 (W.B.) 9-8-2016
2625 LINGAYAS SOCIETY LINGAYA'S UNIVERSITY NACHAULI, JASANA ROAD, FARIDABAD 21-12-2016
2626 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110047 18-9-2015
2627 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070 6-10-2015
2628 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR LSC B-01 VASANT KUNJ NEW DELHI-110070 16-10-2015
2629 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI 2-11-2015
2630 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI 14-9-2015
2631 LION MANPOWER SOLUTIONS PVT LTD PLOT-10 3RD FLOOR L S C B-01 VASANT KUNJ NEW DELHI-110070 13-10-2015
2632 LION MANPOWER SOLUTIONS PVT LTD PLOT NO-10 3RD FLOOR LOCAL SHOPING COMPLEX B-01 VASANT KUNJ NEW DELHI 28-9-2015
2633 LITE TECH ELECTRONICS LIMITED B-7/3, SF, VASANT VIHAR 4-4-2016
2634 LITE TECH ELECTRONICS LTD B-7/3, SF, VASANT VIHAR, NEW DELHI 12-4-2016
2635 LIVELIHOOD INITIATIVES FOR EMPOWERMENT REGISTERED OFFICE: B-606 SATYAM APARTMENT, PLOT NO-5 SEC-18A, DWARKA, NEW DELHI 4-10-2013
2636 LNJ INSTITUTE OF SKILLS AND TECHNOLOGY PRIVATE LTD REGISTERED OFFICE : A- 47NEW FRIENDS COLONY EAST , NEW DELHI HO - A-12 SECTOR 1 NOIDA 21-9-2016
2637 LOGOS COMPUTER EDUCATION AND TRAINING CENTRE LOGOS COMPUTER EDUCATION AND TRAINING CENTRE,BIJAYA TALKIES ROAD,SUNDARGARH,ODISHA 22-12-2013
2638 LOKAMATA RANI RASHMONI MISSION VILLAGE NIMPITH, P.O. NIMPITH ASHRAM, SOUTH 24 PARGANAS, WEST BENGAL 4-1-2016
2639 LOK BHARTI SKILLING SOLUTIONS PVT LTD I - 83 3RD FLOOR, LAJPAT NAGAR - 2, NEW DELHI 4-10-2013
2640 LOKKALYANJANSABHA 110,CHANKYAPURI,J.K.ROAD,BHOPAL 3-3-2016
2641 LOKMITRA SANSTHA NUTAN COLONY , NR. RAHUL NAGAR, PARBHANI 13-9-2015
2642 LOK SEVA BHARTI V.P.O.-UGRAKHERI, PANIPAT 11-9-2015
2643 LOMASH SLURRYTECH PRIVATE LIMITED C-4, SECTOR 6 NOIDA, U.P. 201301 INDIA 21-12-2016
2644 LORDGANESHAINSTOFMANAGEMENTANDTECHNOLOGY SCF 60-61 PHASE 3B2 TOP FLOOR MOHALI 25-8-2014
2645 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT INDUSTRIAL TRAINING INSTITUTE PLOT NO-13, ASHOK VATIKA, POLICE STATION LAJPAT NAGER, SAHIBABAD 25-7-2016
2646 LORD MAHAVIR EDUCATIONAL AND SOCIAL SOCIETY ICT ITI, PLOT NO-13, ASHOK VATIKA CAMPUS, BEHIND POLICE STATION, LAJPAT NAGER, SAHIBABAD 30-6-2016
2647 LORDS INFOTECH MANAGEMENT P LTD NIIT DIMAPUR CENTER C/O.MAHAVIR RICE MILLS CAMPUS RAM JANAKI HR. SEC. SCHOOL ROAD 5-11-2013
2648 LORDS INSTITUTE OF MANAGEMENT TOP FLOOR, BELGIUM SQUARE, NEAR LORDS PLAZA HOTEL, RING ROAD, SURAT 4-7-2016
2649 LOTUS EDUCATIONAL CHARITABLE TRUST 24-O/D,MELA GANDHI NAGAR, AMBALAVANAPURAM, VICKRAMASINGAPURAM, AMBASAMUDRAM TALUK, TIRUNELVELI DISTRICT, TAMIL NADU 13-9-2015
2650 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR. 14-9-2015
2651 LOVE AND ACCEPTANCE 22/92, KUMARAPPAPURAM, 2ND STREET, RAYAPURAM WEST, TIRUPUR. 13-10-2015
2652 LOVEDALE FOUNDATION #16/4 SLV LAYOUT ANAGAL PURA,DODDA GUBBI PO BANGALORE-560077 TEL-080-65908001 CELL-0-98451-86941 17-2-2015
2653 L P SARDAR VALLABHBHAI PATEL P SEVA SANSTHAN ASHARAFNAGAR, ALAMNAGAR, TEH- SADAR, DIST.- LUCKNOW 16-2-2016
2654 LRSINDIA PAONA BAZAR, NEAR UBI BANK OPP PUNJBA NATIONAL BANK PO-IMPHAL WEST,MANIPUR STATE 9-5-2016
2655 LUCKYLARK INTEGRATED TEXTILES AND GARMENT H C W A/P-GARDI, TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA. 23-11-2016
2656 LUCKY LARK INTEGRATED TEXTILES AND GARMENT HW AT POST GARDI TAL KHANAPUR (VITA) DIST.SANGALI MAHARASHTRA. 1-6-2016
2657 LUCKY LARK INTEGRATED TEXTILES AND GARMENT H W PLOT NO. 15, A/P-GARDI(GHANWAD), TAL-KHANAPUR(VITA), DIST-SANGLI, MAHARASHTRA 24-10-2016
2658 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR,ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI 5-9-2016
2659 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP.ALL INDIA RADIO,CHANDMARI,GUWAHATI 20-7-2016
2660 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,OPP ALL INDIA RADIO,CHANDMARI,GUWAHATI 12-8-2016
2661 LUIT EDUCATIONAL SERVICES PVT LTD 2ND FLOOR ABOVE BIMAL AUTO AGENCY,OPP. ALL INDIA RADIO,CHANDMARI,GUWAHATI 6-4-2016
2662 LUIT EDUCATIONAL SERVICES PVT LTD ABOVE BIMAL AUTO AGENCY,2ND FLOOR,CHANDMARI,GUWAHATI 12-8-2016
2663 MAA BHUASUNI MANGALA CHARITABLE TRUST AT - JAYANAGAR (KANKARA), PO - PALAKARI, VIA/PS - DHAMNAGAR, DIST - BHADRAK, ODISHA 4-12-2014
2664 MAA JAYADURGA TRUST MIG -II-2/3, BDA COLONY, PO - CHANDRASEKHARPUR, BHUBANESWAR, DIST - KHURDHA, ODISHA 13-11-2014
2665 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE, ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006 15-11-2016
2666 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER CHANORA PRA BHA SAHI 2ND LANE BERAMPUR GANJAM 21-9-2016
2667 MAA MAHURIKALUA INDUSTRIAL TRAINING CENTER 1ST GATE,ASKA ROAD AT/PO-BERHAMPUR,DIST-GANJAM,ODISHA,760006 6-10-2016
2668 MAAN AIDS FOUNDATION 2ND FLOOR, 2B RAJSHI APARTMENTS, 11B DALIBAGH, LUCKNOW 14-11-2013
2669 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR 5-9-2016
2670 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (222143) 23-11-2016
2671 MAAN SNEH SEWA SAMITI DEVNAGAR, NEW POST OFFICE, NEAR BUS STAND, MACHHALISHAHAR, JAUNPUR, UTTAR PRADESH (PIN-222143) 28-9-2016
2672 MAASANIAMMAN TRUST 2/16, GURUVAPPANAYAKKANUR, MANUPPATTY POST, UDUMALPET TK, TIRUPUR DT. 7-1-2016
2673 MAA SARALA EDUCATION AND HEALTH TRUST PLOT NO -2499, NAYAGARH ROAD, DIST - KHORDHA, ODISHA 8-9-2014
2674 MAA SARASWATI BAHU UDDESHIYA SHIKSHAN SANSTHA SANT KABIR WARD, CHANDANI CHOWK, BHANDARA 21-9-2015
2675 MAA SARASWATI CHARITABLE TRUST NH-24, PAWLA, PILAKHUWA, HAPUR 14-3-2016
2676 MAA SARASWATI CHARITABLE TRUST NH-24 , PAWLA, PILAKHUWA , HAPUR 3-3-2016
2677 MAA SARASWATI CHARITABLE TRUST NH-24,PAWLA,PILAKHUWA,HAPUR 21-12-2015
2678 MAA SARASWATI EDUCATIONAL TRUST SADHAURA ROAD, KALA AMB, SIRMOUR, HIMACHAL PRADESH-173030 2-11-2016
2679 MAA VAISHNO DEVI EDUCATIONAL TRUST BAPU NAGAR ,BHARATPUR 14-9-2015
2680 MACRO MINDS EDUTECH PRIVATE LIMITED 148, KALITALA MAIN ROAD, PURBACHAL BEHIND BANK OF INDIA KOLKATA 21-12-2016
2681 MACSAM CLOTHING PVT LTD C-4, SECTOR 6, NOIDA UTTER PRADESH 21-12-2016
2682 MADDIRALA SIVAIAH MEMORIAL EDUCATIONAL SOCIETY AMARAVATHI ROAD, GORENTLA, GUNTUR 4-8-2016
2683 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR KHUSHHALI BAZAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP 18-9-2015
2684 MADEEHA EDUCATIONAL WELFARE SOCIETY NEAR HDFC BANK SHAUKAT ALI ROAD RAMPUR UP 11-9-2015
2685 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.-KISMAT BAJKUL P.S.- BHUPATINAGAR,PIN-721655, WEST BENGAL 8-9-2016
2686 MADHABDIP EDUCATION SOCIETY VILL- KAKHURIABARI, P.O.- KISMAT BAJKLUL, DIST.- PURBA MEDINIPUR, WEST BENGAL 22-8-2016
2687 MADHUMITHA SOFTWARE SERVICES FLAT NO: E-56, SUIT NO: 103, VAISHNAVI RESIDENCY-II, MADHURANAGAR, HYDERABAD 500 038, TELENGANA, INDIA. 7-1-2016
2688 MADHUMOY SRILEKHA EDUCATION AND WELFARE SOCIETY CHITTARANJAN ROAD, NEAMATPUR, P.O- SITARAMPUR, (BESIDE AGARWAL NURSING HOME), DIST- BURDWAN 21-1-2015
2689 MADHYABHARAT EDUCATION SOCIETY HOUSE NO 38(1),KANHARTOLI,TILAKWARD,CHOTAPALCHOWK,GONDIA 20-7-2016
2690 MADHYAM FOUNDATION N3/202, IRC VILLAGE, NAYAPALLI, BHUBANESWAR, ODISHA 15-5-2014
2691 MADURAI INSTITUTE OF ENGINEERING AND TECHNOLOGY MADURAI - CHINTHAMANI - NEDUNKULAM ROAD POTTAPALAYAM SIVAGANGAI DT 14-9-2015
2692 MADURAI NON FORMAL EDUCATION CENTRE NO. 15, FATHIMA NAGAR, (NEAR FIRST ASSEMBLY OF GOD CHURCH), ANNAI THERASA STREET, BYE PASS ROAD, MADURAI 11-8-2014
2693 MA FOI CONNECTING DOTS ADVISORY PRIVATE LIMITED C-2, II FLOOR, CEEBROS BUILDING, D-32, CENOTAPH ROAD, TEYNAMPET, CHENNAI 12-9-2015
2694 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA 16-12-2016
2695 MAGIC WAND EMPOWERMENT PRIVATE LIMITED MAGIC WAND EMPOWERMENT PRIVATE LIMITED 1ST FLOOR, G K ARCADE, T MARIAPPA ROAD,, 1ST BLOCK, JAYANAGAR,, BANGALORE - 560011, KARNATAKA, INDIA 5-12-2016
2696 MAGNA INFOTECH LIMITED MAGNA INFOTECH LTD. 10-2-289, PLOT NO. 79 SHANTI NAGAR HYDERABAD 500 028 8-11-2013
2697 MAGS RURAL EDUCATION AND TECHNOLOGY PVT LTD # 48, 3RD FLOOR, 2ND MAIN, 2ND MAIN CROSS, MLA LAYOUT, MUTTAPPA BLOCK,RT NAGAR POST, GANGA NAGAR, BANGALORE. 8-9-2014
2698 MAHAAVIR PLYWOOD INDUSTRIES P.NO-660-661 AND 680-681,BEHIND POLICE STATION INDUSTRIAL AREA URLA 25-7-2014
2699 MAHADEV EDUCATIONAL SOCIETY MAHADEV COMPLEX, OPP - BSA OFFICE, BAIRAJ ROAD, BIJNOR - 246701 (UP) 4-4-2016
2700 MAHAGROPOINT FINANCIAL SERVICES PRIVATE LIMITED SHOP NO.31, 1ST FLOOR, CORPORATION COMPLEX 36/77, C.P. RAMASWAMY ROAD ALWARPET, CHENNAI 12-9-2015
2701 MAHAKAUSHAL VIKAS SAMITI RAIPUR PHASE-II,NEAR DIDVANIYA REGENCY,CENTURY COLONY,VINAYAKA VIHAR,D D U NAGAR, RAIPUR 6-9-2015
2702 MAHAKAVIBHARATHIYAREDUCATIONALANDCHARITABLETRUST NO 74, PALLIYUTHU, OPP, NAVARASAM SCHOOL, AVALPOONDURAI. 16-10-2015
2703 MAHAKUMA KUSTHA NIBARANI SAMITY SUNIL MAHATO VILLAGE GADHNI GADHNI, P.S JAMBONI JAMBONI PASCHIM MEDINIPORE WEST BENGAL 9-12-2016
2704 MAHALAKSHMI EDUCATIONAL AND SOCIAL SERVICE TRUST 42,MAHALAKSHMI ILLAM, MANI NAGAR II ND STREET K.K.ROAD, VILLUPURAM 21-1-2015
2705 MAHALAXMI MANAGEMENT INSTITUTE KL-114, KAVI NAGAR, GHAZIABAD, (UP) 26-2-2016
2706 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH 15-3-2016
2707 MAHA MRITYUNJAY LOK KALYAN TRUST N10/12D LAKHRAW BAJARDIHA VARANASI UTTAR PRADESH 221109 5-4-2016
2708 MAHANADI EDUCATION SOCIETY C-15, SHAILENDRA NAGAR, NEAR TAGORE NAGAR CHOWK, RAIPUR 10-2-2015
2709 MAHANANDA WELFARE TRUST STATION ROAD,OPPOSITE INDIAN OVERSEAS BANK.JHALJHALIA,MALDA,WEST BENGAL 14-9-2015
2710 MAHARANA INFRASTRUCTURE AND PROFESSIONAL SERVICES PRIVATE LIMITED W-23 ,SECTOR 11 ,NOIDA 30-1-2014
2711 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNANAGAR 12-9-2016
2712 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA YAMUNA NAGAR 12-8-2016
2713 MAHARANAPRATAP EDUCATIONAL AND SOCIALWELFARE TRUST 39, BHARAT SOCIETY, LAL DAWARA, YAMUNANAGAR 28-9-2016
2714 MAHARANA PRATAP EDUCATION CENTRE W-23 ,SECTOR 11 ,NOIDA 19-11-2013
2715 MAHARANI LAXMIBAI KANYA MAHAVIDYALAYA SAMITI VILLAGE AND POST AALAMPUR GERIA DISTRICT FATEHPUR 8-9-2016
2716 MAHARASHTRA ACADEMY OF ENGINEERING AND RESEARCH S. NO. - 124, MIT CAMPUS, PAUD ROAD, EX SERVICEMEN COLONY, KOTHRUD, PUNE, MAHARSHTRA 4-12-2014
2717 MAHARASHTRA EDUCATION SOCIETY BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR, STATE MAHARASHTRA 11-5-2016
2718 MAHARASHTRA EDUCATION SOCIETY ICHALKARANJI BLOCK NO. 42 & 43, MARATHA MANDAL BUILDING, MAIN ROAD, ICHALKARANJI, TAL. HATKANANGALE, DIST. KOLHAPUR 26-4-2016
2719 MAHARASHTRA INFORMATION TECHNOLOGY SUPPORT CENTER PLOT NO. 210, SOCIETY NO. 5, KONARK BUILDING, R.K. NAGAR, KOLHAPUR. 14-9-2015
2720 MAHARASHTRA TANTRIK SHIKSHAN MANDAL AHMEDNAGAR REGD OFF: PLOT-23, SONANAGAR, BHISTBAUG ROAD, BEHIND KING CORNER, SAVEDI, AHMEDNAGAR, MAHARASHTRA 1-3-2016
2721 MAHARISHI ATMAGNANI SANTHAMANI TRUST HEAD OFFICE: 2788, MELA ANUPANADI, MADURAI - 625009 TAMILNADU INDIA 26-7-2016
2722 MAHARISHI ATMAGNANI SANTHAMANI TRUST 2799, TNHB, NELA ANUPANADI, MADUARI, TAMIL NADU 24-6-2016
2723 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE , MATHURA ROAD 12-4-2016
2724 MAHARISHI INSTITUTE OF CREATIVE INTELLIGENCE A-14, MOHAN ESTATE, MATHURA ROAD 6-4-2016
2725 MAHATHMA CHARITABLE FOR HEALTH AND EDUCATION TRUST EAST STREET,KEELAPALUR,ARIYALUR (TK) & (DT) 8-9-2016
2726 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR,ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR(TK)&(DT) 3-11-2016
2727 MAHATHMA CHARITABLE INSTITUTION FOR HEALTH AND EDUCATION TRUST SARASWATHY NAGAR, ARIYALUR MAIN ROAD,KEELAPALUR,ARIYALUR (TK) & (DT) 17-10-2016
2728 MAHATHMAGANDHI EDUCATION FOUNDATION SANTHOSH BUILDING NEW BUSTAND THALASSERY-1 14-9-2015
2729 MAHATHMA GANDHI HUMAN DEVELOPMENT TRUST NO.2/65,VANNIYAR ST,PERIYAKADAMBUR VILL,TIRUTTANI T.K,TIRUVALLUR D.T,TAMIL NADU. 6-1-2016
2730 MAHATMA GANDHI ADIWASI VIKASH MANDAL VILLAGE- MOHABATTA, POST- PIPARIYA, TEHSIL- BAIHAR, DISTT.- BALAGHAT-481111, MADHYA PRADESH 3-4-2014
2731 MAHATMA GANDHI UNIVERSITY 13TH MILE, G S ROAD, PO- BYRNIHAT, DIST.- RI-BHOI, MEGHALAYA 22-10-2013
2732 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT 21-10-2016
2733 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT 7-9-2016
2734 MAHAVEERA EDUCATIONAL SOCIETY TALLY GHAR RG INTER COLLEGE ROAD CHHIPI TANK MEERUT 12-8-2016
2735 MAHAVEERA EDUCATIONAL SOCIETY THE PROFESSIONALS ,TALLY GHAR CHHIPI TANK RG INTER COLLEGE ROAD 6-10-2016
2736 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM 9-2-2016
2737 MAHENDRA DRIVING INSTITUTE 1CAMPING THOPPU SALAI VIGNESH NAGAR KONDASAMUDRAM GUDIYATTAM 14-3-2016
2738 MAHENDRA DRIVING INSTITUTE 2 CAMPING THOPPU SALAI, VIGNESH NAGAR, NEAR RTO OFFICE, KONDASAMUDRAM, GUDIYATTAM 26-2-2016
2739 MAHENDRA DRIVING INSTITUTE 2, CAMPING THOPPU SALAI, VIGNESH NAGAR, KONDASAMUDIRAM, GUDIYATTAM 16-3-2016
2740 MAHENDRA DRIVING SCHOOL 1&2 CAMPING THOPPU SALAI , VIGNESH NAGAR , NEAR RTO OFFICE , KONDASAMUDRAM GUDIYATTAM TK 21-12-2015
2741 MAHENDRA EDUCATIONAL PRIVATE LIMITED MAHENDRA EDUCATIONAL PRIVATE LIMITED- ARIF CHAMBER- IIND, FIRST FLOOR , SAHARA BHAWAN, KAPOORTHALA CROSSING, LUCKNOW 8-5-2014
2742 MAHENDRA NEXT WEALTH IT INDIA PRIVATE LIMITED CPS TOWERS,NO.16 , ADVAITHA ASHRAM ROAD SALEM 636 004.TAMILNADU , INDIA 25-12-2013
2743 MAHESH FOUNDATION ​MAHESH FOUNDATION # 1284, NEAR HARSHA HOTEL, RAMATIRTH NAGAR, BELAGAVI - 590016 KARNATAKA STATE. 20-7-2016
2744 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI, 8-9-2016
2745 MAHESHPUR MINOTI SOCIETY VILL-MAHESHPUR, P.O-ANANDABAD, P.S-BASANTI, DIST-SOUTH 24 PARGANAS, PIN-743312. 22-9-2016
2746 MAHILA COMPUTER SAKSHARTA SAMITI 47,C VANDANA NAGAR INDORE M.P. 30-9-2016
2747 MAHILA JAGRITI SAMITI MJS BHAWAN KETARI BAGAN SAMLONG NAMKUM 9-8-2016
2748 MAHILA MANDAL SEVABHAVI SANSTHA SATALA TQ SATALA SATALA TQ.AHMEDPUR DIST-LATUR (MAHARASHTRA) 15-9-2015
2749 MAHILA VIKAS KENDRA OPPOSITE JK BANK ,UTTAM COMPLEX FIRST FLOOR MIRAN SHAIB ,RS PURA JAMMU 12-9-2015
2750 MAHILA VIKAS SAMITI KHONGMAN OKRAM CHUTHEK MAKHA, P.O. SINGJAMEI, P.S. IRILBUNG, IMPHAL EAST DISTRICT, MANIPUR. 18-7-2014
2751 MAHIMA TECHNOLOGY PRIVATE LIMITED CPS TOWERS,NO.16 , ADVAITHA ASHRAM ROAD SALEM 636 004.TAMILNADU , INDIA 22-12-2013
2752 MAHOBIA COMPUTER INSTITUTE SOCIETY BALOD ROAD, HALDI, RAJNANDGAON, C.G. 15-9-2015
2753 MAHRISHI DAYANAND SHIKSHAN SANSTHAN WARD NO 9 SADULPUR TEH RAJGARH DISTT CHURU RAJ 13-9-2015
2754 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM , NEW DELHI -110068 4-8-2016
2755 MAINGUARD INDIA SERVICES PVT LTD 430/2, FOREST LANE, CROSS LANE NO. 10, NEB SARAI EXTN., SAINIK FARM, NEW DELHI 6-10-2016
2756 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY, CHERANDATHUR,VADAKARA,KOZHIKODE DISTRICT, KERALA STATE 23-12-2016
2757 MALABAR HIGHER EDUCATIONAL SOCIETY THODANNUR-CHERANDATHUR RD, PIN:-673541, KOZHIKODE (DIST), KERALA, INDIA 30-6-2016
2758 MALABAR HIGHER EDUCATIONAL SOCIETY MALABAR HIGHER EDUCATIONAL SOCIETY,CHERANDATHUR, VADAKARA, KOZHIKODE DIST, KERALA STATE 26-8-2016
2759 MALABAR SOCIAL SERVICE SOCIETY MALABAR SOCIAL SERVICE SOCIETY (MASSS) SREEPURAM, PALLIKKUNNU P O KANNUR, KERALA, INDIA 22-12-2013
2760 MALANKARA SOCIAL SERVICE SOCIETY SROTHAS ST MARY'S CAMPUS PATTOM P.O 1-11-2013
2761 MALHAR PRATISHTHAN MUMBAI SHRI DHANANJYA PRABHAKAR BEDADE 43, SECTOR-12, PLOT NO-4, ROAD NO-1 , OPP BSNL OFFICE, NEW PANVEL, TQ PANVEL DIST RAOGAD(MS) 22-6-2016
2762 MALIGAON DON BOSCO SCHOOL MALIGAON DON BOSCO TECHNICAL SCHOOL MALIGAON, GUWAHATI 27-6-2016
2763 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR 2-9-2016
2764 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR 5-9-2016
2765 MALLABHUM MANBHUM EDUCATIONAL TRUST 2A/13,ARYABHATTA ROAD,B-ZONE,DURGAPUR 5-9-2016
2766 MALTI DEVI HARIHAR PRASAD WELFARE SOCIETY 188/9A BAKSHIKALA, DARAGANJ, ALLAHABAD 5-2-2016
2767 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072 17-10-2016
2768 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAHE, BDA LAYOUT, BANGALORE 560072 11-5-2016
2769 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072 27-9-2016
2770 MAMATHA MAKKALA MANDIRA NO 02, 3RD MAIN, KALYANAGARA, NAGARBHAVI 1ST STAGE BDA LOYOUT, BANGALORE 560072 11-11-2016
2771 MANACLE TECHNOLOGIES PRIVATE LIMITED 198/2,RAMESH MARKET, OPPOSITE SAPNA CINEMA,EAST OF KAILASH 21-10-2014
2772 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAYI BAZAR KHAGA FATEHPUR 10-12-2015
2773 MANAGER ANGLO SANSKRIT COLLEGE CHANDRA PRABHA HOUSE NAI BAZAR KHAGA FATEHPUR 7-1-2016
2774 MANA JANA GARAMODYOG VIKAS SEVA SAMITI VILLEGE:-BAHADURPUR , POST:- TAJPUR , DISTRICT:- SULTANPUR 5-9-2016
2775 MANASA SHIKSHANA SAMSTE C/O ADARSHA PRIVATE ITI, VIABHAVA LAXMI PARK, HANGAL ROAD HAVERI-581 110. KARNATAKA 19-8-2014
2776 MANAV ADHIKAR JAN KALYAN FOUNDATION AMBAPA NAGOUR 14-10-2015
2777 MANAV ADHIKAR JAN KALYAN FOUNDATION 3K 32 VAISHALI NAGAR, AJMER 2-3-2016
2778 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 Uravashi HOUSING SOCIETY, GORASKHANAGAR RTO CORNER MERI NASHIK 422004 27-5-2016
2779 MANAVATAVADI BAHU UDDESHIYA SANSTHA NASHIK F3 CHAMPAVATIKA APRTMENT, GORASKHANAGAR RTO CORNER MERI NASHIK 422004 30-5-2016
2780 MANAV CHARITIES #66,14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE 4-4-2016
2781 MANAV CHARITIES #66, 14TH MAIN, KAMMAGONDANAHALLI, JALAHALLI WEST, BANGALORE 26-4-2016
2782 MANAV MITRA Q NO. 207 SAMTACOLONY RAIPUR,C.G 6-10-2016
2783 MANAV PRAGATI SANSTHAN RAJGARH USMANABD COLONY, BEHIND NEW BUS STAND, CHURU (RAJASTHAN) 17-12-2013
2784 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI - 9-9-2016
2785 MANAV SEVAK EDUCATIONAL AND MEDICAL RESEARCH FOUND TRG CENTER - SHIVAI SAMAJ MANDIR, SHREE SHIVAI SEVA MANDAL, GOVINDJI KENI MARG, NEAR APNA BAZAR, BEHIND NEW BDD CHAWL NO. 10, NAIGAUM, DADAR EAST, MUMBAI 21-9-2016
2786 MANAV SEVA SANSTHAN VIKAS NAGAR, BARGADWA, GORAKHPUR 25-11-2014
2787 MANAV VIKAS EVAM SEWA SANSTHAN HOUSE NO-261, HIND NAGAR, KANPUR ROAD, LUCKNOW,UP 4-10-2013
2788 MANAV VIKAS SANSTHA F-5A, 2ND FLOOR, OPP. RELIANCE FRESH, METRO PILLAR NO. 97, NEW SANGANER ROAD, SODALA, JAIPUR 14-10-2015
2789 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, ASHA CHAMBERS, 3RD FLOOR, VENKATASWAMY RAJU ROAD, KUMARA PARK WEST , BANGALORE 7-9-2016
2790 MANDAMUS INFO KNOWLEDGE CONSULTANTS PVT LTD #2, 3RD FLOOR, ASHA CHAMBERS, VENKATASWAMY RAJU ROAD, NEAR BDA OFFICE, ABOVE CORPORATION BANK, KUMARA PARK WEST, BANGALORE 8-8-2016
2791 MANDSAUR SHIKSHA VIKAS UNNAYAN SAMITI R K COMPUTER EDUCATION CENTER NEAR ARYA SAMAJ SCHOOL . OPP CIVIL HOSPITEL DISTT MANDSAUR 10-2-2015
2792 MANGHI WELFARE SOCIETY NEAR PWD DIVISION OFFICE, SANGRAM TOWN, POS/PS SANGRAM, DISTT KURUNG KUMEY, ARUNACHAL PRADESH 29-12-2016
2793 MANINDRANATH BANERJEE MEMORIAL SOCIETY CITY TOWER, 2ND FLOOR, KUMARPUR, G. T. ROAD, (OPP. KUMARPUR KALI MANDIR), ASANSOL-4, DIST. - BURDWAN, WEST BENGAL 5-2-2015
2794 MANIPAL CITY AND GUILDS SKILLS TRAINING PVT LTD NO 117, 27TH MAIN 2ND SECTOR HSR LAYOUT NEXT TO NIFT COLLEGE BANGALORE 3-4-2014
2795 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 15-6-2016
2796 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M K MARG, BORIVALI WEST, MUMBAI 400091 29-6-2016
2797 MAN MANAGEMENT SERVICES PRIVATE LIMITED ABHAY APARTMENT, B 303, PANDIT M.K. MARG, BORIVALI WEST, MUMBAI - 400091 26-7-2016
2798 MANMUKH EDUCATION CONSULTANCY #3,JAYANTI COMPLEX , NEAR GHANDHINAGAR CLUB , KANKE ROAD , RANCHI 4-9-2014
2799 MANNAN DEVI SAMAJ SEWA SANSTHAN VILLAGE AND POST - SIKTA 17-4-2014
2800 MANORAMA EDUCATION AND WELFARE SOCIETY 1ST FLOOR HOUSING BOARD BUILDING,IN FRONT OF SUBHASH NAGAR RAILWAY CROSSING,OLD SUBHASH NAGAR BHOPAL 14-10-2016
2801 MANOVIKAS CHARITABLE SOCIETY 60A, RADHEY PURI EXTENSION - 1, SWAMI DAYANAD MARG, DELHI 15-9-2015
2802 MANPOWERGROUP SERVICES INDIA PVT LTD 1ST FLOOR,BUILDING 10-B, DLF CYBER CITY 20-9-2016
2803 MANS ACTUAL SERVICE SOCIETY SANGAIYUMPHAM PART-I, PO WANGJING 20-1-2016
2804 MANTHAN GRAMIN EVAM SAMAJ SEVA SAMITI 31, SECTOR-1, SHAKTI NAGAR, BHOPAL 4-10-2013
2805 MANTRA EDUCATIONAL AND CHARITABLE SOCIETY BEHIND BENIWAL HOSPITAL , TOWN -JUNCTION ROAD , HANUMANGARH JN. 20-7-2016
2806 MANTRA SHIKSHAN PRASHIKSHAN SEVA SAMITI SKILL MANTRA VOCATIONAL TRAINING PROVIDER NEW BUS STAND PENDRA BILASPUR CHHATTISGARH 9-12-2016
2807 MANUEL MEMORIAL CHARITABLE TRUST NO-9, PRASANNA VINAYAGAR KOVIL STREET, PALAYAMKOTTAI TIRUNELVELI DISTRICT, TAMILNADU 11-9-2015
2808 MANYAWAR KANSHI RAM COMPUTER SEWA SANSTHAN VILALGE AND POST DANDUPUR TAHSIL AKBARPUR DISTT AMBEDKAR NAGAR 11-9-2015
2809 MAPLE COMPUTER AND COMMUNICATION PRIVATE LIMITED MAPLE HOUSE, A-44, KHARAVEL NAGAR, JANPATH, BHUBANESWAR, DISTRICT - KHURDA, ODISHA 13-9-2015
2810 MARATWADA KRUSHIPASHUSAVARDHAN VIKAS SANSHODHAN V MARATWADA KRUSHI,PASHUSAVARDHAN VIKAS SANSHODHAN VIDNYAN MANDAL, AT CHANDGAON POST POTHRA TQ. DIST BEED. 28-9-2015
2811 MARG 5-89-24 3RD LINE LAXMIPURAM GUNTUR ANDHRAPRADESH 5-9-2016
2812 MARG D.NO:5-89-24 3RD LINE LAKSHMIPURAM GUNTUR ANDHRA PRADESH 5-10-2016
2813 MARG COMPUSOFT PVT LTD MARG COMPUSOFT PVT LTD,F-6,PLOT NO-12/78,70-77,FIRST FLOOR,ROSHANARA PLAZA,ROSHANARA ROAD,DELHI 14-10-2015
2814 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW 14-9-2016
2815 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH PIN: 226019 21-9-2016
2816 MARGDARSHAK DEVELOPMENT PROJECTSCONSULTING PVT LTD PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW DISTRICT: LUCKNOW STATE: UTTAR PRADESH 19-9-2016
2817 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019 17-9-2015
2818 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019 3-9-2015
2819 MARGDARSHAK FINANCIAL SERVICES LIMITED PLOT NO.118, DAYAL FARMS, GANESHPUR -REHMANPUR, CHINHAT, DEVA ROAD, LUCKNOW -226019 9-9-2015
2820 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD OFFICE NO-11, 2ND FLOOR, NEW PLAZA MARKET, OLD DELHI, GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON. 27-6-2016
2821 MARGDARSHAN MANAGEMENT AND MEASUREMENT PVT LTD 11,2ND FLOOR, NEW PLAZA MARKET, OLD DELHI GURGAON ROAD, OPP. ICICI BANK, SEC-14, GURGAON-HARYANA 17-5-2016
2822 MARINE INFRA REPRESENTED BY MR SANJEEV GUPTA #23-23-12,SIVALAYAM TEMPLE WARD STREET,BEACH ROAD,OLD TOWN,VISAKHAPATNAM 12-11-2014
2823 MARKAZUL MAARIF MARKAZ ROAD, MADANI NAGAR, HOJAI, DISTT. NAGAON, ASSAM 21-11-2013
2824 MARKET MATTERS P LTD 410 MY HOME TYCOON KUNADANBAGH HYD-16 25-8-2014
2825 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, AT - DEMOTAND, POST - MORANGI, DISTRICT - HAZARIBAG, JHARKHAND 6-1-2016
2826 MARKSMAN WELFARE SOCIETY MARKSMAN CAMPUS, DEMOTAND, POST-MORANGI, DIST-HAZARIBAG PH. 06546 233045, MOBILE NO. 9798709920, EMAIL: MWS.HZB@GMAIL.COM 23-2-2016
2827 MARLIN EDUCATIONAL TRUST 8-2-18, SRIRAM NAGAR, TRICHY MAIN ROAD, KOTTAIYUR, KARAIKUDI, SIVAGANGAI 17-9-2015
2828 MARTHANDAM INTEGRATED DEVELOPMENT SOCIETY MIDS OFFICE,EDAIVILAGOM,KAZHUVANTHITTAI,KUZHITHURAI P.O,KANNIYAKUMARI DT ,TAMILNADU 28-10-2016
2829 MARTINA BIO GENICS PRIVATE LIMITED 78, KALITALA ROAD, 2ND FLOOR, KALIKAPUR KOLKATA 3-1-2014
2830 MARUDHARA ACADEMY 24, FRIENDS COLONY LAL KOTHI 4-8-2016
2831 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST 50,THEPPAKULAM SECOND STREET, SRIRANGAM, TRICHY. 28-7-2016
2832 MARUTHAMBAL EDUCATIONAL AND CHARITABLE TRUST NO 50,THEPPAKULAM 2ND STREET,SRIRANGAM. 23-6-2016
2833 MASCOT INSTITUTE OF INFORMATION AND TECHNOLOGY PLOT NO-346/1,SRI KRISHNA COLONY,AASHAPUR,SARNATH, VARANASI 15-9-2015
2834 MASS INFOTECH SOCIETY 525, DARSHAN LANE, BEHIND SANTPURA, YAMUNA NAGAR 4-10-2013
2835 MAS SOLAR SYSTEMS PRIVATE LIMITED 153, SIDCO INDUSTRIAL ESTATE, MALUMICHAMPATTI - POST, COIMBATORE, TAMIL NADU, INDIA. 4-12-2014
2836 MASTERGUARD PROTECTIVE SERVICES PVT LTD B-1, 63/64, 1ST FLOOR, INDIRA CHOWK, NEW KONDLI, DELHI 13-11-2013
2837 MASTERJI EDUCATIONAL SOCIETY H.NO:- 7-8-834, HUNTER ROAD, HANAMKONDA, WARANGAL-506001, TELANGANA 10-2-2015
2838 MASTERS ITC AALISSERY, SOUTH OF COLLECTORATE, ALAPPUZHA DIST., ALAPPUZHA. 14-9-2015
2839 MASTERS TRUST 10D/11, 5TH NORTH STREET, SOR NAGAR, USILAMPATTI. 11-9-2015
2840 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE 17-9-2015
2841 MATHA EDUCATIONAL TRUST 1.MATHA NAGAR, MARUTHY NAGAR EXTN VELLORE 14-10-2015
2842 MATHA EDUCATION AND RURAL DEVELOPMENT ASSOCIATION SRI VARADHADRI COMPUTERS KANCHIPURA HOSADURGA TALLUK 14-3-2016
2843 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOEROOM MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED ,TQ .GANGAKHED.DIST.PARBHANI 5-9-2016
2844 MATOSHRI SEVA PRATISHTHAN NEAR HERO SHOWROOM,MAHARANA PRATAP CHOCK PARLI ROAD GANGAKHED.TQ GANGAKHED.DIST.PARBHANI 431514 11-8-2016
2845 MATOSHRI SEVA PRATISHTHAN MAHARANA PARTAP CHOCK ,PARLI NAKA GANGAKHED TQ GANGAKHED DIST PARBHANI 431514 20-7-2016
2846 MATRIX CLOTHING PRIVATE LIMITED VILLAGE - MOHAMMADPUR, KHANDSA ROAD,GURGAON, HARYANA, INDIA. 22-12-2013
2847 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARH BASS ROAD KHAIRTHAL ALWAR RAJASTHAN 29-12-2016
2848 MATSYA EDUCATIONAL AND RURAL DEVELOPMENT TRUST STAR PUBLIC SCHOOL KISHANGARHBAS ROAD KHAIRTHAL 23-12-2016
2849 MAULANA ABDUR RAHIM EDUCATIONAL TRUST 1617,KHEJRON KA RASTA, NEAR INDIRA BAZAR, JAIPUR 17-4-2015
2850 MAULI SARVANGIN GRAMIN VIKAS SAMITI AT.PO.WADEGAON,TH.PANDHURNA,DIST-CHHINDWARA M.P.CONTACT TO RAJU WARUDKAR MOB.NO-9575374793 26-7-2016
2851 MAVERICKS HEALTHCARE PRIVATE LIMITED C/O LIFELINE HOSPITAL, GILL ROAD, LUDHIANA 3-3-2015
2852 MAVIN INFOTECH 304 BHANU ARCADE BESIDE HITECH THEARTRE,MADHAPUR,HYDERABAD TS 500081 10-11-2014
2853 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD 14-3-2016
2854 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD 8-4-2016
2855 MAX EDUCATIONAL WELFARE FOUNDATION MAX EDUCATIONAL WELFARE FOUNDATION C/O SANJIV CHOUBAY20,BENI CHOUDHARY (OFF) EXCELNET JAMNI CHORAHA LAL ROAD 17-5-2016
2856 MAX VIGIL SECURITY PVT LTD 42, ASTHA AVENUE, OPP RTO , SUBHASH BRIDGE CIRCLE, AHMEDABAD 22-12-2013
2857 MBD ALCHEMIE PVT LTD MBD ALCHEMIE 6 GULAB BHAWAN ITO BSZ MARG NEW DELHI 21-1-2015
2858 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA 8-1-2016
2859 M B HOSPITALITY SERVICES PRIVATE LIMITED PLOT NO-1573/2568, JAGANNATH NAGAR, MAIN ROAD, JHARPADA, BHUBANESWAR, ODISHA 23-2-2016
2860 M B KUNHIKANNAN NAIR MEMORIAL CHARITABLE TRUST KOLACHERY MUKKU KOLACHERY P O KANNUR DIST. KERALA 17-9-2015
2861 MBMSEWASANSTHAN 117/N/05 MBM HOUSE RANIGANJ KAKADEO KANPUR 24-11-2013
2862 MBS INFORMATION TECHNOLOGIES #40-1-149, I FLOOR, SIDDHARDHA MAHILA KALASALA ROAD LABBIPET, MG ROAD 17-5-2016
2863 MCONS MEDIA MARKETING PRIVATE LIMITED 327-328, ANGEL CORPORATE PLAZA, ANGEL MEGA MALL, KAUSHAMBI, SEC-14, GHAZIABAD 7-10-2016
2864 MCTECHINDUSTRIAL SCHOOL K.M.PATTANAM,ANGALAKURUCHI(PO),POLLACHI,COIMBATORE. 5-1-2016
2865 MD INFOSYSTEMS PRIVATE LIMITED 4,EAST PARK ROAD,1ST FLOOR,NEAR NEW ROHTAK ROAD 17-5-2016
2866 MD INFOSYSTEMS PVT LTD 4, EAST PARK ROAD, SIDDIPURA, NEAR NEW ROHTAK ROAD, KAROL BAGH NEW DELHI 16-6-2016
2867 MD ISMAIL MEMO EDU MEDICAL AND CHARITABLE TRUST NO. 100, BAZZAR STREET, OPP. GOVT. GIRLS.HR.SEC. SCHOOL. VANDAVASI T.V.MALAI DT 9-4-2015
2868 MECHEDA VIDYASAGAR TECHNICAL TRAINING SOCIETY BADABAHALA, KOLAGHAT, PURBO MEDINIPUR, WEST BENGAL. 5-9-2016
2869 MECHOZ EDUTECH MECHOZ EDUTECH, AT-JYOSHNAPURI LANE, LUCHAPADA ROAD, BERHAMPUR, GANJAM 22-11-2016
2870 MEDHA HOUSE NO. 8/A, ROAD NO-12D, WEST ANANDPURI, WEST BORING CANAL ROAD, PATNA 24-4-2014
2871 MEDHA EDUCATIONAL TRUST 5B,DOCTOR CHATTERJEE BYE LANE,SERAMPORE 5-4-2016
2872 MEDHA EDUCATIONAL TRUST 7A,B.P.DEY STREET,SERAMPORE,HOOGHLY,WEST BENGAL 26-4-2016
2873 MEDIA FEATURES INDIA PRIVATE LIMITED 2ND FLOOR, PARAM TOWER, 11/5B PUSA ROAD 11-9-2015
2874 MEDICA SYNERGIE PRIVATE LIMITED C 162, SURVEY PARK. KOLKATA 25-11-2014
2875 MEDRC EDUTECH LIMITED 3RD FLOOR, TSR TOWERS, 6-3-1090, RAJBHAVAN ROAD, SOMAJIGUDA, HYDERABAD, 11-11-2013
2876 MEDVARSITY ONLINE LIMITED LIFE SCIENCES BUILDING, APOLLO HOSPITALS COMPLEX, FILM NAGAR, HYDERABAD. 10-1-2014
2877 MEENABAIKAWALE BAHUUDDESHIYA SEVABHAVI SANSTHA SHIVAJI NAGAR PARTUR TQ. PARTUR DIST JALNA 8-11-2016
2878 MEENAKSHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ SHANTI KUNJ COLONY NEAR SURVITE SCHOOL ITI ROAD HOSHANGABAD 14-10-2016
2879 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE: INDRAPURI, KAURIHAR CHOWK, WARD NO. 19, RAXAUL, EAST CHAMPARAN - 845305, BIHAR 6-4-2016
2880 MEERA SHUKHALA LOK SEVA KENDRA HEAD OFFICE INDRAPURI, KAURIHAR CHOWK, WARD NO 18 RAXAUL 845305 EAST CHAMPARAN BIHAR 29-2-2016
2881 MEGA CABS PRIVATE LIMITED 261, GROUND FLOOR, OKHLA INDUSTRIAL ESTATE, NEW DELHI-110020 24-5-2016
2882 MEGA CABS PRIVATE LIMITED MEGA CABS PVT LTD. PLOT NO 261, OKHLA INDUSTRIAL ESTATE PHASE 3. NEW DELHI 17-5-2016
2883 MEGA INDUSTRIES MEGA INDUSTRIES KANDANISSERY PANCHAYATH MATTOM PO MATTOM - KOONAMOOCHI ROAD THRISSUR - KERALA 3-4-2014
2884 MEGA INTERNATIONAL SARASWATI LANE,LOHANIPUR,KADAMKUAN,PATNA 7-5-2014
2885 MEGA LIVING FOUNDATION 302, BEHIND HUDA COMPLEX, SWARGA NIVAS ENCLAVE, OPP PRIME HOSPITAL LANE, MAITHRIVANAM, AMEERPET, HYDERABAD, TELANGANA 21-12-2015
2886 MEGA LIVING FOUNDATION #6-1-585/B/45, MARUTHI NAGAR, KHAIRTABAD, HYDERABAD 500004, TELANGANA 14-9-2015
2887 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPARGANJ, INDUSTRIAL AREA DELHI-110092 2-6-2016
2888 MEGA MINND BOOKS INDIA PRIVATE LIMITED 301, PATPAR GANJ,INDUSTRIAL AREA, DELHI-110092 30-5-2016
2889 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS,GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR-54 , GURGAON ,SHIV KUMAR YADAV - 08173005335 12-1-2016
2890 MEGHA VINCOM PRIVATE LIMITED OFFICE NO-333,LODHA COMPLEX,SHASTRI CIRCLE UDAIPUR, 10-2-2016
2891 MEGHA VINCOM PRIVATE LIMITED THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335 15-1-2016
2892 MEGHA VINCOM PVT LTD THE PALM SPRINGS , GOLF COURSE ROAD , OPP. HOTEL IBIS , SECTOR - 54 , GURGAON , SHIV KUMAR YADAV - 08173005335 29-1-2016
2893 MEHER SOFTWARE SOLUTIONS 2FLOOR, GEETHANJALI COMPLEX, RAMAGIRI, NALGONDA, ANDHRA PRADESH. INDIA 15-4-2014
2894 MEHMUDA SHIKSHAN MAHILA GRAMIN VIKAS BAHU SANSTHA AHMED COMPLEX, 690, GOLCHHA BAZAR, SADAR, NAGPUR-01 10-7-2015
2895 MEHNDI HASAN WASI HASAN COMPUTER EDUCATION SOCIETY REGTD. OFFICE: 24-AAMGHAT, NEW COLONY, GHAZIPUR (UP) PIN-233001 12-1-2016
2896 MEHTAB COMPUTER SOCIETY MEHTAB COMPUTER, KC ROAD, ST. NO. 1, BARNALA, 148101 21-12-2016
2897 MEHTA INSTITUTE OF CAREER TRAINING PRIVATE LIMITED NO 6 V R MAYOR RAMANATHAN ROAD EAST SPUR TANK ROAD, CHETPET, CHENNAI 17-9-2015
2898 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR V R RAMANATHAN ROAD, (EAST SPUR TANK ROAD), CHETPET, CHENNAI 28-12-2015
2899 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD (EAST SPURTANK ROAD) CHETPET, CHENNAI 12-1-2016
2900 MEHTA INSTITUTE OF CAREER TRAINING PVT LTD NO 6, MAYOR VR RAMANATHAN ROAD CHETPET CHENNAI 11-1-2016
2901 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE TAMIL NADU CHENNAI 4-4-2016
2902 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLICANE CHENNAI 2-3-2016
2903 MEIYUR AGRICULTURAL TRAINING PRIVATE LIMITED NEW NO 43 OLD NO 20 IRUSAPPA STREET TRIPLIACNE CHENNAO 600005 14-3-2016
2904 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO.43, OLD NO.20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI-600005. 16-11-2016
2905 MEIYUR EDUCATION AND SKILL DEVELOPMENT PVT LTD NEW NO:43, OLD NO:20, IRUSAPPA GRAMINI STREET, TRIPLICANE, CHENNAI 30-11-2016
2906 MELANGE CLUB PRIVATE LIMITED S.F.#314,315, PERUNDURAI ROAD 20-1-2016
2907 MERAPATH EDUCATION LIMITED B-18/B ,FIRST FLOOR OPP. METRO PILLAR NO.- 174, MAIN ROAD SHASTRI NAGAR, SUBHADRA COLONY, NEW DELHI-110035 6-1-2016
2908 MERAPATH EDUCATION LIMITED E-2/230B, FIRST FLOOR, OPP. METRO PILLAR NO-173 ,MAIN ROAD SHASTRI NAGAR, NEW DELHI-110052 8-4-2016
2909 MERIT RESEARCH SOCIETY AKHAURA ROAD, AGARTALA, TRIPURA WEST 26-4-2016
2910 MERITUDE SKILL DEVELOPMENT PRIVATE LIMITED OPP. ASHAPRABHU HOSPITAL, YELLAPUR ROAD, SIRSI, KARNATAKA 28-12-2016
2911 MESIAH ST.PAULS INDUSTRIAL TRAINING CENTRE BYE PASS ROAD, POOVALUR, LALGUDI TALUK TRICHIRAPPALLI-621712 14-9-2015
2912 MESSRS M J SOLANKI C - 603 A, GANESH MERIDIAN, OPP. KARGIL PETROL PUMP, NEAR SOLA FLY OVER, SG HIGHWAY, SOLA, AHMEDABAD (GUJARAT) 26-7-2016
2913 METAL TECH CONSTRUCTIONS PRIVATE LIMITED 171,172,MAHAVISHNU NAGAR, PONY-THINDIVANAM NH ROAD,PATTANUR,AUROVILE-POST,VILLUPURAM DIST, TAMILNADU. 14-9-2015
2914 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI 5-12-2016
2915 METIS EDUVENTURES PRIVATE LIMITED METIS EDUVENTURES PRIVATE LIMITED, 705, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI 30-11-2016
2916 METIS EDUVENTURES PRIVATE LIMITED 705-706, ROOTS TOWER, LAXMI NAGAR DISTRICT CENTRE, DELHI 9-12-2016
2917 METRO SOCIAL AND EDUCATIONAL TRUST SHOP NO 5 BESIDE MALLESHWARA COMPLEX PRASHANTHI NAGAR KOPPAL ROAD. GANGAVTHI 11-8-2016
2918 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN 5-4-2016
2919 MEWAR UNIVERSITY MEWAR UNIVERSITY NH-79, GANGRAR, CHITTORGARH, RAJASTHAN 11-1-2016
2920 MEWAR UNIVERSITY NH - 79 GANGRAR, CHITTORGARH, RAJASTHAN-312 901 14-9-2015
2921 MG CAREER PARK A UNIT OF MG TECHNO SAVVY PVT LTD C-58, N.K TOWER, LALKOTHI SCHEME ,JAIPUR ( RAJASTHAN) 17-12-2013
2922 M H W H COMPUTER EDUCATION SOCIETY 24 AAMGHAT NEW COLONY GHAZIPUR 12-9-2015
2923 MICA EDUCATIONAL COMPANY PRIVATE LIMITED OPP. RANCHI CLUB GATE, 2ND FLOOR, GANGA APARTMENT, SETHIA COMPOUND, 5 MAIN ROAD, RANCHI 25-11-2014
2924 MICRONET 5706-07, FF, NEAR AIRTEL SHOWROOM, MALL ROAD, BATHINDA 20-1-2015
2925 MICROTEK EDUCATIONAL SOCIETY 1ST FLOOR, NIRMAL COMPLEX, MALDAHIYA, VARANASI, UTTAR PRADESH 30-11-2015
2926 MICROTEK EDUCATIONAL SOCIETYF C 27/279 A-2, NIRMAL COMPLEX, 1ST FLOOR, MALDAHIYA, VARANASI 30-12-2015
2927 M I EDUCATIONAL AND CHARITABLE TRUST 34A,SLB SCHOOL SOUTH ROAD, NAGERCOIL 8-9-2014
2928 MIE EDUCATIONAL SERVICES PVT LTD #M-39, 1ST & 2ND FLOOR, OLD DLF COLONY, SEC-14, GURGAON 7-1-2015
2929 MILESTONE PLM SOLUTIONS PVT LTD 507 PARADISE TOWER. GOKHALE ROAD. THANE (W) 17-10-2016
2930 MILLI EDUCATIONAL WELFARE SOCIETY JANTA HAT, KANHAIYABARI, KISHANGANJ, BIHAR - 855107 12-9-2015
2931 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI 24-6-2016
2932 MILLION MINDS MANAGEMENT SERVICES LIMITED A-1,ACHARAYA NIKETAN, MAYUR VIHAR PHASE 1, DELHI 24-6-2016
2933 MINDAIDE CONSULTING PRIVATE LTD 102, SMR VINAY VATIKA APARTMENTS NAGANNAPALYA ROAD, MARUTHI SEVA NAGAR, BANGALORE - 560033, KARNATAKA INDIA. 560033 21-7-2014
2934 MIND INDIA 187, MANIRAM DEWAN ROAD, INSIDE HOTEL ALANKAR CAMPUS, CHANDMARI, GUWAHATI 27-5-2016
2935 MIND Q SYSTEMS PRIVATE LIMITED 8-3-214/7, 1ST FLOOR, ABOVE HDFC BANK LTD, SRINIVAS NAGAR COLONY (WEST), SANJEEVA REDDY NAGAR, HYDERABAD, ANDHRA PRADESH 14-9-2015
2936 MIND SHARPER ACADEMY PRIVATE LIMITED 1/8C, PURI STREET NO. 1, NEAR JM CONVENT SCHOOL MAUJPUR 17-5-2016
2937 MINERVA EDUCATIONAL AND WELFARE SOCIETY 232 MAHISBATHAN . SALTLAKE CITY. SECTOR- V KOLKATA 700102 8-1-2016
2938 MINERVA POLYTECHNIC AMRITAKUNDA,NABAGRAM,MURSHIDABAD,WEST BENGAL,PIN-742136 22-8-2016
2939 MINIKASHI MAHAMAYA JANKALYAN SAMITI INDAR SHANTA KUNJ II, SHANTI KUNJ COLONY ITI ROAD HOSHANGABAD M.P 13-7-2016
2940 MIRACEL VOLUNTARY ORGANIZATION 3-322, S.R.R COMPLEX, IT MASTER COMPUTERS BHUPALPALLY, WARANGAL-TELANGANA-506169 18-9-2015
2941 MIRACLE A VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX IT MASTER COMPUTERS MAIN ROAD, BHUPALPALLY WARANGAL 11-9-2015
2942 MIRACLE VOLUNTARY ORGANIZATION MIRACLE VOLUNTARY ORGANIZATION 3-322,S.R.R COMPLEX MAIN ROAD, BHUPALPALLY WARANGAL(DIST)-TELANGANA 28-9-2015
2943 MISSION TOWN PLANNING COLONY, DHENKANAL RS, DHENKANAL,ODISHA. 3-1-2014
2944 MITCON CONSULTANCY AND ENGINEERING SERVICES LTD S. NO. 33/1, OPP. CHHATRAPATI SHIVAJI SPORTS COMPLEX, BALEWADI, PUNE 16-9-2015
2945 MITKAT ADVISORY SERVICES PVT LTD 1/ 47, EVERSHINE MALL, MINDSPACE, MALAD (W), MUMBAI - 400 064, INDIA MOBILE +91 98334 15676; E-MAIL : CONTACT@MITKATADVISORY.COM TELEPHONE: +91 22 4021 1904 11-2-2014
2946 MMC COMPUTERS S.c.o:66-67, Sector-8-c, Madhya Marg 10-11-2014
2947 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR NAHARLAGUN 11-11-2016
2948 M M CHARITABLE TRUST DR. LUMAR DAI ROAD, PREM NAGAR, NAHARLAGUN 9-12-2016
2949 M M GROUP MRS BUILDING 3RD FLOOR DCR MARKET , P.O:- MALDA,P.S : ENGLISHBAZAR, PIN : 732101 , DIST : MALDA 16-5-2014
2950 MNRMMGGFC TRUST POSTAL ADRESS-2/405, VIDYADHAR NAGAR, JAIPUR, RAJASTHAN. REGISTER ADDRESS- INTERNATIONAL COLONY, NEEM KA THANA, SIKAR, RAJASTHAN 23-12-2013
2951 MODELAMA EXPORTS LIMITED PLOT NO. 184, PLATINUM TOWER, UDYOG VIHAR PHASE -I 5-9-2014
2952 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016 5-2-2016
2953 MODELAMA SKILLS PRIVATE LIMITED 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE -1, GURGAON -122016 8-6-2016
2954 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLATINUM TOWER, PLOT NO. 184, UDYOG VIHAR PHASE -1, GURGAON -122016 28-1-2016
2955 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, PLOT NO. 184,PLATINUM TOWER, UDYOG VIHAR PHASE 1, GURGAON -122016 11-1-2016
2956 MODELAMA SKILLS PRIVATE LIMITED PLOT NO. 184, PLATINUM TOWER, 4TH FLOOR, UDYOG VIHAR PHASE 1, GURGAON - 122016 14-7-2016
2957 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR,184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016 15-1-2016
2958 MODELAMA SKILLS PRIVATE LIMITED 4TH FLOOR, 184, PLATINUM TOWER, UDYOG VIHAR PHASE -1, GURGAON -122016 12-1-2016
2959 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B-BLOCK, PHASE-III, PREMNAGAR, NAJAFGARH, NEW DELHI 26-8-2016
2960 MODEL RURAL YOUTH DEVELOPMENT ORAGNISATION 81-A, B- BLOCK. PHASE-III PREM NAGAR, NAJAFGARH, NEW DELHI 22-7-2016
2961 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR S.D.CHATTERJEE ROAD, KOLKATA - 700144, SOUTH 24 PGS , WEST BENGAL 14-10-2015
2962 MODERN ACADEMY OF ADVANCED TRAINING AND STUDIES BARUIPUR, S.D.CHATTERJEE ROAD,KOLKATA- 700144 13-9-2015
2963 MODERN COMPUTER EDUCATION 1ST FLOOR, UDYOG BHAVAN, SHARADAPRANGAN, BHIGWAN CHOWK BARAMATI DIST- PUNE 28-10-2016
2964 MODERN COMPUTERS DODA NEAR SPORTS STADIUM DODA REHMAT ALAM COMPLEX 8-11-2016
2965 MODERN EDUCATIONAL AND SOCIAL SERVICE SOCIETY NO.92, KATCHERRY STREET, KATTUMANNARKOIL (POST & TALUK), CUDDALORE DISTRICT, TAMILNADU 10-11-2015
2966 MODERN EDUCATION SOCIETY MODERN EDUCATION SOCIETY, D-16, OM PARISAR STATION ROAD DURG, CHHATTISGARH 14-7-2014
2967 MODERN EDUCATION SOCIETY REGD.OFF:- VILL.MANDORA,DISTT-SONIPAT,HARYANA ADMN OFF:- H.NO.-241 ,GALI NO.-1 ,GOPALPUR ROAD ,KHARKHODA DISTT-SONIPAT 15-2-2014
2968 MODERN INSTITUTE OF INFORMATION TECHNOLOGY 2978, FIRST FLOOR, INSIDE GATE HAKIMAN, AMRITSAR 14-9-2015
2969 MODRIKA CONSULTING PRIVATE LIMITED 138, 3RD FLOOR, TOWER A, CORENTHUM CORPORATE, SECTOR-62, NOIDA 4-4-2016
2970 MOHAN SHIKSHA SAMITI MOHAN PUBLIC SCHOOL OPP.JAWAHAR NAGAR ,BHARATPUR 14-9-2015
2971 MOHENBARUAH FOUNDATION FURKATING JUNIOR COLLEGE, P.O. FURKATING, LACHIT NAGAR, DIST:- GOLAGHAT, ASSAM 5-8-2016
2972 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT,KARNATAKA STATE 21-12-2016
2973 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALUK, UDUPI DISTRICT, KARNATAKA STATE 14-12-2016
2974 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, MOODLAKATTE POST, KUNDAPURA TQ, UDUPI DIST 21-10-2016
2975 MOODLAKATTE NAGARATHNA BHUJANGA SHETTY TRUST MOODLAKATTE INSTITUTE OF TECHNOLOGY, KUNDAPURA TALLUK UDUPI DISTRICT, KARNATAKA STATE 23-11-2016
2976 MORD TEST ND 31-12-2016
2977 MORD TEST NEW DELHI ND 31-12-2016
2978 MORYA SAMAJIK PRATISHTHAN HERITAGE PLAZA WING NO 2 2ND FLOOR PIMPRI CHINCHWAD LINK ROAD IN FRONT OF MORYA HOSPITAL CHINCHWADGAON PUNE 22-6-2016
2979 MOSAIC NETWORK INDIA PRIVATE LIMITED M-9 CORPORATE HOUSE, WING 'B' 169 R.N.T MARG 6-4-2016
2980 MOTHER KANCHAN COLLEGE OSMANABAD BARSHI NAKA OSMANABAD 29-12-2016
2981 MOTHER MARY EDUCATIONAL AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN, LIMBODI , KHANDWA ROAD, INDORE 11-9-2015
2982 MOTHER MARY EDUCATION AND SOCIAL WELFARE SOCIETY 117 RANI BAGH MAIN,KHANDWA ROAD,INDORE 14-3-2016
2983 MOTHER TERESA EDUCATIONAL AND WELFARE SOCIETY 2, KASTURBA PATH, NEAR JAMUNA APARTMENT, BORING ROAD, PATNA 21-1-2015
2984 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001 15-3-2016
2985 MOTHER TERESA EDUCATION FOUNDATION M-7, OLD DLF COLONY, SECTOR-14, GURGAON 16-2-2016
2986 MOTHER TERESA EDUCATION FOUNDATION M 7, GROUND FLOOR, OLD DLF, SEC 14 GURGAON-122001 2-3-2016
2987 MOTHER TERESA JAN KALYAN SAMITI 10, NAGAR PALIKA MARKET, RADHA ROAD CIVIL LINES RAMPUR UP 24-5-2016
2988 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGARPALIKA MARKET RAMPUR - UTTAR PRADESH 15-9-2015
2989 MOTHER TERESA JAN KALYAN SAMITI MOTHER TERESA JANKALYAN SAMITI 10, RADHA ROAD NAGAR PALIKA MARKET RAMPUR - UTTAR PRADESH 5-9-2016
2990 MOTHER TERESA REDCS 20 BRAHMIN STREET PALLIPAT 631207 13-9-2015
2991 MOTHER TERESA WELFARE TRUST S-27,CHANDRALOKMARKETCOMPLEX,NILADRIVIHAR,CHANDRASEKHARPUR,BHUBANESWAR 13-11-2014
2992 MOTHER THERESA WOMEN DEVELOPMENT TRUST NO.12 THIYAGI SHANMUGAM STREET, TINDIVANAM VILLUPURAM DISTRICT 4-8-2016
2993 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL. 14-9-2015
2994 MOTHER THERISA SEVA DEVELOPMENT SOCIETY H.NO-28/1110, NEAR GOVT. HOSPITAL, NANDYAL, KURNOOL (DIST), ANDHRA PRADESH 18-9-2015
2995 MOTHER TREE TRUST 325/18, 3RD FLOOR, THAMBU CHETTY STREET, MANNADY 8-1-2016
2996 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR – 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI - 400104 3-3-2016
2997 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104 26-4-2016
2998 MOTOR EDUCATION AND TRAINING ASSOCIATION PVT LTD 283/2243, MOTILAL NAGAR 1, VIBGYOR HIGH SCHOOL LANE, GOREGAON (WEST), MUMBAI 400104 17-5-2016
2999 MOUNTTALENT CONSULTING PVT LTD A-22 2ND FLOOR,SECTOR-4,NOIDA-201301 26-2-2016
3000 MOUSUMI CHARITABLE AND EDUCATIONAL TRUST C/O- INSTITUTE OF INFORMATION STUDIES 86/A,3RD FLOOR,SAHID NAGAR,BHUBANESWAR, INFRONT OF UNIVERSITY LAW COLLEGE 30-1-2014
3001 MOVEMENT VOLUNTARY ORGANISATION MIG - 69, APHB COLONY, BHONGIR, NALGONDA 5-11-2013
3002 MPCON LIMITED BLOCK-II, 3RD FLOOR, PARYAWAS BHAWAN, ARERA HILLS, BHOPAL 3-10-2013
3003 MPTA EDUCATION LTD 2ND FLOOR, KUNAL PLAZA, NEAR CHINCHWAD RAILWAY STATION, CHINCHWAD, PUNE 13-11-2013
3004 MS ANGELS PLOT NO-889 , MADHUSUDAN NAGAR , NEAR THE WORLD UNIT-4 23-11-2016
3005 M S E SOLUTIONS PVT LTD MIG 1 ,SAI KRIPA STORE, INDRA COMPLEX VIDISHA 13-9-2015
3006 M S INSTITUTE OF EDUCATION PRIVATE LIMITED WZ-30, 1ST FLOOR, VASHISHTH PARK, PANKHA ROAD, SAGARPUR CHOWK, NEW DELHI 25-8-2015
3007 MS KALINGA SOFTWARE PRIVATE LIMITED PLOT NO-L-3/76,ACHARYA VIHAR,BHUBANESWAR. 11-1-2016
3008 MSM ITI MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 21-6-2016
3009 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM ERNAKULAM KERALA 24-5-2016
3010 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 19-5-2016
3011 MSM ITI PIRAVOM MSM ITI PIRAVOM HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 686664 5-1-2016
3012 MSM ITI PIRAVOM MSM ITI PIRAVOM PIRAVOM P.O ERNAKULAM KERALA 15-3-2016
3013 MSM ITI PIRAVOM MSM ITI HOSPITAL JUNCTION PIRAVOM P.O ERNAKULAM KERALA 2-6-2016
3014 MS NATIONAL CONSTRUCTION VILL-RONTHOL, PO-BOROI, PS-HARISHCHANDRAPUR, DIST-MALDA, WEST BENGAL. 5-9-2016
3015 MSOURCE INDIA PRIVATE LIMITED 17, RACE COURSE ROAD, INDORE 3-4-2014
3016 MS SOFTWARE SOLUTIONS NO 4/2&3 VASAVI STREET ,R.K.COMPLES NEAR KVB BANK, HOSUR 4-6-2014
3017 M S SOLUTIONS SHIMULIAPARA, POST- CHANDPARA BAZAAR, PS- GAIGHATA, DIST- NORTH 24 PARGANAS, WEST BENGAL 15-11-2016
3018 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR BEHIND ANJUSHREE INN HOTEL INDORE ROAD, UJJAIN MP 30-11-2015
3019 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN 4-8-2016
3020 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI VIHAR UJJAIN 23-5-2016
3021 MUDRA SOCIAL WELFARE SOCIETY SAMITI D-3/7 TRIVENI BIHAR 7-1-2016
3022 MULTICARE SERVICES INDIA PVT LTD B/2, ANAND NAGAR, SHITLADEVI TEMPLE ROAD, MAHIM (W), MUMBAI 400 016 18-7-2014
3023 MULTISOFT SYSTEMS TECHNOLOGY CONSULTANCY PVT LTD B 125, SEC 2, NOIDA 24-6-2015
3024 MUNIFICENT ANGELS NOWGAM BYPASS CHOWK SRINAGAR 14-9-2016
3025 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, 3RD FLOOR, DEVPATH COMPLEX, BEHIND LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA 12-1-2016
3026 MUNIMJI TRAINING AND PLACEMENT PRIVATE LIMITED 301, DEVPATH COMPLEX, B/H LAL BUNGLOW, OFF C.G.ROAD, NAVRANGPURA, AHMEDABAD, GUJARAT, INDIA 11-1-2016
3027 MURALI KRISHNA EDUCATIONAL SOCIETY 5-12-211/1,SRINIVASA COLONY, NALGONDA DIST, A.P. 17-4-2014
3028 MURSHIDABAD MANAB SAMAJ KALAYAN UNNAYAN SAMITY VILL- HASANPUR, PO-BHAGIRATHPUR, PS-DOMKRL, DIST-MURSHIDABAD, WEST BENGAL. 5-9-2016
3029 MUSKAN SANSTHAN CHOUBISA SAMAJ KA NOHRA, MOHALLA GHANTI, DUNGARPUR RAJASTHAN 13-9-2015
3030 MUSLIM EDUCATIONAL TRUST MUSLIM EDUCATIONAL TRUST, NADAPURAM. KALLACHI.P.O, CALICUT, KERALA 16-1-2017
3031 MUTHAMIL ARAKKATTALAI 126,SANDROR STREET, INDRA NAGAR, PULIANGUDI, TIRUNELVELI DIST., TAMIL NADU 28-9-2015
3032 MUTHAMIL TRUST 126 SANTOR STREET INDRA NAGAR PULIANGUDI 15-9-2015
3033 MYJ CIDORR MYRADA JAGRUTHI CENTER FOR INSTITUTIONAL DEVELOPMENT AND ORGANISATIONAL REFARMS AND RESEARCH, DAVANAGERE ROAD, HOLALKERE, CHITRADURGA DISTRICT, KARNATAKA 5-11-2013
3034 MYRADA CENTER FOR INSTITUTIONAL DEVELOPMENT AND ORGANISATIONAL REFORMS MYRADA CIDOR GULBARGA PRAKRUTHI GNYANA KENDRA TRAINING CENTER KAMALAPUR, RAJNAL ROAD KAMALAPUR - 585 313 TALUKA & DISTRICT. GULBARGA, KARNATAKA STATE. 22-1-2014
3035 MYSORE RESETTLEMENT AND DEVELOPMENT AGENCY NO.2, SERVICE ROAD, DOMLUR LAYOUT, BANGALORE 18-7-2014
3036 MYTHILIS HERBAL BEAUTY SCHOOL AND CLINIC 4 TH FLOOR NO 19 FATHIMA PLAZA, PONDY BAZAR T.NAGAR CHENNAI 18-7-2014
3037 NAANDI FOUNDATION 502, TRENDSET TOWERS, ROAD NO 2 BANJARA HILLS, HYDERABAD. 17-5-2016
3038 NABA DIGANTA EDUCATIONAL TRUST PLOT NO-1, SECTOR-B, PATIA, CHANDAKA NEUCLEOUS IND. COMPLEX 13-7-2016
3039 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA 11-8-2016
3040 NABA DIGANT EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR - 751024 ODISHA, INDIA 8-8-2016
3041 NABA GANTA EDUCATIONAL TRUST KOUSTUV TECHNICAL CAMPUS PLOT NO.1 (A), SECTOR - B CHANDAKA INDUSTRIAL COMPLEX PATIA, BHUBANESWAR 4-8-2016
3042 NABAPRAVAT TRUST PLOT NO. 540/1780, NILACHAL NAGAR (NEAR SIDHAR CHANDI TEMPLE & INFOCITY), PATHAR GADIA, PO - KIIT, BHUBANESWAR, KHORDHA, PIN - 751024 12-1-2016
3043 NAC INFRASTRUCTURE EQUIPMENT LTD IZZAT NAGAR NAC CAMPUS KONDAPUR HYDERABAD CYBERABAD 11-11-2016
3044 NACRE SOFTWARE SERVICES 7-1-212/A/69, PLOT NO 84, SHIVABAGH COLONY, AMEERPET 14-3-2016
3045 NAGALAND TOOL ROOM AND TRAINING CENTRE NEW INDUSTRIAL ESTATE, SUB-JAIL(TINALI), DIPHU ROAD -NH-36, DIMAPUR : NAGALAND. 12-9-2015
3046 NAGASAI OILS PRIVATE LIMITED DOOR NO 2-15-233 KOTA BAZAR NARASARAOPET 14-9-2015
3047 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO JHAJHAR 24-6-2016
3048 NAI DISHA EDUCATION SOCIETY RCM POLYTECHNIC CAMPUS VPO M P MAJRA TEHSIL BERI DISTT JHAJJAR HARYANA 30-6-2016
3049 NALANDA BAHUUDDESHIYA SHIKSHAN SANSTHA GEWARDHA C/O HATWAR COMPLEX SBI BANK ARMORI AT POST TA ARMORI DIST GADCHIROLI 23-2-2016
3050 NALANDA EDUCATIONAL SOCIETY G-2, MAHARASHI HOUSE, ROAD NO. 3, BANJARA HILLS, HYDRARABAD 4-3-2015
3051 NALANDA INSTITUTE FOR COMPUTER AND VOCATIONAL TRAINING PVT LTD 301-302, JUHI PLAZA, 128 KANCHAN BAGH ROAD, NEAR GEETA BHAWAN SQUARE. INDORE - MADHYA PRADESH 3-2-2014
3052 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR, NEAR SHIV MANDIR DURG 30-11-2016
3053 NAMITA COMPUTER EDUCATION SOCIETY KENDRIYA KARMCHARI NAGAR NEAR SHIV MANDIR DURG 18-11-2016
3054 NANTUBALA SAMANTA TECHNICAL INSTITUTE 40, B.C.ROAD, KANTA PUKUR LANE, RANIGANJ BAZAR, BURDWAN 14-3-2016
3055 NARASINGHAPUR NIBEDITA EDUCATIONAL S AND S WELFARE NARASINGHAPUR,SAGARPARA,DOMKAL, DIST: MURSHIDABAD 12-9-2016
3056 NARAYANA HRUDAYALAYA PRIVATE LIMITED #258/A BOMMASANDRA INDUSTRIAL AREA,HOSUR RAOD,BANGALORE 17-8-2015
3057 NARAYAN EDUCARE PRIVATE LIMITED AT-SALARPUR POST-SALARPUR P.S.-DANIYAWAN, DIST-PATNA 6-4-2016
3058 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001 22-7-2016
3059 NARAYAN SEWA SANSTHAN NARAYAN ASHRAM SEWA NAGAR MAIN CHOWK SATHIAON AZAMGARH UTTAR PRADESH-276406 CAMP OFFICE: SOHIT MARKET MAIN HIGHWAY NARAULI AZAMGARH UTTAR PRADESH-276001 24-5-2016
3060 NARESH I TECHNOLOGIES 2ND FLOOR, DURGA BHAVANI PLAZA, OPP SATYAM THEATRE, AMEERPET 6-4-2016
3061 NARI AND SISHU KALYAN SAMITTEE AT/PO; SERGARH DIST; BALASORE ODISHA 15-3-2016
3062 NARI AND SISHU KALYAN SAMITTEE AT:SERGARH PO; SERGARH PIN:756060 DIST: BALASOE 11-1-2016
3063 NARI SEWA SAMITI NARI SEWA SAMITI, RAJA NAWAB ALI ROAD, LUCKNOW 5-2-2015
3064 NARULA EDUCATIONAL TRUST 20 B.T. ROAD, PAIKPARA, KOLKATA, WEST BENGAL 14-9-2016
3065 NATARJAN TRUST 78, 7TH , CROSS STREET, MANGUDI, TIRUNELVLEI 6-4-2016
3066 NATIONAL ACADEMY OF CONSTRUCTION NAC CAMPUS,KONDAPUR POST,CYBERABAD, HYDERABAD, TELANGANA STATE 11-3-2015
3067 NATIONAL ACCOUNT AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOOR, 168 HEERA NAGAR, DCM, AJMER ROAD, JAIPUR, RAJASTHAN 28-9-2015
3068 NATIONAL ACCOUNTS AND COMPUTER EDUCATION BIDLA TOWER,3RD FLOR, 168 HEERA NAGAR, DCM, AJMER RAOD, JAIPUR, RAJASTHAN 14-3-2016
3069 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WEST BENGAL 12-1-2016
3070 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N.TAGORE ROAD, A.V. SCHOOL MORE, KRISHNAGAR, NADIA, WEST BENGAL. 6-1-2016
3071 NATIONAL COMPUTER SAKSHARTA MISSION 58 R.N. TAGORE ROAD, KRISHNANAGAR, NADIA, WB 15-1-2016
3072 NATIONAL COMPUTER SAKSHARTA MISSION E 83 STREET NO.11 MAIN BHARAT VIHAR ROAD RAJAPURI UTTAM NAGAR NEW DELHI 5-1-2016
3073 NATIONAL COUNCIL FOR CLIMATE CHANGE SUSTAINABLE DE PATEL BLOCK, RAJDEEP ELECTRONIC COMPOUND,NR. STADIUM CIRCLE,NAVRANGPURA,AHMEDABAD 22-4-2016
3074 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI 720-B, JAINA TOWER II, DISTRICT CENTER, JANAKPURI, 12-9-2015
3075 NATIONAL COUNCIL OF VOCATIONAL AND RESEARCH TRAINI IMRD CAMPUS, R.P. PUDUR, NAMAKKAL 11-9-2015
3076 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221, RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR 12-1-2016
3077 NATIONAL EDUCATIONAL SOCIAL WELFARE TRUST 1221 RAJAJI NAGAR SECOND EXTENSION MEDICAL COLLEGE ROAD THANJAVUR 10-2-2016
3078 NATIONAL EDUCATIONAL SOCIETY 92, STATION ROAD, PURDILPUR, GORAKHPUR 13-11-2014
3079 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR, HANSI 4-1-2016
3080 NATIONAL EDUCATION SOCIETY MAIN BARWALA ROAD, VIRAT NAGAR,HANSI,DISTRICT HISAR,HARYANA 14-9-2015
3081 NATIONAL ENVIRONMENT EDUCATION DEVELOPMENT NEED JEYPORE ROAD, NEAR HDFC BANK, SALUR, VIZIANAGARAM DIST, ANDHRA PRADESH 17-9-2015
3082 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS 3-A, PRIVATE OPPOSITE CHURCH, GANDHI NAGAR, JAMMU - 180004 (JAMMU AND KASHMIR) 10-11-2015
3083 NATIONAL INSTITUTE FOR TECHNICAL TRAININGS TRUST NITTT 3-A, PVT. OPP. CHURCH GANDHI NAGAR JAMMU , JAMMU & KASHMIR 6-10-2016
3084 NATIONAL INSTITUTE FOR TECHNICAL TRANINGS NITT 3-A, PVT. OPP. CHURCH, GANDHI NAGAR, JAMMU 12-11-2014
3085 NATIONAL INSTITUTE OF COMPUTER APPLICATIONS AT MINING SCHOOL ROAD, SPECIAL PLANNING CAMPUS, PO KEONJHAR, ODISHA 11-5-2016
3086 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY 373/A PIRTALA ROAD, NEAR BUSTAND, PO-KANDI,PS-KANDI, DIST-MURSHIDABAD,W.B, PIN-742137, M-9434433225 5-1-2016
3087 NATIONAL INSTITUTE OF COMPUTER E LEARNING ACADEMY COLLEGE ROAD PO-AMTALA PS-NOWDA DIST-MURSHIDABAD 14-9-2015
3088 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR 13-1-2017
3089 NATIONAL INSTITUTE OF ELECTRONICS AND INFORMATION TECHNOLOGY SRINAGAR SIDCO ELECTRONICS COMPLEX, OLD AIRPORT ROAD, RANGRETH SRINAGAR J&K 5-1-2017
3090 NATIONAL INSTITUTE OF LIFE SKILLS 27-16-83, CONGRES OFFICE ROAD, OPP: ANDHRA RATNABHAVAN, GOVERNORPET, VIJAYAWADA, AMARAVARHI 17-1-2017
3091 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4, PINK TOWER, BEHIND SAHARA CHAMBER, TONK ROAD, JAIPUR-302015 23-2-2016
3092 NATIONAL INSTITUTE OF TECHNOLOGY AND MANAGEMENT B-4 PINK TOWER BEHIND SAHARA CHAMBER LAL KHOTI TONK ROAD JAIPUR(RAJASTHAN) 5-2-2016
3093 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, JAIN BUILDING, YAMUNANAGAR, HARYANA 5-1-2016
3094 NATIONAL PARAMEDICAL SCIENCES SOCIETY 2ND FLOOR, GURUKUL INSTITUTE, NEAR FOUNTAIN CHOWK,JAIN BUILDING,OPP.MEERA BAZAR,YAMUNANAGAR 15-9-2015
3095 NATIONAL SCHOOL OF MANAGEMENT STUDIES D C NACHAN ROAD,P.O.-KAMALPUR,P.S-DURGAPUR,DIST.BURDWAN,WEST BENGAL. 17-8-2016
3096 NATIONAL SCHOOL OF MANAGEMENT STUDIES DURGAPUR CHA NACHAN ROAD,PO-KAMALPUR,PS-DURGAPUR,DIST-BURDWAN, WEST BENGAL,PIN-713204 17-8-2016
3097 NATIONAL SKILLS FOUNDATION OF INDIA K-59, SOUTH CITY - 1, GURGAON 13-1-2014
3098 NATIONAL SOCIAL SOCIETY D-195 KP VASANT KUNJ NEW DELHI-110070 13-4-2016
3099 NATIONAL SOCIAL SOCIETY D-195 KUSUMPUR VASANT KUNJ NEW DELHI 26-4-2016
3100 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53, GRAMACHAVADI VARATHARAJAPURAM, CUMBUM-625515 14-10-2015
3101 NATIONAL WOMEN DEVELOPMENT TRUST NO:- 53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515. 21-1-2016
3102 NATIONAL WOMEN DEVELOPMENT TRUST NO:-53,GRAMACHAVADI, VARATHARAJAPURAM, CUMBUM-625515. 6-1-2016
3103 NATIONAL WOMEN DEVLOPMENT TRUST NO:-53 GRAMACHAVADI,VARATHARAJAPURAM, CUMBUM 11-9-2015
3104 NATIONAL YUVA COOPERATIVE SOCEITY LTD B-12, GOPAL NAGAR, AZADPUR DELHI 21-1-2015
3105 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR NEAR KRISHNA TOWER PARASIYA ROAD 21-6-2016
3106 NATRAJ SHIKSHAN EVAM SAMAJ KALYAN SAMITI ADARSH NAGAR PARASIYA ROAD CHHINDWARA 25-7-2016
3107 NATRAJ VIKAS SANSTHAN NAYAK DENTAL CILINIC , FARIHA , FIROZABAD 5-11-2014
3108 NATURAL EDUCATIONAL ENVIRONMENTAL AGRICULTURAL DEVELOPMENT SOCIETY NO. 66-B SENGALUEEAR OPAI STREET, KANCHEEPURAM CITY, KANCHEEPURAM DISTRICT, TAMILNADU 11-9-2015
3109 NATURAL HEALTH CARE SOCIETY AMBEDKAR NAGAR, VEMBULURU VILLAGE & POST, DAKKILI MANDAL SPSR NELLORE DISTRICT, AP 20-9-2016
3110 NATURAL RESOURCE MANAGEMENT AND COMMON WEALTH 453 DYNAMIC CENTER, 2ND FLOOR, M P NAGAR ZONE 1 BHOPAL-462011 3-4-2014
3111 NATURE CARE AND EDUCATIONAL SOCIETY MEHTA COMPLEX, OPP. LAXMI PETROL PUMP, NAWABGUNJ, HAZARIBAG 27-3-2014
3112 NATURE CLEAN FOUNDATION B-10 SECTOR -02 AGRASEN NAGAR, RING ROAD 1 RAIPUR C.G. 17-9-2015
3113 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR 1, DELHI 29-8-2016
3114 NATURE CURE AND YOGA TRUST GANDHI SMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI 26-8-2016
3115 NATURE CURE AND YOGA TRUST GANDHI SAMARAK NIDHI, MAYUR VIHAR PHASE 1, DELHI 29-8-2016
3116 NATURE S CLUB AT- MAHIPAL, PO-KENDRAPARA , DIST- KENDRAPARA, ODISHA, PIN-754211 21-12-2015
3117 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA 9-2-2016
3118 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, STATE -ODISHA 4-3-2016
3119 NATURES CLUB AT MAHIPAL, PO KENDRAPARA , DIST KENDRAPARA, ODISHA 14-3-2016
3120 NAV AASTHA JAN VIKAS SEVA SAMITI WARD NO. 03, NEAR OLD KATTHA FACTORY, GODHANPUR, AMBIKAPUR 17-7-2014
3121 NAVACHETHANA MALLAPPALLY INSTITUTE 26-7-2016
3122 NAVAPARA KHADI GRAMODHYOG MANDAL KHADI BHAVAN AT NAVAPARA POST DARI 17-9-2015
3123 NAVAYOTI YUVAK SANGHA NEAR SAI MANDIR RUGUDIPARA BALANGIR (IDISHA) 19-8-2015
3124 NAV CHETNA ACADEMY 25-A, VIKAS NAGAR, NEAR ALLAHABAD BANK, KANPUR 15-3-2016
3125 NAV DURGA INSTITUTE OF INFORMATION TECHNOLOGY WARD NO 6 IN FRONT OF SBI BANDA 8-6-2016
3126 NAVJEEVAN PREM MANDIR CAMPUS KALAWAD ROAD RAJKOT 1-11-2013
3127 NAVJEEVAN NURSING SHIKSHAN SANSTHAN NARAYAN KA BASS, KHURI BADI LAXMANGARH, SIKAR (RAJ.) 14-7-2014
3128 NAVJIVAN DNYAN SEVABHAVI SANSTHA PARBHANI GAT NO-234,AUNDHA ROAD, HINGOLI (MAHARASHTRA) 16-9-2015
3129 NAVJYOTI EDUCATION SOCIETY MATRI BHABAN, VIDYASAGARPALLY, JHARGRAM-721507 PASCHIM MEDNIPUR, WEST BENGAL 28-10-2016
3130 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, OPPOSITE GANPATI HONDA, GURGAON HARYANA 21-9-2015
3131 NAVJYOTI GLOBAL SOLUTIONS PVT LTD 1ST FLOOR, M-46 OLD DLF COLONY, SECTOR 14, GURGAON - 122001 15-9-2015
3132 NAVKAR CENTRE FOR SKILLS PRIVATE LIMITED 135-136 B, FIRST FLOOR, SOMDUTT CHAMBERS -I 5, BHIKAJI CAMA PLACE 13-11-2014
3133 NAVODAYA SEVA SANGAM 18-209/2/4/B, AYYAPPA COLONY, SHADNAGAR 15-9-2015
3134 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 2/285- H 1, DAULATPUR ROAD, PANDEYPUR, VARANASI 29-12-2016
3135 NAVODAYA TAKANIKI SHIKSHA SAMITI SA- 1/169-K GHAZIPUR, PANDEYPUR, VARANASI 21-12-2016
3136 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, UNION BANK, PANDEYPUR, VARANASI,UTTAR PRADESH 15-9-2016
3137 NAVODAYA TECHNIC EDUCATION SAMITI NAVODAYA INSTITUTE, NEAR UNION BANK, PANDEYPUR, VARANASI, UTTAR PRADESH. 28-9-2016
3138 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA 15-3-2016
3139 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA 27-5-2016
3140 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA 23-5-2016
3141 NAVODAYA TRUST 38/1, CHANDAKA INDUSTRIAL ESTATE, INFOCITY ROAD, CHANDRASHEKHARPUR, BHUBANESWAR, ODISHA 13-5-2016
3142 NAVRANG SEWA SANSTHAN STATION ROAD RASRA BALIYA 14-9-2015
3143 NAV SHAKTI FOUNDATION G74 FIRST FLOOR PREET VIHAR NEW DELHI 26-2-2016
3144 NAV SHAKTI FOUNDATION REGISTERED OFF: G74, FIRST FLOOR, PREET VIHAR, NEW DELHI. COMMUNICATION ADDRESS: H.NO 229, SECTOR-37 KHANDSA , GURGAON - PIN - 122004 14-3-2016
3145 NAVSHAKTI FOUNDATION G-74 IST FLOOR PREET VIHAR NEW DELHI 14-9-2015
3146 NAYAKS TUTOTRIALS PVT LTD 207, VARDHAMAN INDL. EST.,GOKUL NAGAR, OLD AGRA ROAD,THANE (W). 3-2-2014
3147 NAZAR DEVI SEVA TRUST NAVKAR SHRI KRISHNA NAGAR BHILWARA ROAD KANKROLI DIST RAJSAMAND 26-4-2016
3148 NAZIRPUR RAINBOW EDUCATIONAL INSTITUTE VILL-NAZIRPUR,P.O-NAZIRPUR,P.S-REJINAGAR,DIST-MURSHIDABAD,ST-WEST BENGAL 6-4-2016
3149 N BAJPAYEE SIKSHAN SANSTHAN NEERAJ PARENT'S PRIDE SCHOOL BALDEOBAGH, RAJNANDGAON (C.G) 14-9-2015
3150 NCCSD PATEL BLOCK,RAJDEEP ELECTRONIC COMPOUND,NR.STADIUM SIX ROAD,NAVRANGPURA,AHMEDABAD 6-4-2016
3151 NCK EDUCATIONAL AND CHARITABLE TRUST NO.2-788/1,VANDIPETTAI, THIRUNARAIYUR,NACHIYARKOIL PO, KUMBAKONAM TK,THANJAVUR DT, TAMILNADU,INDIA 4-1-2016
3152 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT[NEEDS],HOUSE PLOT NO-275,NEAR CHARKIPAHARI,TAPOVAN ROAD,POST-ASHRAM KARNIBAD-DEOGHAR 20-7-2016
3153 NEEDS NETWORK FOR ENTERPRISE ENHANCEMENT AND DEVELOPMENT SUPPORT [NEEDS] HOUSE PLOT NO. 275, CHARKIPEHRI,ASHRAM KARNIBAD,KUNDA,DEOGHAR 814143 15-6-2016
3154 NEELKANTH EDUCATIONAL TRUST 581/2 JAGRITI VIHAR MEERUT U.P 23-5-2016
3155 NEELKANTH EDUCATIONAL TRUST 58/12 JAGRITI VIHAR, MEERUT , U.P 20-7-2016
3156 NEELKANTH PUBLISHERS PVT LTD C-93, JAGRAJ MARG, BAPU NAGAR 3-4-2014
3157 NEERANCHLAM SEVA SANSTHAN 16/602, RAVINDRA NAGAR, URRHAT REWA 13-10-2016
3158 NEESA LEISURE LIMITED X-22,23 AND 24,, G.I.D.C ELECTRONIC ESTATE, SECTOR 25, GANDHINAGAR, GUJARAT 382044 22-1-2014
3159 NEESU CONSTRUCTIONS PRIVATE LIMITED CS - 9, FIRST FLOOR, GYAN KHAND 2, NEAR ST. THOMAS SCHOOL, INDIRAPURAM 15-9-2015
3160 NEESU CONSTRUCTIONS PVT LTD CS-9, FIRST FLOOR, GYAN KHAND - 2, INDIRAPURAM, NEAR ST. THOMAS SCHOOL 28-9-2015
3161 NEHERU YUVA VYAM SHALA VA KRIDA MANDAL AT.CUKAR PIMPARI POST.NAIKOTHA TQ.SONPETH DIST.PARBHANI 10-2-2016
3162 NEHRU MEMORIAL COLLEGE COLLEGE ROAD, PUTHANAMPATTY, TRICHY D.T TAMIL NADU 4-12-2014
3163 NEHRU YUVA GRAMIN VIKAS SAMITI BHADRA JAI SHREE IDEAL SCHOOL BHADRA WARD NO-25 BHADRA 5-2-2016
3164 NEHRU YUVA MANDAL AJAY KUMAR GUPTA VILL+POST-GARWAR DIST-BALLIA 3-3-2015
3165 NEHRU YUVA MANDAL GADKHAMB NITIN VASANT NERKAR AT.GADKHAMB POST NAGOAN TEL. AMALNER DIS. JALGOAN 21-6-2016
3166 NEHRU YUVA MANDAL SAMITI VILL- PATRASIYA POST- BARKHERA PILIBHIT 9-11-2015
3167 NEHRU YUWA MANDAL GRAM- KHAGAIJOT, POST, TEHSIL & DISTRICT- BALRAMPUR CORRESPONDNG ADDRESS- SHYAM COLONY BHAGWATIGANJ, BALRAMPUR 30-9-2016
3168 NELE TRUST #3 FIRST FLOOR NEXT TO IOB T-NARASIPURA MAIN ROAD GIRIDHARSHINI LAYOUT ALANAHALLY MYSURU-570028 5-8-2016
3169 NEO ART N GLASS PVT LTD MISCELLANEA, 128/A, KEMP'S CORNER, MUMBAI 14-9-2015
3170 NEO CURSOR 1-8-1/B/25/A, Sundarayya vignana Kendram, BAGH LINGAMPALLY, Hyderabad 5-9-2016
3171 NEPNI TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 6-7-2016
3172 NEST EDUCATIONAL CHARITABLE TRUST 172, RAHIMANPET, KATTUKANALLUR VILLAGE KANNAMANGALAM VIA ARNI, TALUK , THIRUVANNAMALAI DISTRICT 6-1-2016
3173 NETAJI SEVA SANSTHAN INDIRA NAGAR, PALIGANJ, PATNA 17-6-2014
3174 NETAJI SUBHAS COMPUTER SAKSHARTA MISSION 12 SWARNMOYEE ROAD BERHAMPORE MURSHIDABAD WEST BENGAL INDIA 13-9-2015
3175 NETAR SOFTWARE SERVICES PRIVATE LIMITED PLOT NO 30, VASANTNAGAR, KUKATPALLY, RANGAREDDY, HYDERABAD, TELANGANA 500072 4-8-2016
3176 NETCOM SOCIETY 11/1 ABOVE SSS RESTAURANT NEAR JYOTI CINEMA NAPIER TOWN JABALPUR MP 482002 5-8-2016
3177 NET FLEX SOFTWARE TECHNOLOGIES PVT LTD 320,AMANORA CHAMBER,MAGARPATTA ROAD,PUNE,MAHARSTRA 24-6-2015
3178 NETLABS IT CONSULTANCY PRIVATE LIMITED N-25, SOUTH EXTENSION, PART-1, NEW DELHI 24-5-2016
3179 NETLIX IT SOLUTIONS PRIVATE LIMITED COLLECTORATE ROAD, NEAR NEELKANTHESHWER MANDIR,GULABRA, CHHINDWARA 6-5-2016
3180 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR, COMUNITY CENTER, EAST OF KAILASH,NEW DELHI 26-4-2016
3181 NETSOFT CONSULTING SERVICES PRIVATE LIMITED 24, 2ND FLOOR,COMMUNITY CENTER, EAST OF KAILASH, NEW DELHI 6-4-2016
3182 NETTUR TECHNICAL TRAINING FOUNDATION 23/24, II PHASE, PEENYA INDUSTRIAL AREA BANGALORE 12-11-2013
3183 NETWORK FOR EMPOWERING OPPRESSED SOCIETY NO:50/66,ST.XAVIAR STREET,NAGAL NAGAR,DINDIGUL 5-9-2014
3184 NETWORK FOR INFORMATION AND COMPUTER TECHNOLOGY NICT HOUSE, PLOT NO. EB - 109, SCHEME NO. 94, OPP. BOMBAY HOSPITAL, INDORE (M.P.) - 452010 17-4-2015
3185 NEW DIRECTIONS EDUCATIONAL SOCIETY 81/A,MLA`S,COLONY,ROAD NO.12,BANJARA HILLS,HYDERABAD. 3-4-2014
3186 NEW ERA EDUCATIONAL SOCIETY NEW ERA PUBLIC SCHOOL , 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),507002,KHAMMAM DIST. 26-4-2016
3187 NEW ERA EDUCATIONAL SOCIETY NEW ERA SCHOOL MAMATHA HOSPITAL ROAD, KHAMMAM 23-2-2016
3188 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN 4-8-2016
3189 NEW ERA EDUCATIONAL SOCIETY 4-2-227/1 VARADAIAH NAGAR,KRISHNA BUILDING,MAMATHA HOSPITAL ROAD,KHAMMAM(URBAN),KHAMMAM DIST. BLOCK: KHAMMAM URBAN 8-7-2016
3190 NEW ERA SOFTWARE TECHNOLOGIES NEST COMPUTER,6-17-7,PANDIRIVARI STREET,OPP:PETROL BUNK,KOTIPALLI BUSSTAND,T-NAGAR,RAJAHMUNDRY 12-11-2014
3191 NEW ERA SOFTWARE TECHNOLOGIES NEST,DR NO:6-17=7,PANDIRIVARI STREET,T-NAGAR,RAJAHMUNDRY,E.G.DT,A.P 1-6-2016
3192 NEW GAIN EDUCATIONAL SOCIETY 553/1, JAIN MANDIR STREET CHOTA BAZAR , SHAHADRA DELHI 13-5-2016
3193 NEW GAIN EDUCATIONAL SOCIETY NEW GAIN EDUCATIONAL SOCIETY 553/1 CHAOTTA BAZAAR SHAHADARA DELHI - 110032 14-10-2016
3194 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH 5-12-2016
3195 NEW HOWARD EDUCATIONAL SOCIETY 11/3 GANGA VIHAR,OPP ARYA SAMAJ MANDIR,VISWAKARMA CHOWK,BHOPA ROAD,MUZAFFARNAGAR,UTTAR PRADESH 10-11-2016
3196 NEW LBS SANSTHAN NEW LBS SANSTHAN , ZERO MILE CHOURAHA , PRATAPGARH 17-1-2017
3197 NEW MOON Kamalpur, Dhalai, Tripura Rupashpur Kamalpur 9-8-2016
3198 NEW NTECH COMPUTER EDUCATIONAL SOCIETY NEW NTECH COMPUTER EDUCATIONAL SOCIETY, KRASHNA NAGAR TIRWA ROAD SARAYMEERA KANNAUJ 209727 16-3-2016
3199 NEW PATH EDUCATION SOCIETY KASARIDIH, KANHAIYAPURI, BEHIND PANCHMHUKI HANUMAN MANDIR 4-12-2014
3200 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION SF1, WESTERN CITY COMPLEX, PIJ ROAD, NADIAD 5-1-2017
3201 NEW TECH RURAL AND URBAN EDUCATION DEVELOPMENT FOUNDATION NEW TECH FOUNDATION SF1, WESTERN CITY COMPLEX, ABOVE INDIAN BANK, PIJ ROAD, NADIAD 13-1-2017
3202 NEWTEK INDIA PRIVATE LIMITED 1506, CHIRANJIV TOWERS, 43, NEHRU PLACE, NEW-DELHI 29-3-2014
3203 NEWTON EDUCATIONAL AND SOCIAL WELFARE TRUST REGD OFFICE MANJAPUTHUR VILLAGE AND POST SANKARAPURAM TK VILLUPURAM DT TAMILNADU 606208 PROJECT OFFICE KALLAI MAIN ROAD SANKARAPURAM POST AND TK VILLUPURAM DT 606401 14-9-2015
3204 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR, KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA, HARYANA 5-2-2016
3205 NEW VOCATIONAL TRAINING INSITUTE 1ST FLOOR KUMAHAR DHARAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA 29-2-2016
3206 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR KUMHAR DHARMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA (HRY) 26-8-2016
3207 NEW VOCATIONAL TRAINING INSTITUTE 1ST FLOOR, KUMHAR DHRAMSHALA, NEAR ITI COLLEGE, RANIA ROAD, SIRSA 13-9-2015
3208 NEW VOICE FOUNDATION 2-2-18/30/A/1, THE HERITAGE APARTMENTS, DD COLONY, BAGH AMBERPET. HYDERABAD, TELANGANA 16-12-2016
3209 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR 14-10-2015
3210 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR 11-1-2016
3211 NEW WORLD TRUST MARIYA PARAMEDICAL COLLEGE CAMPUS 52 RAJARAJAN NAGAR GNANAM NAGAR MARIAMMAN KOVIL VIA THANJAVUR 1-10-2015
3212 NEXT EDUCATION SOCIETY 11, MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, GANGAPUR ROAD, NASHIK 4-1-2016
3213 NEXT EDUCATION SOCIETY NASHIK MURKUTE COLONY, NEW PANDIT COLONY, NEAR JYOTI STORES, OFF GANGAPUR ROAD, NASHIK 14-9-2015
3214 NH CONSULTING PRIVATE LIMITED 5E, 1ST FLOOR, DADA JUNGI HOUSE, SHAHPUR JAT, NEW DELHI-110049 9-12-2016
3215 NHIT 9954/3A1,MARTHANDAPURAM 3RD STREET,ALANGUDI ROAD,HDFC BANK UPSTAIRS,PUDUKKOTTAI. 4-9-2014
3216 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL, OPP TIRTHNAGAR -1, MEMNAGAR, AHMEDABAD 21-8-2015
3217 N H KAPADIA EDUCATION TRUST THE H B KAPADIA NEW HIGH SCHOOL NR SUBHASH CHOWK MEMNAGAR AHMEDABAD 6-8-2015
3218 NIAM EDUCATIONAL FOUNDATION 3, TAMOOR NAGAR, NEW FRIENDS COLONY, NEW DELHI 11-9-2014
3219 NIBBLE TECH COMPUTER EDUCATION MAIN BAZAAR MIRAN SAHIB R S PURA JAMMU 12-5-2016
3220 NIBBLE TECH COMPUTER EDUCATION MAIN BAZZAR MIRAN SAHIB R.S PURA JAMMU 26-4-2016
3221 NICE COMPUTER EDUCATIONAL SOCIETY #08, MANDAL OFFICE COMPLEX, MAIN ROAD, RAMAYAMPET 21-11-2013
3222 NICET COMPUTER EDUCATION AT-PARK LANE, NEAR COLLECTORS RESIDENSE,KEONJHAR 9-8-2016
3223 NIC INSTITUTE OF TECHNOLOGY P.O + P.S. - RAJARHAT 11-8-2016
3224 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, 20-5-2016
3225 NIDAN 1ST FLOOR, SAGAR COMPLEX, NEW RAJDHANI ENCLAVE, VIKAS MARG, DELHI 5-5-2016
3226 NIDAN TECHNOLOGIES PVT LTD 2429 WRIGHT TOWN MADAN MAHAL STATION ROAD 25-11-2014
3227 NIESBUD A-23, SECTOR-62, INSTITUTIONAL AREA NOIDA 23-12-2013
3228 NIFA INFOCOMP SERVICES PVT LTD 82, HARI MARG, CIVIL LINES, JAIPUR 19-10-2013
3229 NIFT TEA KNITWEAR FASHION INSTITUTE EAST OF TEKIC, MUDALIPALAYAM SIDCO, TIRUPUR 16-4-2015
3230 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR,ZIYA BUILDINGS, OPP: DISTRICT COURT,MARUTHI NAGAR KADAPA-516001. ANDHRA PRADESH 22-12-2016
3231 NIHAR SKILL EDUCATION #1/338-1,1ST FLOOR, ZIYA BUILDINGS,OPP: DISTRICT COURT, MARUTHI NAGAR,KADAPA. 5-1-2017
3232 NIIT LIMITED 8, BALAJI ESTATE, FIRST FLOOR, GURU RAVIDAS MARG, KALKAJI, NEW DELHI 10-10-2013
3233 NIIT YUVA JYOTI LIMITED 85, SECTOR-32, INSTITUTIONAL AREA, GURGAON-122001, HARYANA 7-10-2016
3234 NIKHIL COMPUTER PRASHIKCHAN EVAM SAMAJ KALYAN SANSTHAN C/O ARPIT FACILITY CENTRE 37 NEW KHEDAPATI COLONY GWALIOR MP 24-10-2016
3235 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BRAHMAKUMARI YOGA CENTER,NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM-507001(TELANGANA STATE) 12-9-2016
3236 NIKITHA COMPUTERS H.NO:9-9-61,OPP:BHADRADRI BANK, NEAR RAMALAYAM,KASBA BAZAR,KHAMMAM,TELANGANA STATE 21-12-2015
3237 NILACHAL PLOYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA 14-10-2015
3238 NILACHAL PLOYTECHNIC MANAGED BY NABAPRAVAT TRUST PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA 24-11-2015
3239 NILACHAL POLYTECHNIC PLOT NO:540/1780,NILACHAL NAGAR(NEAR SIKHERCHANDI TEMPLE & INFOCITY),PATHERGADIA,PO-KIIT,BHUBANESWAR, ODISHA 15-9-2015
3240 NILACHAL SEVA PRATISTHAN DAYAVIHAR (KANAS),DIST.:PURI, ODISHA,INDIA 13-1-2014
3241 NILAHCAL EDUCATIONAL TRUST AT - GOTHAPATNA, PO - MALIPADA, DIST – KHORDHA, BHUBANESWAR, PIN – 751003 30-10-2015
3242 NILAKSHI EDUTECH PVT LTD C-591 AVANTIKA ROHINI SECTOR-1 NEW DELHI-110085 BEHIND WATER TANK 12-5-2016
3243 NILKANTH CHARITABLE TRUST AT POST BILIYA LIMDI PARU,TA.SIDHPUR,DIST.PATAN 14-9-2015
3244 NIMBUS SHIKSHA EVAM KALYAN SAMITI B-596 MIG INDRA ASHRAY COLONY, BERASIA ROAD KAROND BHOPAL 30-11-2016
3245 NIPDIT COLLEGE ROAD,PHULBANI,DIST-KANDHAMAL,ODISHA 8-7-2016
3246 NIPET GOPAL KRISHNA PATTNAIK S/O SHRI PRAMOD CHANDRA PATTNAIK JAGANNATH PRASAD, GANJAM, ODISHA-761121. 12-9-2015
3247 NIPSTEC LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI 6-4-2016
3248 NIPSTEC LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, 26-4-2016
3249 NIRALA VIKAS SAMITI BEHIND M.S.COLLEGE, RANISAR BAAS, BIKANER 11-11-2014
3250 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR 29-12-2016
3251 NIRANJAN MADHYAMIK SHIKSHA SAMITI B-152, ANAND NAGAR, BAHODAPUR, GWALIOR 5-1-2017
3252 NIRANTAR SAMAJIK AWAM SHAICHCHNIK SANSTHAN ROAD NO 1, PLOT NUMBER 234/235 (A), POST OFFICE: PATLIPUTRA 2-2-2015
3253 NIRBAL JAN KALYAN SAMITI 76, CHIRAG DELHI, NEW DELHI 13-9-2015
3254 NIRDESH NATIONAL INSTITUTE FOR RURAL DEVELOPMENT, EDUCATION, SOCIAL UPLIFTMENT AND HEALTH (NIRDESH) VILLAGE: MAJHAULIA P.O.: KHABARA DISTRICT: MUZAFFARPUR BIHAR 3-1-2014
3255 NIRMALA DEVI EDUCATION TRUST HNO. 144 PEERAGARI VILLAGE PEERAGARHI DELHI 27-6-2016
3256 NIRMAL TAKHAT BABA BUDHA SAHIB CHARITABLE TRUST VILLAGE & POST OFFICE DAKOHA, JALANDER CANTT, PUNJAB 21-1-2015
3257 NIRMANA EDUCATIONAL TRUST AT/PO- BALAKATI 5-11-2014
3258 NIRMAN EK MISSION DABAR GALI, KHETARI MOHALLA, ARAH, BHOJPUR 14-3-2016
3259 NIRMAN EK MISSION REGD. OFFICE- KHAGRI ROAD, SAMANPURA, RAJA BAZAR, PATNA PROJECT OFFICE-DABUR GALI, KHETARI MOHALLA, ARA, BHOJPUR 4-4-2016
3260 NIRMAN EK MISSION NIRMAN EK MISSION KHAGRI ROAD, SAMANPURA, RAJA BAZAR PATNA, BIHAR 13-5-2016
3261 NISA INDUSTRIAL SECURITY AGENCIES PRIVATE LIMITED 213,SAI COMMERCIAL CENTRE ,KHAR (W) 16-11-2013
3262 NISA INDUSTRIAL SERVICES PRIVATE LIMITED NISA GLOBAL 19TH FLOOR, LOTUS GRANDEUR, VEERA DESAI ROAD, OPPOSITE GUNDECHA NEAR TO COUNTRY CLUB ANDHERI LINK ROAD, ANDHERI WEST. MUMBAI - 400053 3-1-2014
3263 NIS MANAGEMENT PVT LTD 58/99, PRINCE ANWAR SHAH ROAD, KOLKATA 5-8-2016
3264 NIS SPARTA LTD H BLOCK DHIRUBHAI AMBANI KNOWLEDGE CITY, THANE BELAPUR ROAD, KHOPERKHAIRANE, NAVI MUMBAI 6-9-2015
3265 NIST COMPUTER ACADEMY GROUND FLOOR TIRUPATI COMPLEX BESIDE BANGLA HIGH SCHOOL LAKE BARA TALAB GARDEN 13-9-2015
3266 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE 22-12-2016
3267 NIST EDUCATIONAL TRUST HAWAL OPP. ISLAMIA COLLAGE 16-12-2016
3268 NIT COMPUTERS EDUCATIONAL SOCIETY H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI-505325,DIST: KARIMNAGAR,TELANGANA. TEL: 08725-236321. 16-3-2016
3269 N I T D T AT-AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG 22-7-2016
3270 N I T D T AT- OPPOSITE SAHARA INDIA OFFICE, BANSHILAL CHOWK, BARA BAZAR, HAZARIBAG 28-9-2015
3271 NIT SKILLS INDIA PVT LTD H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI DIST:KARIMNAGAR,TELANGANA. 21-9-2015
3272 NIT SKILLS INDIA PVT LTD NIT SKILLS INDIA PVT.LTD. H.NO :# 1-8-254 LINGA REDDY COMPLEX NEAR NITHYA SAI HOSPITAL MAIN ROAD METPALLI,DIST: KARIMNAGAR , TELANGANA.,INDIA. - TEL: 08725-236321. 15-9-2015
3273 NITYA SOFTWARE INDIA PVT LTD PLOT NO 175, VIJAYAPURI COLONY AS RAO NAGAR ECIL HYDERABAD 20-7-2016
3274 NIVEDITA KALYAN SAMITI 13/164, MANAS NAGAR (BARA), REWA DISTRICT, MADHYA PRADESH 30-10-2013
3275 NIYATEE FOUNDATION PLOT NO. F-13, AT - MUNICIPALITY COLONY, PO - LINGARAJ NAGAR, OLD TOWN, BHUBANESWAR, DIST - KHORDHA, ODISHA 11-11-2014
3276 NM LOK KALYAN TRUST B-53,SAHEED NAGAR, BHUBANESWAR,ODISHA 24-6-2016
3277 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019 4-3-2016
3278 NM LOK KALYAN TRUST B-53, SAHEED NAGAR,BHUBANESWAR,ODISHA 9-5-2016
3279 NM LOK KALYAN TRUST B-53,SAHID NAGAR , BHUBANESWAR,ODISHA 29-1-2016
3280 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA. 5-8-2016
3281 NM LOK KALYAN TRUST B-53, SAHEED NAGAR, P.O. SAHEED NAGAR, BHUBANESWAR-751007, KHURDHA(ODISHA) 12-1-2016
3282 NM LOK KALYAN TRUST SIJUA, PATRAPARA, KHANDAGIRI, BHUBANESWAR, ODISHA-751019 16-3-2016
3283 NM LOK KALYAN TRUST B-53,SAHID NAGAR, BHUBANESWAR, ODISHA 24-5-2016
3284 NMS ENTERPRISES LIMITED SECOND FLOOR, 48, HASANPUR, I.P EXTENSION 5-9-2014
3285 NOBLE EDUCATIONAL EMPOWERMENT SOCIETY 3-6-145/7/A, STREET NO.17, 1ST FLOOR, HIMAYATHNAGAR, HYDERABAD 1-10-2013
3286 NOBLE INST FOR PREMIER STUDIES AND TECHNOLOGIES D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI. 9-9-2016
3287 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECH LTD D-82. F/F, MALVIYA NAGAR, NEW DELHI 24-5-2016
3288 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, FIRST FLOOR, MALVIYA NAGAR, MAIN ROAD, MAIN MARKET, NEW DELHI 22-9-2016
3289 NOBLE INSTITUTE FOR PREMIER STUDIES AND TECHNOLOGIES LIMITED D-82, F/F, MALVIYA NAGAR, NEW DELHI 6-10-2016
3290 NOBLE INSTITUTE OF EDUCATION SOCIETY NOBLE INSTITUTE OF EDUCATION SOCIETY(R) DR SHANKAR NARAYANA REDDY BUILDING,1ST FLOOR,KONAPPANA AGRAHARA BUSSTOP BEHIND AXIS BANK, ELECTRONIC CITY POST BANGALORE - 560 100 6-2-2015
3291 NOBLE INSTT FOR PREMIER STUDIES AND TECH LIMITED D-82, FIRST FLOOR, MAIN ROAD, MAIN MARKET, MALVIYA NAGAR, NEW DELHI 2-8-2016
3292 NORTH BENGAL ART ACADEMY NORTH BENGAL ART ACADEMY,NILADRI SHIKHAR BUILDING,1ST FLOOR,HILL CART ROAD, SILIGURI, DIST DARJEELING PIN-734001 (WEST BENGAL). 14-12-2016
3293 NORTH BENGAL ART ACADEMY NILADRI SHIKHAR BUILDING, 1ST FLOOR, HILL CART ROAD, SILIGURI,DIST- DARJEELING, WEST BENGAL 30-11-2016
3294 NORTH EAST DEVELOPMENT CONSORTIUM HOUSE NO 29, NAMGHAR PATH-2, RUKMINI NAGAR, WIRELESS, DISPUR, GUWAHATI, 14-9-2016
3295 NORTH EASTERN SOCIETY FOR HUMAN DEVELOPMENT NESHD REG. ADDRESS- DWARKANAGAR, NAVODAY PATH, P.O-KHANAPARA, GUWAHATI-781022,ASSAM, INDIA ADMINISTRATION OFFICE : H.NO-4, BYE LANE-9, ZOO-ROAD TINIALI, GUWAHATI, ASSAM, INDIA 23-2-2016
3296 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI 14-9-2016
3297 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 ASSAM 22-11-2016
3298 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO 57 IDGAH ROAD PAKIZA NAGAR SIJUBARI HATIGAON GUWAHATI-781038 (ASSAM) 22-8-2016
3299 NORTH EAST PARAMEDICAL AND NURSING INSTITUTE TRUST HNO.57 IDGAH ROAD,PAKIZA NAGAR SIJUBARI,HATIGAON GUWAHATI-781038 (ASSAM) 27-7-2016
3300 NORTH INDIA TECHNICAL CONSULTANY ORG LTD IFCI BHAWAN, 1-C, SECTOR 27-A, MADHYA MARG, CHANDIGARH 25-11-2014
3301 NOVA EDUCATIONAL SOCIETY MUTHUSETTY YTOWERS, 7-1-209/1/2/3, AMEERPET, HYDERABAD 5-10-2016
3302 NOVEXIS HEALTHCARE PRIVATE LIMITED A 201, 2ND FLOOR, NEW LAXMI SADAN CO. OP. SOCIETY, THAKUR VILLAGE, KANDIVALI WEST, MUMBAI 26-4-2016
3303 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE 14-10-2015
3304 NOVIAL INSTITUTE OF COMPUTER EDUCATIONAL TRAINING 2ND FLOOR,OPP RAIN BOW HOSPITAL,RAMESH REDDY NAGAR,NEAR R.T.C,NELLORE,ANDHRA PRADESH. 23-10-2015
3305 NOVUS EDUCATIONAL ACEDAMY PVT LTD 5-1-100, MAHESHWAR COMPLEX, KUKATPALLY 17-1-2017
3306 N RACHAIAH FOUNDATION NO.865 OPP TO DR. MODI HOSPITAL WEST OF CHORD ROAD MODI HOSPITAL ROAD BASAVESHWARANAGAR BANGALORE URBAN 14-12-2016
3307 N RACHAIAH FOUNDATION #865, WESTEND COLLEGE BUILDING, OPP TO MODI HOSPITAL WEST OF CHORD ROAD BASAVESHWARANAGAR BANGALORE URBAN 16-1-2017
3308 N RACHAIAH FOUNDATION #865, WEST END COLLEGE BUILDING, OPP TO MODI HOSPITAL, WEST OF CHORD ROAD BASAVESHWARANAGAR, BANGALORE - 560 079 KARNATAKA, INDIA 5-1-2017
3309 N RACHAIAH FOUNDATION NO.865, OPP. DR. MODI EYE HOSPITAL, WEST OF CHORD ROAD, 2ND STAGE BANGALORE URBAN 30-11-2016
3310 NRDS IT AND MANAGEMENT PRIVATE LIMITED SILPUKHURI, NABAGRAHA ROAD, H/NO.1, 1ST FLOOR 23-2-2016
3311 NRDS MANAGEMENT PRIVATE LIMITED SILPUKHURI, NABAGRAHAR ROAD, H. NO.1, 1ST FLOOR, OPP. VIJAYA BANK, GUWAHATI, ASSAM 17-9-2015
3312 NRLM SKILLS SAMRAT,CHANKYAPURI 14-10-2015
3313 NSD NATIONAL SKILLS DEVELOPMENT NSD CENTRE, 2ND FLOOR, MUTHAIYA COMPLEX, OPP. INDIAN BANK,(NEAR AV THEATRE), DHARMAPURI 13-9-2015
3314 NSHM ACADEMY 124 60 B L SAHA ROAD TOLLYGUNGUE KOLKATA 15-1-2015
3315 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD 15-9-2016
3316 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD 12-8-2016
3317 NTR MEMORIAL TRUST NTR TRUST BHAVAN, ROAD NO.2, BANJARA HILLS, HYDERABAD 4-7-2016
3318 NUCLEUS COMPUTERS LTD 112/371, CHANDANI HOSPITAL ROAD, SWARUP NAGAR, KANPUR, UTTAR PRADESH 21-8-2014
3319 NURTURE INDIA SOCIETY NURTURE INDIA SOCIETY, KANIYAPURAYIDOM BUILDING MALLAPPALLY KERALA INDIA 25-7-2016
3320 NXTECH SYSTEMS 2ND & 3RD FLOOR, SATGURU COMPLEX, OPP. JAIN SOCIETY, NEW BUS STAND ROAD, GODHRA - GUJARAT 11-11-2013
3321 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE 12-1-2016
3322 NYATI TECHNOLOGIES PRIVATE LIMITED F5 - 25, FLAT NO.102, HERMES HERITAGE PHASE-2, SHASTRI NAGAR, YERWADA, PUNE 5-2-2016
3323 NYATI TECHNOLOGIES PVT LTD F5/25, HERMESH HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE 27-11-2015
3324 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE 11-8-2016
3325 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II,SHASTRI NAGAR, YERWADA, PUNE 1-10-2015
3326 NYATI TECHNOLOGIES PVT LTD 1, SHREE APPARTMENT, BEHIND ICICI BANK, GHOLE ROAD, SHIVAJI NAGAR, PUNE. 14-9-2015
3327 NYATI TECHNOLOGIES PVT LTD F5/25, HERMES HERITAGE, PHASE II, SHASTRI NAGAR, YERWADA, PUNE 14-10-2015
3328 NYATI TECHNOLOGIES PVT LTD FLAT NO 37, B WING, AAMOD APARTMENT, OPP SHIVAJI NAGAR POLICE STATION NEAR AGRICULTURE COLLEGE, F C RAOD, SHIVAJI NAGAR, PUNE 411005 28-9-2015
3329 O2 SPA SALON PRIVATE LIMITED 8-2-574, NAJAF APARTMENT, ROAD NO 7, BANJARA HILLS, HYDERABAD 500034 20-9-2016
3330 OAIT INDIA INFRONT OF K K HOPITAL, NEAR KISHANPUR TIRAHA, RAMGHAT ROAD, ALIGARH 14-9-2015
3331 OAKBROOK INTERNATIONAL EDUCATION AND RES PVT LTD B- 806 , TITANIUM SQUARE, THALTEJ CROSS ROAD, S.G. HIGHWAY, THALTEJ, AHMEDABAD 19-8-2014
3332 OBJECTONE INFORMATION SYSTEMS LIMITED 8-3-988/34/7/2/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, HYDERABAD. 14-9-2015
3333 OBJECTONE INFORMATION SYSTEMS LTD 8-3-988/34/7/1&2, KAMALAPURI COLONY, SRINAGAR COLONY MAIN ROAD, 18-9-2015
3334 OBJECT TECHNOLOGY SOLUTIONS INDIA PVT LTD SY.NO 30(P), 34(P), 35(P), 38(P), HITECH CITY-2, GACHIBOWLI, SERILINGAMPALLY, HYDERABAD. 16-3-2015
3335 OCEAN EDUCATIONAL DEVELOPMENT SOCIETY SHANTI NIWAS, BIHIND OF VISHNU MANDIR, MOHAN NAGAR, INFRONT OF PARK, SHIVPURI (M.P.) 29-12-2016
3336 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN 13-1-2017
3337 OCEANIA COLLEGE INDIA PRIVATE LIMITED 220/24, D.L.ROAD DEHRADUN 5-1-2017
3338 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN, UTTRAKHAND 24-5-2016
3339 OCEANIA COLLEGE INDIA PVT LTD 220/22, D.L.ROAD, DEHRADUN 27-9-2016
3340 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR 17-5-2016
3341 OCMCJOBS PRIVATE LIMITED 2ND FLOOR,VISHAL FURNITURE,OPPOSITE SITABULDI POLICE STATION,SITABULDI,NAGPUR-440012 20-5-2016
3342 OCMCJOBS PRIVATE LIMITED 1ST FLOOR,210,MIG,GAUTAMNAGAR,NEAR SHIVAM HOSPITAL,BHOPAL 14-9-2015
3343 OCTANE EDUTECH PVT LTD CF-30, SALTLAKE CITY, SECTOR-1, KOLKATA 5-8-2016
3344 OCTAVO SOLUTIONS PRIVATE LIMITED G-27 KAILASH COLONY 11-6-2014
3345 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA 17-1-2017
3346 ODISHA RESEARCH AND DEVELOPMENT CENTRE TRUST 67, VIDYA VIHAR, IID CENTER, NEAR BARUNEI HILLS, KHURDA, BARUNEI TEMPLE RD, JAGANNATHPUR, KHURDHA, ODISHA 22-12-2016
3347 ODISHA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA 23-6-2016
3348 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE 15-9-2015
3349 OGGIN TECH PRIVATE LIMITED KHASRA NUMBER 15/212, GROUND FLOOR, NEAR MOTHER DAIRY WALI GALI, VILLAGE MANGOLPUR KALAN 6-8-2015
3350 OGMA IT CONCEPTIONS PVT LTD 17/3 BOSEPUKUR ROAD, PS-KASBA, KOLKATA, WEST BENGAL 2-9-2016
3351 OLIVE HERITAGE EDUCATION AND WELFARE SOCIETY 60-OLIVE BHAVAN, HUDA MARKET, (BEHIND HP PETROL PUMP)SEC 23-A, GURGAON 10-2-2015
3352 OMEGA ADVERTISING AGENCY PRESS PVT LTD SENTINEL BUILDING, G.S. ROAD, DISPUR, GUWAHATI -781005 ASSAM, INDIA 14-9-2015
3353 OMEGA TRUST OMEGATRUST, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMDURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA 23-11-2016
3354 OMEGA TRUST OMEGA TRUST, PENIEL HOUSE, NEW VASANTH NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST., TAMIL NADU, S.INDIA. 9-12-2016
3355 OMEGA TRUST OMEGA TRUST, PENIEL PRAYER HOUSE, NEW VASANTHA NAGAR, MANAMADURAI TOWN, MANAMADURAI TALUK, SIVAGANGAI DIST, TAMIL NADU, S,INDIA. 14-12-2016
3356 OM GAURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH 22-12-2016
3357 OM GOURA SEWA SANSTHAN D.S.L-32 SWARN JAPATI NAGAR RAMGHAT ROAD ALIGARH 9-12-2016
3358 OMKARAMEDUCATIONALSOCIETY AVULA STREET, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226 15-1-2015
3359 OMKARAM EDUCATIONAL SOCIETY MAINROAD, OPP POLICE STATION, UDAYAGIRI, NELLORE DT, ANDHRAPRADESH, 524226 16-1-2015
3360 OM METALS INFRAPROJECTS LIMITED J-28 SUBHASH MARG C SCHEME JAIPUR RAJESTHAN 25-12-2013
3361 OMNE AGATE SYSTEMS PVT LTD OMNE AGATE SYSTEMS PRIVATE LTD II FLOOR MNO COMPLEX NO 99 GREAMS ROAD CHENNAI 600 006 12-9-2015
3362 OMNISOFT TECHNOLOGIES PVT LIMITED 2ND FLOOR THE EMPEROR BUILDING ,FATEHGUNJ MAIN ROAD,FATEHGUNJ. 30-9-2013
3363 OM SAI FOUNDATION 14,KASTURBAPATH,BEHIND YAMUNA APARTMENT,NORTH S.K.PURI,BORING ROAD,PATNA-13 3-4-2014
3364 OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOH OMSAI JANKALYAN BAHUDDESHIY SEVAABHAVI SANSTHA LOHA MAIN ROAD LOHA TQ LOHA DIST NANDED 20-9-2016
3365 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL 2/242, MOBIRIPATTI(V), HARUR(TK), DHARMAPURI. 12-11-2014
3366 OM SAKTHI HEAVY MOTOR DRIVING SCHOOL SALEM MAIN ROAD,NEAR ADHIYAMAN KOTTAI RAILWAY CROSS,DEVARASAMPATTI,DHARMAPURI. 12-11-2014
3367 OM SHIV MANAV SEVA SAMITY H NO 209 VILL BALLIYA POST ROUJA 15-9-2015
3368 OM VIJAY CHARITABLE TRUST 1603/MEHTA NAGAR,NEAR OLD IDEAL SCHOOL, RAILWAY ROAD,HISAR 14-9-2016
3369 OM VIJAY CHARITABLE TRUST 1603, MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,HISAR. 27-9-2016
3370 OM VIJAY CHARITABLE TRUST 1603,MEHTA NAGAR,NEAR OLD IDEAL SCHOOL,RAILWAY ROAD,HISAR. 6-10-2016
3371 OM WELFARE SOCIETY OPP.SYNDICATE BANK, AZAD NAGAR,GANGWA ROAD, HISAR, HARYANA 15-4-2014
3372 OMX EDUCOMP 112/335 SWAROOP NAGAR KANPUR UTTAR PRADESH 8-1-2016
3373 OMX WEBTECH PRIVATE LIMITED 112/335 - 1ST FLOOR SWAROOP NAGAR KANPUR 11-1-2016
3374 ONE INDIA INFORMATION TECHNOLOGY PVT LTD 501 VAISHALI NAGAR ,VAISHALI TOWER -2 VAISHALI NAGAR ,JAIPUR 17-9-2015
3375 OOVIYAAS SCHOOL OF DESIGN AND FINE ARTS 64,MINT STREET,SOWCARPET, CHENNAI 79 12-11-2014
3376 OPPORTUNITIES INFINITE 49/22, MADDOX STREET, CHOOLAI, CHENNAI 12-1-2016
3377 OPPRESSED PEOPLE HELPING SOCIETY NO.35, K.C.K. NAGAR, IIND STREET, PUDUKAMUR ROAD, ARNI PALAYAM, ARNI, THIRUVANNAMALAI DISTRICT TAMIL NADU 12-9-2015
3378 OPTAAMAZE CORPORATE SOLUTIONS PRIVATE LIMITED D-729, LOWER GROUND FLOOR, CHITTARANJAN PARK, NEW DELHI 17-10-2013
3379 OPTIMUS MANAGEMENT AND HR CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL 23-6-2016
3380 OPTIMUS MANAGEMENT AND HUMAN RESOURCE CONSULTANCY PVT LTD F-44, FLAMINGO, AAKRITI ECO CITY, E-8, ARERA COLONY, BHOPAL 26-9-2016
3381 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT.- KULLU, H.P. 9-12-2016
3382 ORAIL EDUCATIONAL SERVICES PRIVATE LIMITED NEAR DEGREE COLLEGE, DHALPUR, DISTT- KULLU, H.P. 29-11-2016
3383 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR - 2, NEW DELHI 22-9-2016
3384 ORANE INTERNATIONAL PRIVATE LIMITED B 38, 1ST FLOOR, LAJPAT NAGAR 2, NEW DELHI - 110024 9-9-2016
3385 ORANGE CITY EDUCATION SOCIETY NAGPUR PLOT NO.22, NEW NAGPUR CO-OP. HOUSING SOCIETY, GODHANI ROAD, NAGPUR INSTITUTE : 1ST WING, RAI GULMOHAR, TEKA NAKA, KAMPTEE ROAD, NAGPUR 26-3-2014
3386 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085 19-10-2016
3387 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK,100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085 23-12-2016
3388 ORANGE TECH SOLUTIONS #784, 2ND PHASE, 7TH BLOCK, 100 FT RING ROAD, BANASHANKARI 3RD STAGE, BENGALURU, KARNATAKA 560085 6-10-2016
3389 ORAVEL STAYS PRIVATE LIMITED 15TH FLOOR, EROS CORPORATE TOWERS, NEHRU PLACE, NEW DELHI 18-12-2015
3390 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55. 22-7-2016
3391 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55. 8-9-2016
3392 ORGANISATION FOR RURAL DEVELOPMENT 1/272, GOLDEN TEMPLE ROAD, ARIYUR POST, VELLORE-55. 18-8-2016
3393 ORGANISATION FOR WELFARE TO SOCIETY PLOT NO 59, GOUTAM NAGAR, PO - BJB NAGAR, BHUBANESWAR, DIST - KHURDHA, ODISHA 9-2-2016
3394 ORIENTAL EDUCATION SOCIETY INSTITUTE ADDRESS : GAT NO 37, 38 AT POST GAUDDARA TAL : HAVELI , DIST :PUNE OFFICE ADDRESS : OFFICE NO 43/44 PRESTIGE POINT 283 SHUKRAWAR PETH NEAR CHINCHECHI TALIM PUNE - 411002 25-11-2014
3395 ORIENTAL SKILLS AND SAFETY SERVICE PVT LTD H.NO. 6-3-347/20/3A, FLAT NO. 5A, 5TH FLOOR, DIVYA SAI SHAKTI APARTMENTS, DWARAKAPURI COLONY, PUNJAGUTTA, HYDERABAD - 500082, TELANGANA, INDIA. 9-5-2016
3396 ORIENTAL SKILLS AND SAFETY SERVICES PVT LTD 6-3-456/A/20, 203 MARUTHI GRANDEUR, DWARAKAPURI COLONY, HYDERABAD, INDIA 17-9-2015
3397 ORIENT CRAFT FASHION INST OF TECH PVT LTD PLOT NO 68 UDHYOG VIHAR PH-4 GURAGON-(HARYANA) 1-10-2013
3398 ORIENT CRAFT LTD PLOT NO 7D SEC-18 MARUTI INDUSTRIAL AREA UDHYOG VIHAR PH-4, GURGAON 17-10-2013
3399 ORION EDUTECH PVT LTD 163/1 VIP ROAD SCHEME VII(M), ULTADANGA,KOLKATA 3-10-2013
3400 ORION SECURITY SOLUTIONS PVT LTD ORION SECURITY SOLUTIONS PVT. LTD. 5E, 1ST FLOOR, JUNGI HOUSE, SHAHPUR JAT, NEW DELHI-110049 28-10-2016
3401 ORION TRUST SAGOLBAND THINGOM LEIKAI 4-1-2016
3402 ORISSA CHILD WELFARE AND EDUCATION TRUST 1288, KAPILAPRASAD, OLD TOWN, BHUBANESWAR, ODISHA 15-9-2015
3403 ORISSA COMPUTER ACADEMY PUBASASAN, KAUSALYA GANGA, BHUBANESWAR 20-1-2016
3404 ORISSA EDUCATION AND CHARITABLE TRUST 144-C MANCHESWAR INDUSTRIAL ESTATE BHUBANESWAR 26-3-2014
3405 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR, KHURDA 17-5-2016
3406 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA 12-8-2016
3407 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA 20-7-2016
3408 ORISSA EDUCATION TRUST PATRAPADA,BHUBANESWAR,KHURDA 2-6-2016
3409 ORISSA EDUCATION TRUST PATRAPADA, BHUBANESWAR,KHURDA 22-6-2016
3410 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA 26-7-2016
3411 ORISSA RURAL RECONSTRUCTION ASSOCIATION PLOT NO.2357/4154, LAXMISAGAR, BHUBANESWAR, DIST KHURDA, Odisha 18-8-2016
3412 ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING ORISSA TRUST OF TECHNICAL EDUCATION AND TRAINING (OTTET), PRASNAGARBHA, PLOT. NO-S-3/68, 69, & 83, SEC. A, ZONE B, MANCHESWARIND.ESTATE, BHUBANESWAR 18-1-2017
3413 ORNATE SOFTWARE SOLUTIONS PRIVATE LIMITED 7, ARENJA TOWERS, PLOT NO 49-51, SECTOR-11, CBD BELAPUR, NAVI MUMBAI 17-12-2013
3414 ORTIN LABORATORIES LIMITED FLAT NO 502, PALEM TOWERS BARKATPURA, HYDERABAD – 500 027, TELANGANA, INDIA 7-1-2016
3415 ORTIN LABORATORIES LIMITED PLOT NO 502, PALEM TOWERS, BARKATPURA, HYDERABAD – 50027, TELANGANA, INDIA 30-11-2015
3416 OSCAR CHARITABLE TRUST #2716/6, OPP LAKSHMI MILLS, NELLAI MAIN ROAD, KOVILPATTI 25-11-2014
3417 OSIYAN SHIKSHA PRASAR SAMITI REG OFF - 122 NEW SHIVAJI NAGAR ,THATIPUR ,CHAUHAN PIYAU,GWALIOR,474011 CENTER - 66 TANSEN ROAD,ABOVE TIRUPATI BAJAJ SHOWROOM,GWALIOR,474003 6-4-2016
3418 OSIYAN SHIKSHA PRASAR SAMITI 122 NEW SHIVAJI NAGAR,CHAUHAN PIYAU,THATIPUR 15-3-2016
3419 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST MUSLIM CHOWK, GUNJ MAIN ROAD , GULBARGA MOBILE: 9900969568 15-9-2015
3420 OSMANIA EDUCATIONAL SOCIAL AND CHARITABLE TRUST JALEEL COMPOUND ,PAYAN DARGA ROAD, GULBARGA 6-1-2016
3421 OSRA ENGINEERS PRIVATE LIMITED EB - 36, MAYA ENCLAVE, NEW DELHI - 110064 15-11-2013
3422 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE, NEAR SALES TAX SQURE, BERHAMPUR 27-6-2016
3423 OSTARD AT- BAIDYANATHA NAGAR 1ST LANE,NEAR SALE TAX SQUARE, BERHAMPUR 17-5-2016
3424 OUR HELPINGHAND DB BLOCK 15 F, 3RD FLOOR LIG FLATS HARI NAGAR NEW DELHI. PHONE 09266669832 11-11-2014
3425 OUTREACH NO.205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BANGALORE 11-1-2016
3426 OUTREACH OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVELOPMENT 205,HBR LAYOUT 2ND BLOCK,80 FEET ROAD,1ST STAGE EXTN,BANGALORE-560043 17-9-2015
3427 OUTREACH ASSOCIATION OF VOLUNTEERS FOR RURAL DEVLP NO, 205, 1ST STAGE EXTENSION, 2ND BLOCK, HBR LAYOUT, BENGALURU 15-1-2016
3428 OXFORD ACADEMY EDUCATIONAL AND DEVELOPMENT TRUST 1ST FLOOR, AJS COMPLEX, SALEM MAIN ROAD, RAMAN NAGAR, RAMAN NAGAR POST,METTUR TALUK, SALEM DIST, TAMILNADU 23-10-2015
3429 OZONE PHARMACEUTICALS LTD 1,LSC,BLOCK A-3 JANAKPURI NEW DELHI(INDIA) 4-10-2013
3430 PAAVENDHAR INDUSTRIAL SCHOOL RUN BY SIT TRUST NO 17 & 18 SASTRI NAGAR, VARATHARAJAPURAM VILLAGE, MUDICHUR ROAD, CHENNAI 11-9-2015
3431 PACE EDUCATIONAL AND WELFARE SOCIETY PLOT NO. H1-5, ROAD NO. 4, BEHIND CITY MALL, IPIA, KOTA 14-9-2015
3432 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR, TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA 4-4-2016
3433 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY D.NO.1-9-837, WEEKLY BAZAR,TIRUMALA TALKIES 'X' ROAD, NIAMABAD DISTRICT TELANGANA STATE 29-2-2016
3434 PACE IT AND EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 TOP OF HIND BAKERY WEEKLY BAZAR TIRUMALA TALKIES X ROAD NIZAMABAD DISTRICT TELANGANA STATE 16-3-2016
3435 PACE IT EDUCATIONAL INSTITUTIONS SOCIETY H.NO.1-9-837 , TOP OF HIND BAKERY, TIRUMALA TALKIES X ROAD, POCHAMMGALLY NIZAMABAD DISTRICT, TELANGANA STATE 4-1-2016
3436 PACER SECURE SERVICES PRIVATE LIMITED PLOT NO.62, BLOCK‐C, DWARKA VIHAR, BHUPENDER NAGAR, NEAR CRPF CHOWK, DWARKA, SECTOR‐16, NEW DELHI 17-9-2015
3437 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM 18-9-2015
3438 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT, P.O- R P ROAD, HAILAKANDI 11-9-2015
3439 PACIFIC INSTITUTE OF TECHNOLOGY AND MANAGEMENT N. S ROAD, W/N-12 (NEAR OLD HOSPITAL POINT) P.O- R P ROAD, HAILAKANDI-788155, ASSAM 28-9-2015
3440 P A C RAMASAMY RAJA POLYTECHNIC COLLEGE K.R. NAGAR POST, RAJAPALAYAM - 626108 VIRUDHUNAGAR DISTRICT, TAMILNADU, INDIA. 17-9-2015
3441 PADMA CHANDWANI HOUSE NO. I B5, OPP. AMBDKARPARK, PRATAPNAGAR JODHPUR 12-1-2016
3442 PADMARANJEETA EDUCATION TRUST AUROBINDA NAGAR JEYPORE KORAPUT ODISHA 13-11-2014
3443 PADMASHRI ANNASAHEB JADHAV BHARATIYASAMAJ UNN MAN PADMASHRI ANNASAHEB JADHAV BHARATIYA SAMAJ UNNATI MANDAL, DHAMANKAR NAKA, COLLEGE ROAD, BHIWANDI 28-1-2016
3444 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE MATLODA DISTT HISAR 21-9-2016
3445 PALI TRUST PEOPLE AND ANIMAL LIVE INTIMATELY TRUST REGD OFFICE VPO MATLODA TEHSIL BARWALA CORP OFFICE NH 52, HISAR MAIN ROAD BARWALA HISAR 12-9-2016
3446 PALLAVI EDUCATIONAL SOCIETY 94 S D ROAD, MINERVA COMPLEX, 7TH FLOOR, SECUNDERABAD 16-4-2015
3447 PALMA MAHALIR SUYAUTHAVIKUZHU KOOTTAMAIPPU 11/61/1, VELLIVILAGAM, CHANGAI, KANJIRACODE P O. MARTHANDAM 16-6-2016
3448 PALMYRAH WORKERS DEVELOPMENT SOCIETY PALMYRAH WORKERS DEVELOPMENT SOCIETY 11, KENNET CROSS ROAD NEW ELLIS NAGAR MADURAI TAMILNADU 11-9-2015
3449 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM 28-1-2016
3450 PALMYRAH WORKERS DEVELOPMENT SOCIETY PWDS CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT TAMIL NADU 9-2-2016
3451 PALMYRAH WORKERS DEVELOPMENT SOCIETY CRYSTAL STREET MARTHANDAM KANNIYAKUMARI DISTRICT 15-1-2016
3452 PANASIA LEARNING AND SKILLS PRIVATE LIMITED DHALIPARA, KRISHNAPUR, MOHISHGOTE, RAJARHAT, NEWTOWN, KOLKATA, WEST BENGAL 5-9-2016
3453 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR. 23-6-2016
3454 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR 9-5-2016
3455 PANCHANAN JENA MEMORIAL TRUST SWASTIK NAGAR, KESORA, BANKUAL, BHUBANESWAR 22-4-2016
3456 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O – BANHARISHPUR , P.S – PANCHLA , DIST – HOWRAH , PIN – 711322 (WB),INDIA 6-12-2016
3457 PANCHLA NABAJAGARAN WELFARE SOCIETY VILL- SAMANTI, P.O- BANHARISHPUR, P.S- PANCHLA, DIST- HOWRAH, PIN- 711322, WEST BENGAL, INDIA 23-12-2016
3458 PANCHWATI PRAYOGSHALA PRIVATE LIMITED VILLAGE-KISHANPURA,SAHRANPUR ROAD,ROORKEE 17-7-2014
3459 P AND A ADVERTISING AGENCY PRIVATE LIMITED C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK, ODISHA-753014 CAMPUS AT : TAMANDO, NEAR NH-5, BHUBANESWAR, ODISHA 28-9-2015
3460 P AND A ADVERTISING AGENCY PRIVATE LIMITED PLOT NO. C/1290, SECTOR-VI, CDA, BIDANASI, CUTTACK-753014, ORISSA. INDIA 8-12-2015
3461 P AND A ADVERTISING AGENCY PRIVATE LIMITED HEAD OFFICE : C/1290, 1ST FLOOR, CDA, SECTOR-VI, CUTTACK, ODISHA CAMPUS OFFICE : BNI COLLEGE CAMPUS, TAMANDO, NEAR NH5, BHUBANESWAR 14-9-2015
3462 PANDAVA EDUCATIONAL TRUST PANDAVA EDUCATIONAL TRUST,PLOT NUMBER 32,3RD FLOOR,ABOVE ALLAHABAD BANK,BLOCK-C,SECTOR-14,KAUSHAMBI,GHAZIABAD 15-1-2016
3463 PANDAV EDUCATION TRUST 3137/5 DELHI-SAHARANPUR HIGHWAY,HASSANPUR MASSURIE KHEKRA 16-2-2016
3464 PANDAV EDUCATION TRUST 3137/5 MASSORIE LINK ROAD,KHEKRA,BAGHPAT 22-2-2016
3465 PAN INFOTECH CLASSIC TOWERS , OPPOSITE JAWAHAR THEATRE , KOTHAMANGALAM , ERNAKULAM DISTRICT, KERALA 30-4-2015
3466 PANKH PARIDHI FOUNDATION 362 E, R K PURAM KOTA RAJASTHAN 22-6-2016
3467 PANKH PARIDHI FOUNDATION 362 E RK PURAM KOTA RAJASTHAN 30-5-2016
3468 PARAM BHAGWAT SHIKSHA AVAM SAMAJIK VIKAS SANSTHAN NIFESM A 122-123, VIJAY NAGAR, NEAR KARTARPURA PHATAK, JAIPUR (RAJASTHAN) 15-9-2015
3469 PARA MEDICAL EDUCATION ASSOCIATION AND SOCIAL SERV PARA MEDICAL EDUCATION ASSOCIATION AND SOCIAL SERVICE SOCIETY, IPSR, 12 SATBARI, CHHATARPUR, NEW DELHI-74 7-9-2016
3470 PARA MEDICAL TECHNOLOGY SOCIETY OF INDIA B-20,NEW ASHOK NAGAR, DELHI 14-9-2015
3471 PARAM ENTERPRISES COMMERCIAL NO-405, 4TH FLOOR, COMMUNITY CENTRE, WAZIRPUR INDUSTRIAL AREA, NEW DELHI 8-6-2016
3472 PARAM ENTERPRISES SOUTH GAUTAM NAGAR FATEHPUR 8-6-2016
3473 PARAMHANS COMPUTER EDUCATION CENTRE NEELKANTH COMPLEX, OPP. SBI BANK, PILANI ROAD, CHIRAWA 22-12-2013
3474 PARAMHANS EDUCARE PRIVATE LIMITED NEELKANTH COMPLEX, IN FRONT OF SBI, PILANI ROAD, CHIRAWA, DISTT. - JHUNJHUNU (RAJ.) 6-4-2015
3475 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK, NEAR BADA GANPATI, INDORE, (M.P.) 27-9-2016
3476 PARAM PUJYA RAKSHAK AADINATH WELFARE AND EDUCATIONAL SOCIETY PRAWES 453, MALHARGANJ, ABOVE UNION BANK NEAR BADA GANAPATI, INDORE (M.P.) 27-10-2016
3477 PARANA SHANTI PANDEY SHAIKSHANIK AVAM SAMAJIK SANS 92,JAWAHAR MARG,NANDLALPURA SQUARE, INDORE 12-9-2015
3478 PARAS WELFARE FOUNDATION MAIN BAZAR NEAR BUS STAND BAMINL, DISTRICT GURDASPUR, STATE PUNJAB PIN NO- 15027 28-9-2015
3479 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA 15-3-2016
3480 PARDA WARD NO 6 RADHAKRISHNAPADA NUAPADA ODISHA 6-4-2016
3481 PARDA RADHAKRISHNAPADA, WARD NO 6 NUAPADA 766105 ODISHA 30-8-2016
3482 PARIMALA PANDURANGAN EDUCATIONAL TRUST OLD NO.27, CHETTY STREET, NEW NO.53, KAMARAJAR STREET,WALAJAPET, WALAJAPET TALUK, VELLORE DISTRICT TAMILNADU 13-9-2015
3483 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE,RAILWAY RESERVATION ROAD, DELHI 15-3-2016
3484 PARITY INFOTECH SOLUTIONS PVT LTD 201, HARGOBIND ENCLAVE, RAILWAY RESERVATION ROAD, DELHI 16-3-2016
3485 PARIVARTAN EDUCATION RESEARCH AND WELFARE SOCIETY RZ-A-50, RAJU EXTENSION, KAKROLA VILLAGE, DELHI 110078 29-4-2015
3486 PARIVARTAN SEWA EVAM SHIKSHA SAMITI PARIVARTAN SEWA EVAM SHIKSHA SAMITI HOUSE NO. 69, BANK NAGAR ASHOKA GARDEN, BHOPAL MADHYA PRADESH 15-2-2014
3487 PARIVARTHANA GRAMEENA ABHIVRUDHI SAMSTHE #8/1,VIGNESHWARA NILAYA, VISHVESHWARA NAGAR, MYSORE 7-10-2016
3488 PARTICIPATORY RURAL DEVELOPMENT INITIATIVES SOCIET PLOT NO: 230, SHIVA NAGAR COLONY, NEAR DONALD HIGH SCHOOL, HYDERGUDA, HYDERABAD - 500048 9-11-2013
3489 PARYAVARAN EVAM JAN KALYAN SAMITI NEAR HPS SCHOOL, HALDWANI RAOD, BANDIA, KICHHA, UDHAM SINGH NAGAR (UTTARAKHAND) 20-7-2016
3490 PARYAVARAN SHAIKSHIK VIKAS SANSTHAN 19 FF AAROHI BUILDING CHOWK LUCKNOW 26-3-2014
3491 PASCHIM BANGA MANAB KALYAN BIKASH KENDRA 12/3, BROJONATH LAHIRHI LANE, NEAR BUXARAH MINI BUS STAND, HOWRAH - 711 104, WEST BENGAL 22-7-2016
3492 PASUMAI ULAGAM 204 1ST FLOOR VARI ENTERPRISES SKC ROAD SURAMPATTI NALL ROAD ERODE 2-3-2016
3493 PASUMAI ULAGAM 204, SKC ROAD, 1ST FLOOR VARI ENTERPRISES SURAMPATTI NALL ROAD, ERODE 15-3-2016
3494 PATEL COMPUTER EDUCATION TRUST OPP : NEW BUS STAND SANALA ROAD 4-8-2015
3495 PATEL COMPUTERS EDUCATION SYSTEMS PVT LTD 312, ASHISH COMPLEX, NEAR ASTRON CHOWK, SARDARNAGAR MAIN ROAD, RAJKOT, GUJARAT 22-4-2015
3496 PATEL EDUCATION SOCIETY 103-104, ORBIT MALL, AB ROAD, INDORE. 11-3-2016
3497 PATHBREAKERS SERVICES PVT LTD 304,EROS BUILDING-56 , NEHRU PLACE NEW DELHI 13-1-2014
3498 PATIALA SOCIETY OF EDUCATION CMT COLLEGE,SHANTI NAGAR,BEHIND URBAN ESTATE PHASE 2,PATIALA 4-3-2016
3499 PAWAN GYAN VIGYAN SANSTHAN 17,PAWAN KUNJ COLONY, KAMAN, BHARATPUR,RAJASTHAN 19-7-2016
3500 PAWAN GYAN VIGYAN SANSTHAN 17, PAWAN KUNJ COLONY, KAMAN, BHARATPUR, RAJASTHAN 18-7-2016
3501 PAWANSUT SARVANGIN VIKASH KENDRA PSVK C/O GANDHI MEMORIAL PUBLIC SCHOOL,AKORHIGOLA,ROHTAS. 17-1-2017
3502 PAWANSUT SERVANGIN VIKASH KENDR 262/574, HOUSE OF SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O,PATNA, BIHAR 6-1-2016
3503 PAWANSUT SERVANGIN VIKAS KENDRA 262/574, H/O SRI SURESH DUTTA MISHRA, CHANDPUR BELA, G.P.O, PATNA, BIHAR 12-1-2016
3504 PCI EDUCATIONAL TRUST SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PURA JAMMU 181102 11-1-2016
3505 PCR INVESTMENTS LIMITED 19, BISHOP GARDENS, RAJA ANNAMALAI PURAM, CHENNAI - 600 028 14-10-2015
3506 PC TRAINING INSTITUTE LIMITED RU-7, 2ND FLOOR, RU BLOCK DDA COMMERCIAL COMPLEX, OUTER RING ROAD, PITAMPURA, DELHI 14-8-2015
3507 PEACE TRUST NEAR POLICE HOUSING COLONY, TRICHY ROAD, DINDIGUL 14-3-2016
3508 PENTACLE SYSTEMS PRIVATE LIMITED HOUSE NO-6, BYE LANE-2, TARUN NAGAR, ABC, GUWAHATI 17-9-2015
3509 PENTAGON INSTITUTE FOR PROFESSIONAL STUDIES P LTD 743, LAKHANPUR HOUSING SOCIETY, AWADHPURI DOUBLE ROAD, VIKAS NAGAR KANPUR. UP 6-9-2015
3510 PENTAGON RUGGED SYSTEMS 5TH FLOOR, 11-5-397, SAFA APARTMENT, REDHILLS 6-5-2016
3511 PEOPLE CARE FAMILY B BLOCK, 3RD FLOOR, JAGDAMBA TOWER, SAHDEO MAHATO MARG, BORING ROAD, PATNA 11-11-2014
3512 PEOPLE RECONSTRUCTION AND GENDER ACTIVITY TRAINING HEALTH INSTITUTE NO.24, VALLIKANDHAN NAGAR,THOTTAPATTU, NATHAPATTU POST, VARAKKALPATTU VIA, CUDDALORE TALUK. 14-9-2015
3513 PEOPLES ACTION SERVICE SOCIETY 4/74 SANGILIYANDAPURAM PETTAVAITHALAI.POST SHRIRANGAM.TALUK TRICHY.DISTRICT TAMILNADU 6-1-2016
3514 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT NO 68/5 FIRST CROSS BALAJI NAGAR AMMAPET SALEM 636003 TAMILNADU 13-9-2015
3515 PEOPLES EDUCATION AND COMMUNITY EMPOWERMENT THE SECRETARY # 68/5 1ST CROSS, BALAJINAGAR AMMAPET, SALEM 636003 TAMILNADU SOUTH INDIA 6-4-2016
3516 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA 13-9-2015
3517 PEOPLES FORUM 44-DHARMAVIHAR, KHANDAGIRI, BHUBANESWAR, ODISHA BLOCK: BHUBANESWAR DISTRICT: KHORDHA STATE: ODISHA PIN: 751030 23-10-2015
3518 PEOPLES GENERAL ASSOCIATION H.NO. 16 DEEPAK SOCIETY CHUNNA BHATTI KOLAR ROAD 11-8-2014
3519 PEOPLES INSTITUTE FOR DEVELOPMENT AND TRAINING PIDT LOKSHALA P/O JAGDISHPUR, VIA MADHUPUR 2-6-2014
3520 PEOPLES SCIENCE INSTITUTE 653 INDIRA NAGAR 27-4-2015
3521 PEOPLES SERVICE SOCIETY PALAKKAD DIOCESAN PASTORAL CENTRE, CHAKKANTHARA, PALLIPPURAM POST, PALAKKAD, KERALA, SOUTH INDIA 3-4-2014
3522 PEOPLES TRUST IN TECHNICAL INSTITUTE 7TH ARUMUGAM NORTH STREET,4TH KARPAGANAGAR NORTH, THIRUMANGALAM TALUK, MADURAI DISTRICT 14-9-2015
3523 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS, NEAR GREENLAND ,LABBIPETA VIJAYAWADA , KRISHNA DT 10-11-2016
3524 PEOPLEWELFARESOCIETY 40-15-9/2 ABILASH APPTS ,NEAR GREENLAND ,LABBIPETA 17-1-2017
3525 PEOPLEWELFARESOCIETY 40-15-9/2 F3, ABILASH APPTS , NEAR GREENLAND ,LABBIPETA ,VIJAYAWADA. 29-11-2016
3526 PERCEPTION MANAGEMENT CONSULTING PRIVATE LIMITED B-1000, ANSAL PALAM VIHAR, GURGAON, HARYANA 8-12-2013
3527 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON, HARYANA 17-5-2016
3528 PEREGRINE GUARDING PRIVATE LIMITED PLOT NO 301, SCO COMPLEX, SECTOR 29, GURGAON 14-9-2015
3529 PHD RURAL DEVELOPMENT FOUNDATION PHD HOUSE, 4/2, SIRI INSTITUTIONAL AREA, AUGUST KRANTI MARG, NEW DELHI 2-4-2014
3530 PHILOGY CONSULTING SERVICES PRIVATE LIMITED 25, VASANT VIHAR, PHASE 1, DEHRADUN, UTTARAKHAND 10-11-2013
3531 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAND ROY ROAD, KOLKATA, WEST BENGAL. 1-9-2016
3532 PIED PIPER MARKETING SERVICES LLP 38/29 BHUBAN MOHAN ROY ROAD, KOLKATA, WEST BENGAL. 2-9-2016
3533 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED PLOT NO. 245, ROAD NO. 12, PRASHASAN NAGAR, JUBILEE HILLS, HYERABAD 5-10-2016
3534 PINKS N BLOOS BEAUTY SALOONS PRIVATE LIMITED CENTURY PARK, PLOT NO.245, ROAD NO.12, PRASHASAN NAGAR, JUBILEE HILLS, HYDERABAD 3-11-2016
3535 PIONEER AUTOMOTIVE EQUIPMENTS PVT LTD H-27, SITE C, UPSIDC INDUSTRIAL AREA, SURAJPUR, GREATER NOIDA, GAUTAM BUDH NAGAR 10-11-2016
3536 PIONEER DESIGN AND ENGINEERING PVT LTD #844, 2ND CROSS, 7TH MAIN, HAL 2ND STAGE, INDIRA NAGAR 6-4-2016
3537 PIONEER SECURITY AND ALLIED SERVICES P LIMITED 212,"CIRCLE P BUILDING"NR PRAHALAD NAGAR GARDEN, S.G.ROAD, SATELITE AHMEDABAD 30-9-2013
3538 PIONEER TRAD 100, PERIYA COLONY, VADAMADURAI, ELAPURAM BLOCK, UTHUKOTTAII TALUK, THIRUVALLORE DISTRICT 30-8-2016
3539 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM 12-9-2016
3540 PIONEER TRAD NO.100,PERIYACOLONY, VADAMADURAI, ERNANKUPPAM VILLAGE 22-7-2016
3541 PIONEER TRAD NO.100, PERIYACOLONY, VADAMADURAI, ERNAKUPPAM VILLAGE 13-5-2016
3542 PIONEER TRAD 31, FIRST STREET, KRISHNADOSS ROAD, MANGALAPURAM 27-9-2016
3543 PIPAL TREE VENTURES PRIVATE LIMITED A/202,RADIUM APARTMENT , AAREY ROAD, GOREGAON (EAST), MUMBAI, MAHARASHTRA 400 063 3-10-2013
3544 PIRENS LONI BK. TAL-RAHATA,DIST-AHMEDNAGAR 11-5-2016
3545 PIRENS LONI BK,TAL-RAHATA,DIST-AHMEDNAGAR,STATE-MAHARASHTRA 23-5-2016
3546 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, ENGLISH BAZAR P.S : ENGLISHBAZAR PO & DIST : MALDA 29-8-2016
3547 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR, P.S : ENGLISH BAZAR P.O & DIST : MALDA 12-8-2016
3548 PIROJPUR YOUTH VOCATIONAL TECHNICAL INSTITUTE OLD SALE TAX BUILDING PIROJPUR PO & DIST : MALDA 26-8-2016
3549 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.) 26-9-2016
3550 PITHAMPUR AUTO CLUSTER 126, KANCHAN BAGH, INDORE (M.P.) 7-9-2016
3551 P L ACADEMY 5/1, HERAMBA DAS LANE, KOLKATA- 700 009, WEST BENGAL,INDIA 10-2-2015
3552 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN KATRAS ROAD , DHANBAD 15-3-2016
3553 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD 404. VINAYAK BHAWAN , KATRAS ROAD , DHANBAD 29-2-2016
3554 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD 16-3-2016
3555 PLANET EDUCATION AND SKILL DEVELOPMENT PVT LTD HOUSE NO-404 , VINAYAK BHAWAN , KATRAS ROAD DHANBAD 14-3-2016
3556 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE 26-8-2016
3557 PLANET INTERACTIVE PRIVATE LIMITED GURUKUL CAMPUS, BEHIND MCDONALDS, GOKHALE ROAD, THANE, MAHARASHTRA 12-9-2016
3558 PLANET KERALA TD UMMER QUARTERS, CHATTANCHAL, THEKKIL PO, KASARAGOD DISTRICT, KERALA, INDIA 13-1-2014
3559 PLATANUS TECHNOLOGY PVT LTD #31.9/C4 1ST FLOOR NIMISHAMBA BUILDING, OPP 10TH BMTC BUS DEPOT, HENNUR MAIN ROAD, KALYAN NAGAR, BANGALORE – 560043 13-9-2015
3560 PLN9 SECURITY SERVICES PVTLTD PLN9 SECURITY SERVICES PVT. LTD,IIND FLOOR, SUN TOWER,MG ROAD GURGAON PH.: 0124-4257500 22-1-2014
3561 PLNS EDUCATORS PRIVATE LIMITED 15/362, Mary Naidu Street, Subedarpet, Nellore 7-1-2016
3562 PLUTUS INFO EDUTECH PRIVATE LIMITED H NO. A-67, KH NO. 469/1, GROUND FLOOR, INDIRA ENCLAVE, NEB SARAI NEW DELHI 18-6-2015
3563 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI 9-12-2016
3564 PMG COMMERCE EDGE FOUNDATION 39/41 FIRST FLOOR RING MARKET BIDA RAJPURA UTTAR PRADESH BHADOHI 16-12-2016
3565 PNRSOL TECHNOLOGIES PVTLTD GURU KRIPA SADAN , NEAR SHIV MANDIR, VINAYAK VIHAR COLONY, KANKARDA, BHUNABAY, AJMER 13-1-2017
3566 PODDAR SANSTHAN PODDAR SANSTHAN, SECTOR 7, MANSAROVAR, JAIPUR 30-1-2014
3567 PODDAR TRUST PODDAR SANSTHAN, SECTOR 7, MANSAROVAR, JAIPUR 23-12-2013
3568 PONDICHERRY MULTIPURPOSE SOCIAL SERVICE SOCIETY PMSSS, 81, LAPORTE STREET, PONDICHERRY 13-11-2014
3569 PONNAIYAHRAMAJAYAMINSTITUTEOFSCIENCEANDTECHNOLOGY PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU 26-4-2016
3570 POSITIVESHIFT CHANGE CONSULTING PVT LTD 201 HUDA TECHNO ENCLAVE, PLOT NO. 21, SECTOR 3, OPP. RAHEJA MINDSPACE, HI-TECH CITY LAYOUT, MADHAPUR, HYDERABAD - 500081, INDIA. 2-2-2015
3571 POSSIT SKILL ORGANISATION POSSIT SKILL ORGANISATION E-4, SECOND FLOOR, SOUTH EXTENSION PART -I NEW DELHI 110049 26-2-2016
3572 POTHANA EDUCATIONAL SOCIETY H.NO; 2-5-882, 1ST FLOOR, CIRCUIT HOUSE ROAD, HANAMA KONDA, 27-11-2013
3573 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP 21-9-2015
3574 POWER TO EMPOWER SKILLS PRIVATE LIMITED 128, PAKKA TALAB CHAURAHA, ETAWAH, UP 28-9-2015
3575 POWER TO EMPOWER SKILLS PRIVATE LIMITED 211 A AWAS VIKAS COLONY ETAWAH UP 15-9-2015
3576 POWER TRAIN OVERSEAS TRAINING PRIVATE LIMITED 507, SHAH AND NAHAR ESTATE, DR. E. MOSES ROAD, WORLI NAKA, MUMBAI 14-9-2015
3577 PRABAHA DHALAI KULAI, DHALAI, TRIPURA 2-5-2014
3578 PRABARTAK TRUST 1 NO OLD NIMTA ROAD, BELGHARIA, KOLKATA-700056 17-9-2015
3579 PRABODHAN BAHUUDDESHIYA SANSTHA FIRST FLOOR, VITTHAL PARK , GANGAPUR ROAD, NEAR ASHOK STAMBH, NASHIK,MAHRASHTRA, INDIA 14-3-2016
3580 PRABODHAN BAHUUDDESHIYA SANTHA VITTHAL PARK, 1ST FLOOR, GANGAPUR ROAD, NASHIK 2-3-2016
3581 PRABODHAN BAHUUDESIYA SANSTHA FIRST FLOOR, VITTHAL PARK, GANGAPUR ROAD, NEAR ASHOK STAMBH,NASHIK 6-4-2016
3582 PRACHITI COMPUTERS 201-213, YASHWANTRAO CHAVAN COMPLEX, ASHOK HOTEL CHOWK, MAIN ROAD, LATUR, MAHARASHTRA 15-9-2015
3583 PRACSOL TECHNOLOGIES INDIA PRIVATE LIMITED MERLIN INFINITE, #1201 DN-51, SECTOR V, SALT LAKE 5-9-2016
3584 PRADAN E-1/A, KAILASH COLONY 17-7-2014
3585 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN BAHUDDESHIYA SAMAJ SEVA SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD 19-1-2017
3586 PRADNYA SHRAMAN SARSWATACHARYA DEVNANDIJI JAIN B S S SANSTHA BARSHI NAKA OSMANABAD 5-1-2017
3587 PRAFULLA CHANDRA INSTITUTE OF TECHNOLOGY AT-JAGANNATHPUR, PO/VIA/PS/DIST-BHADRAK 21-8-2014
3588 PRAGATI BAHUUDDESHIYA SHIKSHAN SANSTHA NEAR PCPOINT COMPUTER EDUCATION GOREGAON, MAIN ROAD GOREGAON 3-3-2016
3589 PRAGATI CHARITABLE TRUST PLOT NO.- 66 , GOPINATH PUR, DHAULI, BHUBANESWAR,ODISHA 5-1-2016
3590 PRAGATI EDUTECH PVT LTD BUDHIN BHAWAN,NEAR JONALI BUS STOP, R G BARUAH ROAD, GUWAHATI, ASSAM 17-9-2015
3591 PRAGATI FOUNDATION OM NAGAR ENTRANCE, VIDYAGIRI, DHARWAD 5-9-2014
3592 PRAGATI GRAMIN VIKAS SANGATHAN AT PO - WAT PS - MADANPUR DIST- AURANGABAD STATE - BIHAR 15-2-2014
3593 PRAGATI PARIWAR SOCIETY PAHARI MANDIR LANE, RATU ROAD, RANCHI 19-5-2014
3594 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON GUWAHATI ( NEAR PRAGJYOTISH SCHOOL) 781033 16-10-2015
3595 PRAGJYOTISH SCHOOL SOCIETY WEST,BORAGAON,NEAR PRAGJYOTISH SCHOOL,GUWAHATI,ASSAM 31-12-2015
3596 PRAGMATIC EDUCATIONAL SOCIETY D-452,PALAM EXTENSION SECTOR 7,DWARKA,NEW DELHI 7-11-2013
3597 PRAGYA NETWORK EDUCATIONAL SOCIETY 65, PANA UDYAN, NARELA, DELHI 5-9-2014
3598 PRAKALGRAST KALYANKARI SAMITEE KMJ HOSPITAL ROAD, SSHASTRI WARD, GONDIA 10-11-2016
3599 PRAKASH AND COMPANY A-58 SECTOR-19 NOIDA 10-11-2014
3600 PRAKASH DEEP SEWA SANSTHAN B 86 INDIRA NAGAR AWAS VIKAS COLONY DISTT. RAEBARELI (U.P.) 4-1-2016
3601 PRAKHAR GYAN EDUCATIONAL AND SOCIAL WELFARE 153,I FLOOR.ORBIT MALL,INDORE.PIN 452010 3-4-2014
3602 PRAKHAR PRAGYA SHIKSHA PRASAR AVAM SAMAJ KALYAN SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH 28-9-2016
3603 PRAKHAR PRAGYA SHIKSHA PRASAR AVM SAMAJKALYANSMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH 7-9-2016
3604 PRAKHAR PRAGYA SHIKSHA PRASAR SMITI NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH 11-3-2016
3605 PRAKHAR PRAGYA SKHISHA PRASAR AVAM SAMAJ KALYAN SA NH 26, NARSINGHPUR ROAD, SIRONJA, SAGAR, MADHYA PRADESH 16-6-2016
3606 PRAKRITI FOUNDATION FOR NATURAL RESOURCES REGENERATION BHAGIRATH SOCIETY, JHALOD, DISTRICT - DAHOD, GUJARAT 9-4-2015
3607 PRAKRITI PARYAVARAN SANRAKSHAN SANSTHAN C-7, LDA MARKET, MANCHANDA HOUSE, ALAMBAGH, LUCKNOW 17-5-2016
3608 PRAKRITI PRYAVARAN SANRKSHAN SANSTHAN PPSS , MAHALLA-PUNJABI COLONY , NEAR RISHI ASHARAM ,BLOCK - LAXMIPUR , PIN -262701 UP 13-9-2015
3609 PRAKSHAL INFOTECH PRIVET LIMITD U/L OM TOWER , NR. STAR BAZAR, JODHPUR CROSS ROAD, SATELLITE 3-4-2014
3610 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD 15-1-2016
3611 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD 12-1-2016
3612 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD 30-11-2015
3613 PRAMODINI EDUCATIONAL AND CHARITABLE TRUST 1297/2739, SARADA NIWAS , KAPILPRASAD 7-1-2016
3614 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCI 14 MITRA NIWAS ROAD , NEAR UCO BANK RATLAM (MP) 26-4-2016
3615 PRANJAL INFORMATION TECHNOLOGY SOCIAL WELFARE SOCIETY 14 MITRA NIWAS ROAD NEAR UCO BANK RATLAM 12-5-2016
3616 PRASEEDAS SKILL FOUNDATION CORP OFF:- FLAT NO 501, VAISHNAVI NEST, DILSUKHNAGAR, HYDERABAD 21-12-2015
3617 PRATHAM EDUCATION FOUNDATION H/O LATE VIDYA NATH OJHA, HOUSE NO.211, ROAD NO.2, NEAR UNITED BANK OF INDIA, PATLIPUTRA COLONY, PATNA 22-1-2014
3618 PRATHAP EDUCATIONAL SOCIETY H.NO. 11-107, VIVEKANANDANAGAR, HUZURABAD, DIST: KARIMNAGAR 21-7-2014
3619 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR 22-9-2016
3620 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOT 26-7-2016
3621 PRATHIBHA EDUCATIONAL WELFARE SOCIETY PEWS 20-150/2, NAIDU BUILDINGS, CHITTOOR TOWN, CHITTOOR 7-9-2016
3622 PRATHIBHE ORGANISATION E-44, 4TH A MAIN ROAD, E & F BLOCK, RAMAKRISHANA NAGAR, MYSROE -570022 28-10-2013
3623 PRATIBHA SYNTEX LTD PRATIBHA SYNTEX LTD. PLOT NO. 4 INDUSTRIAL GROWTH CENTER, KHEDA-454774 PITHAMPUR, DISTT DHAR (M P) INDIA 30-1-2014
3624 PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICA PRATIGYA INSTITUTION FOR PROFESSIONAL AND TECHNICAL SELF EMPLOYMENT TRAINING DEVI JI ROAD NEAR JAIN MEDICAL STORE RAILWAY STATION KOTMA 14-9-2015
3625 PRATIGYA VIKAS SANSTHAN DURG HOUSE NO. 231 BEHIND PANCHSHEEL ACADEMY MUKT NAGAR PADMANABHPUR DURG C.G. 18-9-2015
3626 PRATIKAR ITC CHAMPUA BLOCK, DIST KEONJHAR, ODISHA 4-8-2016
3627 PRATIKAR ITC OLD KERLA ENGLISH MEDIUM CAMPUS, CHMAPUA BLOCK, DIST KEONJAHR 27-6-2016
3628 PRATIKSHA HOSPITALS PRIVATE LIMITED PRATIKSHA HOSPITAL COMPOUND BARBARI, VIP ROAD GUWAHATI 17-9-2015
3629 PRAVARA INSTOF RESEARCH EDU IN NATURAL SOCIAL SCIE PRAVARA INSTITUTE OF RESEARCH AND EDUCATION IN NATURAL AND SOCIAL SCIENCES (PIRENS) LONI BK. TALUKA-RAHATA DISTRICT-AHMEDNAGAR (MAHARASHTRA) 15-6-2016
3630 PRAYAG DANT VIGYAN ANUSANDHAN SANSTHAN ADMIN OFFICE: DEVPRAYAG KNOWLEDGE CAMPUS PHAPHAMAU, ALLAHABAD 3-1-2014
3631 PRAYAS JAC PRAYAS JAC, 59, TUGHLAKABAD INSTITUTIONAL AREA, NEW DELHI 4-11-2013
3632 PREMA HITECH EDUCATION SOCIETY E-354, ROAD NO.- 14 J [ON CITY BUS ROUTE], V. K. I. AREA, JAIPUR 30-1-2014
3633 PREMAJYOTHI SOCIAL SERVICE CENTER OPP URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETORL BUNK,M.G.ROAD,RAVINDRA NAGAR,HASSAN 7-9-2016
3634 PREMAJYOTHI SOCIAL SERVICE CENTER OPP.URBAN WATER SUPPLY,SAVITHA SAMAJA BUILDING,BEHIND PETROL BUNK,M.G.ROAD, RAVINDRA NAGA, HASSAN 21-9-2016
3635 PREMIER CENTER FOR COMPETENCY TRAINING L-7,V.S.I. ESTATE,PHASE-I RAJIV GANDHI SALAI (OMR) THIRUVANMIYUR,CHENNAI. 1-7-2014
3636 PREMIER EDUCATION AND CHARITABLE TRUST PREMIER EDUCATION AND CHARITABLE TRUST,BISIAPADA,JATNI,BHUBANESWAR 3-2-2014
3637 PREMIERSHIELDPVTLTD A-282, OKHLA INDUSTRIAL AREA, PHASE-I 25-11-2013
3638 PRERANA RUGUDIPARA BALANGIR 6-7-2016
3639 PRERANA RUGUDIPARA NEAR BSNL OFFICE BALANGIR 6-9-2015
3640 PRERANA RUGUDIPARA BALANGIR ODISHA 12-9-2015
3641 PRERNA BAHUUDESHIYA SEVABHAVI SANSTHA KALPTARU, PLOT NO.-47, AYODHYA COLONY, LATUR-413531, MAHARASHTRA 11-11-2014
3642 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,OPP GATEWAY SCHOOL,SECTOR-12 9-12-2016
3643 PRERNA ENGINEERING EDUCATION GROUP PVT LTD 811,SECTOR-12,SONIPAT,HARYANA 14-12-2016
3644 PRESIDENCY EDUCATIONAL TRUST HOTEL ROYAL ORCHID COMPLEX 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA 16-9-2015
3645 PRESIDENCY EDUCATIONAL TRUST 1, GOLF AVENUE, AIR PORT ROAD, BANGALORE- 560008. INDIA 5-1-2016
3646 PRIM EDUCATIONAL AND CHARITABLE TRUST NO.6, 3RD FLOOR, NALLAIYAH NAGAR, THANJAVUR 12-9-2016
3647 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE. 30-9-2016
3648 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE. 12-9-2016
3649 PRIM ENGINEERING D.NO 1/237D-18, ANNA COLONY, POLLACHI ROAD, SIDCO INDUSTRIAL ESTATE, COIMBATORE. 22-8-2016
3650 PRISM EDUCATIONAL SOCIETY 6-3-801 4TH FLOOR DELTA CHAMBERS AMEERPET HYDERABAD 25-11-2014
3651 PRIST TRUST PONNAIYAH RAMAJAYAM INSTITUTE OF SCIENCE AND TECHNOLOGY TRUST, # 33&34, NATARAJAPURAM SOUTH, M.C. ROAD, THANJAVUR, TAMIL NADU 15-3-2016
3652 PRIYADARSHINI MAHILA MANDALI H NO 17-3-99 KAREEMABAD WARANGAL DIST WARANGAL TELANGANA 14-9-2015
3653 PRIYADARSHINI VOLUNTARY ORGANISATION 6-4-58/1/102,IQBAL RESIDENCY, MAJID ROAD,VANASTHALIPURAM, RANGAREDDY DIST-500070 3-3-2015
3654 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO. 30, II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANAGAR, BANGALORE 22-7-2016
3655 PRIYADHARSHINI CHARITABLE AND EDUCATIONAL TRUST NO 30,II FLOOR, 17TH MAIN, HOSPITECH HOUSE, VIJAYANGAR, BANGALORE 10-8-2016
3656 PRIYADHARSINI INSTITUTE OF ARTS AND CRAFTS 9/876, SIRUVANI MAIN ROAD, PERUR PACHAPALAYAM, COIMBATORE 3-2-2015
3657 PRIYANKA INSTITUTE OF VOCATIONAL EDUCATION NEAR S.B.I.,BOINDA,KISHORGANJA,DIST-ANGUL 26-3-2014
3658 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL 2-9-2016
3659 PROACTIVE FOUNDATION JG/1, KRISHNA APPARTMENT, ASWININAGAR, BAGUIATI, KOLKATA, WEST BENGAL 1-9-2016
3660 PROCADENCE EDUCATIONAL SOCIETY RIMMANAGUDA, GAJWEL, MEDAK 14-10-2016
3661 PROFASHION INSTITUTE OF FASHION TECHNOLOGY PLOT 80, 1-8-27/2, NORTH KAMALA NAGAR, ECIL CROSS ROAD, 17-9-2015
3662 PROFESSIONAL COMPUTER INSTITUTE SARAYAN SINGH COMPLEX 2ND FLOOR HDFC BANK BUILDING RS PORA JAMMU 5-1-2016
3663 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA 28-9-2015
3664 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA 18-9-2015
3665 PROFESSIONAL EDUCATIONAL AN SOCIAL WELFARE SOCIETY 2ND FLOOR , AKAR TOWER-B, OLD RTO ROAD, BHILWARA 14-9-2015
3666 PROFESSIONAL SKILLTRAINING AND CONSULTANCY PVT LTD 41/22,MANGAPATHY NAICKEN STREET, CHINDATRIPET, CHENNAI - 600002 4-12-2014
3667 PROFEX CONSULTANT AND DEVELOPERS PRIVATE LIMITED FLAT.102, 407/3 G.T.ROAD, BALLY,NIMTALA, HOWRAH, WEST BENGAL. 12-9-2016
3668 PROGRESSIVE ACTION FOR COMMUNITY EMANCIPATION PACE PROGRESSIVE ACTION FOR COMMUNITY EMANCIPATION (PACE) # 15-50, SREERAMULU STREET MADANAPALLE-517325, CHITTOOR (DIST) A.P. 21-9-2015
3669 PROLIFIC MIND CONSULTANTS PRIVATE LIMITED 1643 EAST END "A" MAIN ROAD,36TH CROSS JAYANAGAR 9TH BLOCK BANGALORE 15-11-2013
3670 PROLIFIC SYSTEMS ANDTECHNOLOGIES PVT LTD PLOT NO : A-267, MIDC, NEAR ESIS (KAMGAR) HOSPITAL, ROAD NO. 16-A, THANE INDUSTRIAL ESTATE, WAGLE ESTATE, THANE (W) - 17-11-2016
3671 PROMAG PROGRESSERS FACILITY SERVICES PRIVATE LIMITED NEW NO. 24, OLD NO.7, 1ST FLOOR, SADASIVAM STREET, GOPALAPURAM, CHENNAI - 600086 25-11-2014
3672 PROMATIC SYSTEMS AND SOFTWARE PRIVATE LIMITED 16, GANESH CHANDRA AVENUE, 1ST FLOOR, KOLKATA - 700 013 16-3-2016
3673 PROMIND SOLUTIONS PVT LTD C-43, SECTOR - 65 NOIDA 6-5-2016
3674 PROSOFT AUTOMATION AND EDUCATION 250, 3RD FLOOR, SAGAR PLAZA, ZONE-2 17-9-2015
3675 PROTATECH INTELLIGENCE MANPOWER PVT LTD B 104, PANCHSHEEL VIHAR, LEFT SIDE BASEMENT, BEHIND TRIVENI COMMERCIAL COMPLEX, NEW DELHI 22-1-2014
3676 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH 30-9-2016
3677 PROTEC COMPUTER EDUCATIONAL SOCIETY 48 C SINGAR NAGAR ALAMBAGH LUCKNOW 18-10-2016
3678 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI. 7-9-2016
3679 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI. 7-9-2016
3680 PROVIDERS SKILL ACADEMY PRIVATE LIMITED OLD NO.30, NEW NO.63, GANESH BUILDING 2ND FLOOR, VENKATANARAYANA ROAD, T.NAGAR, CHENNAI. 6-9-2016
3681 PROWINS AGRI SYSTEM TC9/1785(2), FIRST FLOOR PULLERKONAM LANE SASTHAMANGALAM THIRUVANANTHAPURAM 18-8-2016
3682 PRUTHVISANGRAM GRAMVIKAS SANSTHA AT/POST- KADEPUR TALUKA- KADEGON DISTRICT- SANGLI 26-7-2016
3683 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU COIMBATORE 13-9-2015
3684 PSGR KRISHNAMMAL COLLEGE FOR WOMEN PEELAMEDU, COIMBATORE 15-1-2016
3685 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA 8-9-2016
3686 PS GROUP REALTY LIMITED 83 TOPSIA ROAD (S),WEST BENGAL,KOLKATA 22-9-2016
3687 PS GROUP REALTY LIMITED TRINITY TOWER83,TOPSIA ROAD(S),KOLKATA 23-11-2016
3688 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN - 682024 16-11-2016
3689 PSN CONSTRUCTION EQUIPMENT PRIVATE LIMITED 34/126 A, N.H. 47 EDAPPALLY BYEPASS, EDAPPALLY P.O COCHIN, KERALA 1-11-2016
3690 PSS DEVNANDIJI JAIN BSS SANSTHA YASHVANT NAGAR BARSHI NAKA OSMANABAD 17-1-2017
3691 PSTS FOUNDATION 1-9/18 HARBOUR EXPRESS ROAD, OPP TO THERMAL CAMP I, TUTICORIN 21-7-2014
3692 P TECH EDUCATIONAL TRUST H N 349 SECTOR 9 AVAS VIKAS COLONY SIKANDRA AGRA 12-1-2016
3693 P TECH EDUCATIONAL TRUST H. NO.- 349, SECTOR 9, AVAS VIKAS COLONY, SIKANDRA ,AGRA 5-1-2016
3694 P TECH EDUCATIONAL TRUST H.NO.-349, SECTOR-9, AVAS VIKAS COLONY, SIKANDRA, AGRA 15-9-2015
3695 P TECH MICROSYSTEMS COLLEGE ROAD, NEAR HDFC BANK, OPP. PANCHALWADI, BILIMORA, TA. GANDEVI, DIST. NAVSARI 26-4-2016
3696 PUBLIC AND RARUL ENVIRONMENT SEVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI,TAMIL NADU 9-12-2016
3697 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21TVPERUMALKOVILSTREET MANAMADURAI SIVAGANGAI TAMILNADU 16-11-2016
3698 PUBLIC AND RURAL ENVIORONMENT SERVICE SOCIETY 21, TV PERUMAL KOVIL STREET, MANAMADURAI SIVAGANGAI TAMILNADU 28-10-2016
3699 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI-630606,SIVAGANGAI(DIST),TAMIL NADU 13-1-2017
3700 PUBLIC AND RURAL ENVIRONMENT SERVICE SOCIETY 21,T.V.PERUMAL KOVIL STREET,MANAMADURAI,SIVAGANGAI(DIST),TAMILNADU 14-12-2016
3701 PUNARUTHAN C/O DR SK UPADHYAY RUDRAKSH BHAWAN RAMNAGAR ANDER ROAD SIWAN 18-6-2015
3702 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, 12-9-2015
3703 PUNJAB MEDICAL INSTITUTE OF NURSING AND HOSPITAL G.T.ROAD, NEAR PETROL PUMP, SURANUSSI, JALANDHAR 28-9-2015
3704 PUNJAB RENEWABLE ENERGY SYSTEMS PVT LTD PUNJAB RENEWABLE ENERGY SYSTEMS PVT LTD J-105, TOWER NO 7, BELAPUR RAILWAY STATION COMMERCIAL COMPLEX, BELAPUR RAILWAY STATION, CBD BELAPUR NAVI MUMBAI 400 614 4-8-2016
3705 PURBA CONTAI SOCIAL ORGANIZATION DIGHA BY PASS, DHANDIGHI, CONTAI, PURBA MEDINIPUR, WEST BENGAL 4-8-2016
3706 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESHBANDHU ROAD, PURULIA 12-5-2016
3707 PURULIA INFORMATION TECHNOLOGY SOCIETY MANDIR MARG, DESH BANDHU ROAD, PURULIA 26-7-2016
3708 PURUSOTTAM EDUCATIONAL RESEARCH LOKASEVA CHARITABLE TRUST B11 CHANDAKA INDUSTIRAL ESTATE,PATIA POST-KIIT BHUBANESWAR DIST-KHORDA ODISHA 15-1-2015
3709 PUSHKAL INSTITUTE OF ANIMATION PVT LTD 471-472, HANUMAN NAGAR EXTN., VAISHALI NAGAR, JAIPUR 3-2-2014
3710 PYARI DEVI MEMORIAL TRUST SALARPUR RASULGARH SARNATH VARANASI UTTAR PRADESH 221007 8-9-2014
3711 QED INDIA QED INDIA,PORVORUIM PANJIM GOA 5-4-2016
3712 QUALITY CARE INDIA LIMITED 8-2-595/2/B, ROAD NO. 10 BANJARA HILLS HYDERABAD – 500034 17-8-2016
3713 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED NO.7D, DAFFODIL CEEBROS GARDEN, 38 ARCOT ROAD, VIRUGAMBAKKAM, CHENNAI 23-11-2016
3714 QUEENTIA SKILLS AND ALLIED SERVICES PRIVATE LIMITED 48/5 ARCOT ROAD, MAJESTIC STUDIO COMPLEX, NO.2O, MAJESTIC GARDEN, SALIGRAMAM,CHENNAI 11-11-2016
3715 QUESS CORP LTD #27,4TH FLOOR,SV TOWERS, KORAMANGALA 6TH BLOCK, BANGALORE 22-6-2015
3716 QUESTCOM VILL+PO- SAGRAI, PS- KHANDAGHOSH DIST- BURDWAN, WEST BENGAL -713424 23-11-2016
3717 QUILON SOCIAL SERVICE SOCIETY FATHIMA ROAD ,KOLLAM,KERALA 11-11-2014
3718 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X-1,2,&3, SECTOR-V, SALT LAKE CITY, KOLKATA 11-11-2016
3719 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 1-2&3, SECTOR V ,SALT LAKE, KOLKATA 30-11-2016
3720 QUIPPO CONSTRUCTION EQUIPMENT LTD DPSC BUILDING, BLOCK EP, PLOT NO X 12& 3, SECTOR V ,SALT LAKE, KOLKATA 9-12-2016
3721 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA 11-5-2016
3722 QUIVAN SKILL EMPOWERMENT PRIVATE LIMITED N.N. SAMADDAR ROAD, TALBANDA, PO - JUGBERIA, PS - GHOLA, KOLKATA 27-4-2016
3723 QUSTN TECHNOLOGIES PRIVATE LIMITED E-14 B SECTOR 8 NOIDA 201301 UP 9971177231 13-9-2015
3724 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA 6-4-2016
3725 RAAH DO KADAM MANJIL KI OR SELPAR SADAN, TALWANDI RANA, HISAR, HARYANA 26-4-2016
3726 RACE EDUCATION AND MANAGEMENT SOLUTIONS PVT LTD 6TH FLOOR, MAX BUSINESS BAY, VYTILA 24-6-2016
3727 RACHIT EDUTECH PVT LTD FLAT 290 BLOCK 13, KACHNA ROAD, HOSING BOARD COLONY, NEAR RAILWAY CROSSING, KHAMHARDIH RAIPUR C.G. 25-11-2014
3728 RACHNOUTSAV EVENTS PRIVATE LIMITED 6-3-533 TO 535, PLOT NO: 10, PAVANI VILLAS DWARAKA PURI COLONY, PUNJAGUTTA HYDERABAD 3-2-2014
3729 RACKMINDS TECHNOLOGIES SOLUTIONS PVT LTD #190, FIRST FLOOR, I BLOCK, KUVEMPUNAGAR, MYSURU 18-11-2016
3730 RADHAKRISHNAN LIBRARY FOR INTEGRATED SOCIAL ACTION AT-RAIGAN, PO-KAHALIA, VIA-NILAGIRI, DIST-BALASORE, ODISHA, PIN-756040 2-5-2016
3731 RADHA SWAMI EDUCATIONAL AND VOCATIONAL TRAINING SOCIETY WZ-42, KH NO.12/23, BEGAM PUR, OPP. SECTOR-22, ROHINI 15-9-2015
3732 RADHA SWAMI EDUCATIONAL AND WELFARE SOCIETY 3284, 1ST FLOOR, MAHINDRA PARK, RANI BAGH, 11-11-2014
3733 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW 16-2-2016
3734 RADIANCE CORPORATE SOLUTIONS PVT LTD 163 CHANDRALOK COLONY ALIGANJ LUCKNOW 3-2-2016
3735 RADIANCE SOCIO ECONOMIC DEVELOPMENT ORGANISATION URIPOK HUIDROM LEIKAI 3-4-2014
3736 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAV 26-4-2016
3737 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI 8-3-2016
3738 RAGHAVENDRA RURAL DEVELOPMENT ASSOCIATION AT/PO: AKKATANGERHAL TQ: GOKAK DIST: BELAGAVI 16-3-2016
3739 RAGHO SEVA SANSTHAN CHANDANI CHOWK CINEMA ROAD SHEIKHPURA 11-9-2015
3740 RAINBOW WELFARE TRUST 5/268,KABILAR STREET,MA.PO.SI NAGAR TIRUVLLUR-602001 11-3-2016
3741 RAJAGIRI COLLEGE OF SOCIAL SCIENCES RAJAGIRI.P.O, KALAMASSERY, ERNAKULAM, KERALA 18-2-2015
3742 RAJAGIRI OUTREACH SERVICE SOCIETY RAJAGIRI OUTREACH RAJAGIRI COLLEGE OF SOCIAL SCIENCES RAJAGIRI.P.O KALAMASSERY ERNAKULAM, KERALA 8-11-2013
3743 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI 24-6-2016
3744 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR. ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI 5-9-2016
3745 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST NO: 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI 14-3-2016
3746 RAJA MOHAMMADAN EDUCATIONAL CHARITABLE TRUST 06, DR.ZAKIR HUSSAIN STREET, BEHIND PERIYAR STATUE, RAJA NAGAR, KARAIKUDI. 27-10-2016
3747 RAJARSHI BAHUUDDESHIYA SEVABHAVI SANSTHA KAMALA NAGAR,HINGOLI 16-12-2016
3748 RAJASHRI BAHUUDDESHIYA SEVABHAVI SANSTHA PUNAYEE NIWAS, PRAKASH NAGAR, LATUR 21-10-2016
3749 RAJASTHAN CONSULTANCY ORGANISATION LIMITED ANAND BHAWAN, IST FLOOR, IFCI PREMISES, SANSAR CHANDRA ROAD, JAIPUR 5-5-2016
3750 RAJASTHAN GRAMIN VIKAS SANSTHA VILLAGE- BHADURNA, TEH- SANCHORE DISTT- JALORE 26-3-2014
3751 RAJASTHAN SAMGRAH KALYAN SASNTHAN 5 C EHSAAS NEAR TEMPO STAND CHANDRAVARDAI NAGAR AJMER RAJASTHAN 13-9-2015
3752 RAJBALHAT UDAYAN FOUNDATION SUPARIBAGAN, RAJBALHAT, HOOGHLY, WEST BENGAL 6-4-2016
3753 RAJBALHAT UDAYAN FOUNDATION VILL- SUPARIBAGAN,RAJBALHAT P.O- RAJBALHAT DIST- HOOGHLY PIN-712408 MOBILE NO- 9674746759 26-4-2016
3754 RAJBHASHA KARYANVAYAN EVAM PRASHIKSHAN MISSION 2/103, 1ST FLOOR, RADHEY PURI EXTN.II, KRISHNA NAGAR, DELHI-110051 17-5-2016
3755 RAJBHASHA KARYANVAYAN PRASHIKSHAN MISSION 2/103,IST FLOOR,RADHEY PURI EXTN-II NEAR JAGAT PURI CHOWK,NEW DELHI 26-4-2016
3756 RAJ BUILDCON CONSTRUCTION LIMITED 404, WELLDONE TECHPARK, SECTOR 48, SOHNA ROAD, GURGAON 17-10-2013
3757 RAJDHANI ISTITUTE OF INFORMATION TECHNOLOGY 85/1, SAPTASATI VIHAR, NEAR SAPTASATI TEMPLE, PALASUNI, BHUBANESWAR,ODISHA,INDIA 3-4-2014
3758 RAJEEV AOUDHOGIYC PRASHIKCHAN EVAM SODH SANSTHAN 65/79, CHITTWAPUR ROAD, LALKUAN, LUCKNOW 5-1-2016
3759 RAJEEV GANDHI COMPUTER SAKSHARTA MISSION 806, SHASTRI NAGAR, DADABARI, KOTA(RAJASTHAN) 19-5-2014
3760 RAJEEV GANDHI MEMORIAL EDUACATION SOCIETY VPO LAGBALIANA TEHSIL DEHRA DISTT. KANGRA HP 9816418318, 9805252222,01970246777 24-4-2014
3761 RAJEEV GANDHI YOUTH COMPUTER SAKSHARTA MISSION 3RD FLOOR ON UBI BANK, BATA MORE, BONGAON, NORTH 24 PARGANAS 26-4-2016
3762 RAJENDRA INSTITUTE OF EDUCATION AND SOCIAL WELFARE HALIMPUR, P.O.- DUMARI KALA, VIA- BARHARWA,DISTT.- SITAMARHI (BIHAR) 11-11-2014
3763 RAJGIRI SHIKSHAN MANDAL GONDIA CHAITANYA ADHAR SKILL ACADEMY, JOGLEKAR WARD, GOVINDPUR, MAIN ROAD, GONDIA 15-9-2015
3764 RAJ INTRA TECH 274/6 NEAR DISTT. COURTS, DHALPUR KULLU DISTT. KULLU H.P. 1-1-2016
3765 RAJITLAL INSTITUTE OF TECHNOLOGY AND HEALTH SCIENCES TRUST RITHS SKILLS FOR LIFE J-11, JANVILLA LANE, SASTHAMANGALAM.P.O. 3-4-2014
3766 RAJIV GANDHI EDUCATION FOUNDATION RAJIV GANDHI EDUCATION FOUNDATION, MADAYIKONAM PO,MAPRANAM, THRISSUR, KERALA 2-6-2014
3767 RAJIV GANDHI LITERACY MISSION DR LONES BUILDING OPP NEW HOSPITAL SOPORE DITRICT BARAMULLA 14-10-2015
3768 RAJIV GANDHI PEOPLE WELFARE FOUNDATION NO:12,NEHRUJI NAGAR,BATLAGUNDU 22-11-2014
3769 RAJ KISHORI DEVI SHIKSHAN PRASHIKSHAN SEWASANSTHAN VILL-BABHNAULI, POST-GARWAR, BALLIA 14-9-2015
3770 RAJNISH CONSULTANCY PVT LTD LAKE CITY MALL TA/8A, THIRD FLOOR, KAPURBAWDI, GB ROAD, THANE W 25-11-2014
3771 RAJ SHREE 787 9-12-2016
3772 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR LATUR 6-10-2016
3773 RAJSHREE BAHUDDESIYA SEVABHAVI SANSTHA LATUR AT POST BUDHODA, TQ. AUSA, DIST. LATUR 16-11-2016
3774 RAJSHREEMAN VIKASH AND PRASHIKSHAN TRUST I P COLONY RAMGANJMANDI 14-3-2016
3775 RAJSTHAN DEVELOPMENT SOCIETY WARD NO 19 , KANWARPURA ROAD SIKAR, RAJSTHAN 28-9-2015
3776 RAKSHA SOCIETY 7/370, DARRAGH SALAAM ROAD KOCHANGADI KOCHI KERALA 7-1-2016
3777 RAM MORADABAD 10-11-2014
3778 RAMACHANDRANAR EDUCATIONAL TRUST ADMINISTRATIVE OFFICE, SENTHAMIZH ILLAM, NAGORE, PANANGUDI, NAGAPATTINAM. 5-1-2016
3779 RAMA INFOTECH PRIVATE LIMITED 31/95 TEJ KUMAR PLAZA CAMPUS BEHIND RAM KUMAR PLAZA LUCKNOW UTTAR PRADESH 30-1-2014
3780 RAMANANDA RURAL AND URBAN DEVELOPMENT SOCIETY H.NO. 6-2-661, IIND FLOOR, ABOVE MORE SUPER MARKET, NEAR GANESH TEMPLE, VANASTHALIPURAM, HYDERABAD 3-1-2014
3781 RAMAN COMPUTERS PVT LTD #261, KIADB LAND, HEBBAL INDUSTRIAL AREA, HEBBAL, MYSORE 8-11-2013
3782 RAMAN DEVELOPMENT CONSULTANT PVT LTD 101, AKSHAT, MITHAKHALI SIX ROADS AHMEDABAD 15-9-2015
3783 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR 28-12-2015
3784 RAMAN EDUCATION SOCIETY C.V RAMAN COLLEGE OF ENGINEERING, BIDYA NAGAR, MAHURA, JANLA, BHUBANESWAR 14-3-2016
3785 RAMANI ICECREAM COMPANY LIMITED B-61, KASTURBA NAGAR , BHOPAL 11-8-2016
3786 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 72 KM STONE, DELHI MATHURA ROAD, MITROL, PO AURNGABAD, 5-2-2016
3787 RAMANUJAN EDUCATION AND RESEARCH FOUNDATION 162 A, SECTOR 31 4-1-2016
3788 RAMASAMY CHELLAPAPPU EDUCATIONAL TRUST 1/118,MUSILI STREET,ERAGUDI,THURAIYUR TRICHY 1-7-2014
3789 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTY-POST KRISHNARAYAPURAM-TALUK 18-9-2015
3790 RAMASAMY EDUCATIONAL AND DEVELOPMENT TRUST KANAKKAPILLAYUR PAPAKKAPATTI-POST KRINARAYAPURAM-TALUK KARUR-DISTRICT 2-12-2015
3791 RAMBHAU MHALGI PRABODHINI 17, CHANCHAL SMRUTI, G. D. AMBEKAR MARG, NR. SHRIRAM INDUSTRIAL ESTATE, WADALA, MUMBAI 10-4-2015
3792 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, DELHI 17-5-2016
3793 RAM GOPAL EDUCATIONAL SOCIETY A-1/11, PRASHANT VIHAR, NEW DELHI 17-9-2015
3794 RAM KRISHNA PARAMHANS SHIKSHA SAMITI GORAKHPUR INSTITUTE OF INFORMATION TECHNOLOGY, BEHIND KALI MANDIR, GOLGHAR, GORAKHPUR, U.P 5-12-2013
3795 RAM MANOHAR LOHIYA PRATISTHAN VIKAS MANDAL DAGADGAON TQ.LOHA DIST.NANDED 24-11-2015
3796 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED. 28-9-2016
3797 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI AT.JUNNA POST.SHIKARA TQ.MUKHED DIST.NANDED 6-4-2016
3798 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED. 5-9-2016
3799 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,NANDED. 29-12-2016
3800 RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI SANDEEP RAMCHANDRA KADAM,SECRETARY,RAMPARVA SAMAJIK SHAIKSHANIK SEVA SAMITI,AT.SAMTA NAGAR,POST.SHIVAJI NAGAR,NANDED. 4-1-2016
3801 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H.NO.119, KRISHNA NAGAR, WARD NO. 23, KORBA 21-9-2016
3802 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR, WARD NO. 17, KORBA CG 15-9-2016
3803 RAMSON INDIA EQUIPMENT SERVICES PRIVATE LIMITED H. NO. 119, KRISHNA NAGAR WARD NO. 19, KORBA 20-9-2016
3804 RAMSON INDIA EQUIPMENT SERVICES PVT LTD H NO. 119, WARD NO. 23, KRISHNA NAGAR KORBA CG 12-9-2016
3805 RANA SHIKSHA SAMITI VILL. GHESPUR, P.O RADAUR, DISTT. YAMUNANAGAR, HARYANA 18-9-2015
3806 RANA SHIKSHA SAMITI VILL- GHESPUR, PO-RADAUR, DISTT- YAMUNA NAGAR STATE HARYANA 14-9-2015
3807 RANCHI SECURITY PVT LTD 301, GIRDHAR PLAZA, OPP GOSHALA, HARMU BY PASS ROAD, RANCHI, JHARKHAND 14-9-2015
3808 RANDSTAD INDIA LTD RANDSTAD INDIA LIMITED RANDSTAD HOUSE OLD NO 5 & 5A, NEW NO 9. PYCROFTS GARDEN ROAD NUNGAMBAKKAM, CHENNAI - 600 006, INDIA. 28-5-2014
3809 RARE HOSPITALITY AND SERVICES PVT LTD 10,AISHWARYA TOWER,GR.FLOOR,C.ST ROAD,KALINA ,SANTACRUZ (EAST)MUMBAI-400098 ,MAHARASHTRA 4-8-2015
3810 RAS CAREER INSTITUTE PRIVATE LIMITED SUITE 11, 3RD FLOOR, SUPREME PLAZA PLOT NO. 15 & 16, SECTOR 6, DWARKA NEW DELHI 8-12-2013
3811 RASHTRAMATA MAA JIJAU BAHUUDESHIY SANSTHA AT.PO. KINGAON RAJA TQ. SINDKHED RAJA DIST. BULDHANA STATE MAHARASHTRA 443203 5-2-2016
3812 RASHTRAVIKAS AGRO EDUCATION SANSTHA 10 "RAMKUNJ", SHIV PARVATI COLONY, NEAR SURABHI COLONY, AMALNER, DIST. JALGAON 6-7-2016
3813 RASHTRIYA COMPUTER SAKSHARTA MISSION H.NO-32, ROAD NO-7, SOUTH INDRA NAGAR, (NEAR RAMBILASH CHOCK) POSTAL PARK 1-6-2016
3814 RASHTRIYA COMPUTER SAKSHARTA MISSION H. NO- 32, ROAD NO -7, SOUTH INDRA NAGAR, MEAR RAMBILASH CHOWK POSTAL PARK 12-9-2016
3815 RASHTRIYA SAKSHARTA MISSION IT LTD 1ST FLOOR, 28/1/7, SITE IV INDUSTRIAL AREA (NR HOTEL COUNTRY INN) SAHIBABAD, GHAZIABAD 30-9-2013
3816 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR.M.E.M. SCHOOL, PORBANDAR 11-5-2016
3817 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX, CHHAYA CHOWKI , NR. M.E.M.SCHOOL PORBANDAR 26-4-2016
3818 RASHTRIYA SAKSHARTA MISSION SANSTHA SHIVAM COMPLEX CHHAYA CHOWKI , NR. M.E.M. SCHOOL, PORBANDAR 17-5-2016
3819 RASHTRIYA SAKSHARTA MISSION SANTHA SHIVAM COMPLEX CHHAYA CHOWKI NR MEM SCHOOL 30-12-2015
3820 RASHTRIYA SARVA SAKSAR ABHIYAN RSSA, # 97- A, PKT C-1, MAYUR VIHAR-3, DELHI 13-1-2014
3821 RASTOGI EDUCATION SOCIETY MODEL TOWN NEHRU NAGAR (EAST) 8-6-2016
3822 RASTOGI EDUCATION SOCIETY MODEL TOWN, NEHRU NAGAR (EAST) 27-6-2016
3823 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD, KHEWAT NO.6,KHASRA NO. 17/12,19 V.P.O.GANJBAR (HR)132103 20-9-2016
3824 RATHI PERSONNEL TRAINING AND PLACEMENT SERVICE PVT REFINERY ROAD,KHEWAT NO.6,KHASRA NO.17/12,19 V.P.O.GANJBAR, PANIPAT 8-9-2016
3825 RAVINDRAA EDUCATIONAL AND CHARITABLE TRUST NO.3, III FLOOR, PERIYASAMY TOWERS, CHATRAM BUS STAND, TRICHY 14-9-2015
3826 RAXA SECURITY SERVICES LTD RAXA ACADEMY, KODIKONDA CHECKPOST, MORAMPALLI (POST) CHILMATHURU (MANDAL), ANANTAPUR (DIST.) ANDHRA PRADESH 28-10-2016
3827 RAYGAIN TECHNOLOGIES PVT LTD 1170 POCKET 3 SECTOR 19 DWARKA NEW DELHI 23-6-2016
3828 RAYMOND LIMITED TAILORING CIRCLE, 1ST FLOOR, OLD TEXTILES BUILDING, POKHARAN ROAD NO. 1, JEKEGRAM THANE - WEST, MAHARASHTRA 3-4-2014
3829 RAYS INTERNATIONAL FOUDATION RAYS INTERNATIONAL FOUNDATION ,XXII/238, FIRST FLOOR IRUMBAYIL COMPLEX, POLICE STATION ROAD,MUVATTUPUZHA,PIN:686661 EMAIL: IRCMUVATTUPUZHA@GMAIL.COM 9-8-2016
3830 RAYS INTERNATIONAL FOUNDATION IRUMBAYIL COMPLEX,POLICE STATION ROAD,NEAR FAIR STATION,NUVATTUPUZHA,PIN 686661 23-6-2016
3831 RAYS INTERNATIONAL FOUNDATION FIRST FLOOR, POLICE STATION ROAD, IRUMBAYIL COMPLEX , MUVATTUPUZHA P O , ERNAKULAM DISTRICT, KERALA 11-5-2016
3832 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA 2-9-2016
3833 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XXII/238,FIRST FLOOR,IRUMBAYIL COMPLE,POLICE STATION ROAD,MUVATTUPUZHA-686661 26-4-2016
3834 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA 19-8-2016
3835 RAYS INTERNATIONAL FOUNDATION RAYS INTERNATIONAL FOUNDATION,XX11/238,FIRST FLOOR,IRUMBAYIL COMPLEX,POLICE STATION ROAD,MUVATTUPUZHA 31-8-2016
3836 RAY WELFARE TRUST 16/160, TRILOKPURI, DELHI - 110091 31-12-2015
3837 R B ENTERPRISES INTERNATIONAL PVT LTD P.O.RASAPUNJA,BAKRAHAT ROAD,DAG NO. 4863,KOLKATA 25-11-2014
3838 R C GEMS ANAND NAGAR.MAHARANI SHANTADEVI ROAD, NAVSARI. GUJARAT 16-3-2015
3839 RCI INDUSTRIES AND TECHNOLOGIES LIMITED H NO. B 97, WAZIRPUR INDUSTRIAL AREA, DELHI 26-11-2014
3840 RCI SKILLS AND SOCIAL DEVELOPMENT PRIVATE LIMITED B-97, WAZIRPUR INDUSTRIAL AREA, DELHI 6-4-2015
3841 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA 11-8-2016
3842 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA 22-9-2016
3843 RCIT EDUCATION PRIVATE LIMITED 5/3 PARIKSHIT ROY LANE, BELIAGHATA MAIN ROAD, NEAR SALES TAX OFFICE, KOLKATA 7-9-2016
3844 REACH RURAL ENVIRONMENTAL AWARENESS COMMUNITY HELP KUMARANAHALLI, ADAVIHALLI POST, HARAPANAHALLI TALUK, DAVANAGERE DIST. 13-1-2014
3845 REAL SOLUTIONS 7/14 C4, 3RD FLOOR,MANANCHIRA TOWERS, A G ROAD CALICUT,KERALA INDIA 11-5-2016
3846 REDEFINEDIMENSIONSCONSULTINGPRIVATELIMITED 112,RISHAB I.P EX MALL PATPARGANJ DELHI 24-6-2015
3847 REDOX LABORATORIES INDIA PVT LTD 127/10, NH5, VELLANKI, ANANDAPURAM JUNCTION, VISAKHAPTANAM ANDHRA PRADESH 3-4-2014
3848 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH 22-7-2016
3849 REGENCY HOSPITAL LIMITED A-2, SARVODAYA NAGAR, KANPUR (UP)-208005 UTTAR PRADESH 19-7-2016
3850 REGENCY HOSPITAL LIMITED A-2 SARVODAYA NAGAR KANPUR 208005 UTTAR PRADESH 1-7-2016
3851 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL 5-9-2016
3852 REGENT EDUCATION AND RESEARCH FOUNDATION BARA KANTHALIA, SEWLI TELINI PARA, NORTH 24 PARGANAS, BARRACKPORE, KOLKATA, WEST BENGAL 5-9-2016
3853 REGIONAL AND URBAN DEVELOPMENT AGENCY PLOT NO 6 SECTOR 1 EAST EXTENSION TRIKUTA NAGAR JAMMU 28-9-2016
3854 REGIONAL CENTRE FOR ENTREPRENEURSHIP DEVELOPMENT SOCIETY SCO 315-315 2ND FLOOR, SECTOR 35 B CHANDIGARH 23-4-2015
3855 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD, KUKATPALLY, HYDERABAD 29-9-2016
3856 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY VISWA BHARATHI CAMPUS, NIZAM PET ROAD, NIZAM PET, HYD-71 14-9-2016
3857 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY 118, BRUNDAVAN COLONY, NIZAMPET ROAD, KUKATPALLY, HYDERABAD 5-10-2016
3858 REGIONAL EDUCATIONAL DEVELOPMENT SOCIETY NIZAMPET ROAD KUKATPLLY HYDERABAD 21-9-2016
3859 REI EDUCATION 420 AKASHIA ST. LAGRANGE HOUSE 18-8-2016
3860 REKHA SOCIETY DGGHDGHSH 21-12-2015
3861 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 134 SECTOR-K-9B KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA INDIA 11-1-2016
3862 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO 137 SECTOR-K-9B KALINGANAGAR PATRAPADA BHUBANESWAR ODISHA INDIA 17-12-2015
3863 RENAISSANCE STRATEGIC AND MANAGEMENT SERVICES P LT PLOT NO-134, SECTOR-K-9B, KALINGA NAGAR, PATRAPADA, BHUBANESWAR, ODISHA, INDIA 22-1-2016
3864 RENUKA EDUCATION AND WELFARE SOCIETY SONAR POLAT A P M C ROAD KUNDAGOL 26-8-2016
3865 RESCO ENTERPRISE LLP 23-A SERANG LANE, PS-TALTOLA, KOLKATA, WEST BENGAL 1-9-2016
3866 RESCUE TRUST MUNICIPAL COMPLEX UPSTAIRS, UZHAVAR SANDHAI, KARUR 1-9-2014
3867 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI 28-9-2015
3868 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKA JI, NEW DELHI 8-1-2016
3869 RESEARCH AND DEVELOPMENT INITIATIVE PVT LTD N-9-A, LOWER GROUND FLOOR, KALKAJI, NEW DELHI 14-10-2015
3870 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL, SOUTH DOULATPUR ROAD, RAJA BAZAR, JEHANABAD 14-10-2016
3871 RESHMA GRAMIN VIKASH SANGH MOTI MAHAL SOUTH DOULATPUR ROAD 23-11-2016
3872 RESOURCE IMPLE DEV AND ALLOTROPIC YOUJANA SOCIETY SHINE ACADEMY, HUCHUK PARA, BESIDE HOTEL NEST 23-6-2016
3873 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3, G.K'S PRASHANTHI NILAYAM, GROUND FLOOR, G K COLONY, R.K PURAM BRIDGE, OPP. AROMA BAKERY, SAINIKPURI 15-6-2016
3874 RESOURCE SQUARE SOLUTIONS PRIVATE LIMITED NO.3,G.K'S PRASHANTHI NILAYAM, GROUND FLOOR,G K COLONY, R.K PURAM BRIDGE,OPP:AROMA BAKERY,SAINIKPURI 29-6-2016
3875 RESURGENT INDIA LIMITED 903-906, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018 18-1-2017
3876 RESURGENT INDIA LIMITED 903-904, UNITECH BUSINESS ZONE, TOWER C, NIRVANA COUNTRY, SECTOR 50, GURGAON, HARYANA - 122018 12-1-2017
3877 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR 14-10-2015
3878 RETAIL ENTERPRISE DOMAIN INDIA LIMITED 99/1,GROUND FLOOR JAYADEV BIHAR,NEAR PARIES BAKERY, BHUBANESWAR 28-9-2015
3879 RETHINA EDUCATIONAL TRUST 91,SRINIVASAPURAM,KIDARANKONDAN,THIRUVARUR 4-3-2015
3880 REWARD SOCIETY NO.129/A, AMBUJA COMPLEX, 1ST FLOOR, TRICHY MAIN ROAD, VILLUPURAM 12-8-2015
3881 RGCSM RAJEEV GANDHI COMPUTER SAKSHARTA MISSAION (RGCSM) ADD.OPP STAT BANK OF PATYALA DHIGAWA MANDI TEH-LOHARU DIST-BHIWANI (HARYANA)127201 CON-9728470700-0125-257418 EDU.COM.DHIGAWA@GMAIL.COM 16-9-2015
3882 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR, CHENNAI-17 29-9-2016
3883 RHINO TECH SOFT PRIVATE LIMITED NO 83,BAZULLAH ROAD T.NAGAR 9-9-2016
3884 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD, SIRSA 9-12-2016
3885 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD , SIRSA 29-11-2016
3886 RHOMBAS EDUCATIONAL AND TECHNICAL SOCIETY #162, GANDHI COLONY, I.T.I ROAD ,SIRSA- 125055(HRY.) 4-11-2016
3887 RHYTHEM SOCIAL SERVICE SOCIETY FOR WOMEN NIRMALA COLLEGE CAMPUS RED FIELDS COIMBATORE 11-1-2016
3888 RIA CONSTRUCTIONS LTD SCO 176 FIRST FLOOR SECTOR 5 PANCHKULA 5-6-2014
3889 RIET JAIPUR UNDER CHANDRAWATI EDUCATION SOCIETY BHANKROTA, AJMER ROAD, JAIPUR 11-9-2015
3890 RIGHT FOUNDATION NEAR BIRSA BLOOD BANK,BARIATU RANCHI,ROAD NO:-3,P.O:-RMCH BARIATU,834009 17-11-2016
3891 RISE INDIA SKILLS SOLUTIONS PRIVATE LIMITED 221,GROUND FLOOR,OKHLA PHASE-3 7-10-2016
3892 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA 28-12-2015
3893 RISE PUBLISHERS AND CREATIVE SOLUTIONS PVT LTD H.NO:5-5-185, LASHKAR BAZAR, HANAMKONDA,WARANGAL,TELANGANA 8-1-2016
3894 RISHAN INFOSKILLS PVT LTD RISHAN INFOSKILLS PVT. LTD., 8, RED SQUARE MARKET, ORIENTAL BANK OF COMMERCE BUILDING, HISAR 28-10-2016
3895 RISHI FABRICS LIMITED 161-162-163-F- FOCAL POINT PHASE-8 20-11-2013
3896 RISHI INISTITUTE OF HIGHER STUDIES SOCIETY 57/I SUNDER VIHAR COLONY CIVIL LINES JHANSI (UP) PIN CODE- 284001 23-12-2016
3897 RISHI INSTITUTE OF HIGHER STUDIES SOCIETY C/O MAA PITAMBARA PRIVATE ITI, BEHIND JMK HERO SHOWROOM SHIVPURI ROAD NANDANPURA JHANSI UTTAR PRADESH 29-12-2016
3898 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA 6-4-2016
3899 RISHI VOCATIONAL EDUCATION PVT LTD 615, MAKARPURA GIDC VADODARA 7-4-2016
3900 RISHIVOCATIONALEDUCATION PVTLTD 615,G.I.D.C., MAKARPURA,VADODARA 15-9-2015
3901 RITECOM INDIA TECHNOLOGIES LIMITED #20/3 6TH CROSS, ISEC ROAD, NAGARABHAVI 6-4-2015
3902 RIT FOUNDATION E-17, MASJID MOTH, GREATER KAILASH PART 3 29-4-2015
3903 RITHVIKAA CARS PRIVATE LIMITED SHOP NO. 5, LAKSHMI TOWERS, NEAR TRIVENI TALKIES, ANANTAPUR 14-8-2014
3904 R K SANSTHAN UDYAMITA BHAWAN, 3/166, HOUSING BOARD COLONY, SAWAIMADHOPUR 17-12-2013
3905 RKT SOLUTION PRIVATE LIMITED 38A, POCKET 12, JASOLA VIHAR NEW DELHI-110025 CORPORATE OFFICE: C2/21, SECTOR-31, NOIDA – 201301 4-4-2016
3906 RKT SOLUTION PVT LTD B-5, 5TH FLOOR, SHRI RAM PLACE, SECTOR-27, NOIDA (UP) 23-5-2016
3907 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL,PUNJABI COLONY,DAYALBAND,BILASPUR 23-5-2016
3908 RLG SEWA C/O SHANTI NIKETAN PUBLIC SCHOOL,DAYALBAND,PUNJABI COLONY BILASPUR 12-5-2016
3909 RLG SEWA C/O SHANTINIKETAN PUBLIC SCHOOL, PUNJABI RCOLONY,DAYALBAND,BILASPUR,DIST-BILASPUR 12-5-2016
3910 RLG SEWA PANJABI COLONY DAYALBAND BILASPUR CG 5-4-2016
3911 R M EDUCATIONAL TRUST 59 RNR TOWERS COVAI ROAD KARUR 5-1-2016
3912 R M EDUCATIONAL TRUST 59, RNR TOWERS, COVAI ROAD, KARUR, TAMIL NADU 12-1-2016
3913 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 2 14-9-2015
3914 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002 28-9-2015
3915 R M EDUCATIONAL TRUST NO 42/25 GEE GEE COMPLEX MOUNT ROAD CHENNAI 600 002 21-9-2015
3916 R M EDUCATIONAL TRUST 42/25 GEE GEE COMPLEX IIND FLOOR, ANNA SALAI CHENNAI 9-2-2016
3917 RMP INFOTECH AT POST BILIYA LIMADI PARU,TA SIDHPUR,DIST.PATAN GUJARAT 22-6-2015
3918 ROCKMAN INDUSTRIES LIMITED A-7, PHASE 5, FOCAL POINT, LUDHIANA, PUNJAB 141010 28-12-2016
3919 ROMAN EDUCATIONAL TRUST AL-AZIZ PLAZA SRINAGAR KASHMIR INSTITUTE ADDRESS CHADOORA BUDGAM 18-11-2016
3920 ROM COMPUTER ACCOUNTS EDUCATION PVT LTD NEAR IDBI BANK, NAYA BAZAR, LASHKAR, GWALIOR 3-2-2015
3921 ROOKEYS ACADEMY PRIVATE LIMITED ROOKEYS ACADEMY PRIVATE LIMITED H NO 146,, PRAKASAM ROAD, BALAJI COLONY, TIRUPATI - 517502, ANDHRA PRADESH, INDIA 19-1-2017
3922 ROOMAN TECHNOLOGIES PVT LTD #130, 1ST BLOCK, DR.RAJKUMAR ROAD, RAJAJINAGAR, BANGALORE 14-12-2013
3923 ROSTRIYA JANKALYAN INFORMATION TECHNOLOGY SOCIETY 96 SECOND FLOOR, KALAWATI PALIWAL MARKET GUMANPURA, NEAR- MULTIPURPOSE SCHOOL KOTA 324007 RAJASTHAN 14-10-2015
3924 ROYAL EDUCATION SOCIETY 3/369 RAVAN SMRUTI, SAVEWADI, TRIMURTI NAGAR, LATUR 4-1-2016
3925 ROYAL TOUCH ICIS 75 A, STATION ROAD, KORATTUR, CHENNAI 30-4-2015
3926 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B, ROOM NO. 8A, 2ND FLOOR, SECURITY HOUSE, KOLKATA- 01 11-1-2016
3927 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA WB 26-2-2016
3928 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA-700001,WB 5-2-2016
3929 ROZGAR VIKAS EDUCATION PRIVATE LIMITED 23B,ROOM NO.8A,2ND FLOOR SECURITY HOUSE,KOLKATA, WB 5-4-2016
3930 RPS CONCIERGE SERVICES INDIA PRIVATE LIMITED 7/3, PALLAM STREET, SECRETARIAT COLONY, AMBATTUR CHENNAI. NEAR AMBATTUR OT BUS TERMINUS 2-3-2016
3931 RP TEK INDIA PRIVATE LIMITED B-1, SHIPRA RIVIERA TOWER, GYANKHAND-3, INDIRAPURAM, GHAZIABAD 11-11-2014
3932 RRS INDIA SECURITY SERVICES PVT LTD 320, BHATKHEDI, OPP. RAILWAY SPRING FACTORY, SITHOULI JHANSI ROAD, GWALIOR (M.P.) 21-12-2016
3933 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR, KLJ TOWER NORTH,B-5,DISTRICT CENTRE,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI 8-1-2016
3934 RSDF INFOTECH SERVICES PRIVATE LIMITED 2ND FLOOR,KLJ TOWER NORTH ,B-5,DISTRICT CENTER,NETAJI SUBHASH PLACE,WAZIRPUR,NEW DELHI 16-12-2015
3935 RSESK SOCIETY MAHENDRU 2-6-2014
3936 R SHIKSHA TRUST GANESH COMPLEX, ARIYALUR MAIN ROAD, E.B STORE OPP, PERAMBALUR 4-12-2014
3937 RSK EDUCATIONAL AND CHARITABLE TRUST REGD OFF: NO,6, RANGAA COMPLEX, CHINTHAMANI. TRICHY 25-11-2014
3938 RSWM LIMITED RSWM LIMITED (HO) A-12 SECTOR 1 NOIDA UP 26-7-2016
3939 RSWM LIMITED RSWM LIMITED (HO) A-12 BHILWARA TOWER NOIDA SECTOR 1 UP 26-12-2016
3940 RSWM LIMITED RSWM LTD (HO) BHILWARA TOWER A-12 NOIDA SECTOR 1 UP 2-8-2016
3941 R TECH SOLUTIONS R TECH SOLUTIONS, GT ROAD BESIDE JK SAREE MANDIR, SRIKAKULAM 532001 1-6-2016
3942 R TECH SOLUTIONS SAMINENI COMPLEX, DOOR NO:8-4-106, BESIDE JK SAREE MANDIR GT ROAD ,SRIKAKULAM 17-5-2016
3943 RT INSTITUTE OF SOCIAL WORK TRAINING ANDMANAGEMENT DURGA CHAUK, CIRCUIT HOUSE ROAD, NEAR JAMIL AUTO 5-1-2016
3944 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN, SAMANTARA PUR, BHUBANESWAR 23-11-2016
3945 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR 9-12-2016
3946 RUCHIKA SOCIAL SERVICE ORGANIZATION 3731-A, SRIRAM NAGAR, OLD TOWN SAMANTARA PUR, BHUBANESWAR 14-12-2016
3947 RUMI EDUCATION PRIVATE LIMITED UNIT 816, 8TH FLOOR, SPAZE I PARK, SECTOR 49, SOHNA ROAD, GURGAON 5-11-2013
3948 RUPAI DEVELOPMENT ORGANISATION HOUSING COLONY,ROOM NO-57,NEAR WORKER EDUCATION CENTRE,PARBATIA.TINSUKIA 26-3-2014
3949 RURAL ADVANCEMENT SOCIETY 5A, TIGER LANE,W6C/11, WESTERN AVENUE, NEAR COUNTRY CLUB, SAINIK FARMS NEW DELHI 14-9-2015
3950 RURAL AGENCY FOR SOCIAL AND TECHNOLOGICAL ADVANCEMENT RASTA KAMBALAKKAD-PO WAYANAD 13-9-2015
3951 RURAL AGRI SYTMS RESERCH ND CONSLTNG SRVCS PVT LTD SHOP NO. 2 DIVINE, CO-OPERATIVE SOC.NEXT TO OBEROI MALL . GEN A K VAIDYA MARG, GOREGAON EAST 30-1-2014
3952 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777,KONGU COMPLEX,KARANAMPETTAI PO,PALLADAM TK,TIRUPUR DT,PIN-641401 18-9-2015
3953 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,KARANAMPETTAI POST,PALLADAM TK,TIRUPUR 15-9-2015
3954 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI,PALLADAM TALUK,TIRUPPUR 28-12-2016
3955 RURAL AND URBAN SKILL DEVELOPMENT TRUST NO.777 KONGU COMPLEX,KARANAMPATTI PO,TRICHY MAIN ROAD,PALLADAM TK,TIRUPUR DT- 641 401 28-9-2015
3956 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR 9-12-2016
3957 RURAL AND URBAN SKILL DEVELOPMENT TRUST 777,KONGU COMPLEX,TRICHY MAIN ROAD,NEAR KVB ATM,KARANAMPETTAI POST,PALLADAM TALUK,TIRUPPUR 13-10-2015
3958 RURAL AREA DEVELOPMENT COMMITTEE RADCO LINGSIPHAI VILLAGE, CHURACHANDPUR DISTRICT 8-12-2013
3959 RURAL AREA DEVELOPMENT ORGANISATION WANGJING AWANG LEIKAI, P.O. WANGJING, P.S. THOUBAL, THOUBAL DISTRICT, MANIPUR 14-7-2014
3960 RURAL CARE MINISTRIES 13TH LINE,SIVANAGARAJU COLONY REDDYPALEM POST, VIA-PEDAKAKANI GUNTUR 16-2-2016
3961 RURAL COMPUTER EDUCATION AND TRAINING SOCIETY CADD CAE COMPUTERS, 8/25, VEPPANTHOPPU STREET, PALANI ROAD, DINDIGUL. 14-7-2014
3962 RURAL DEVELOPMENT AND TRAINING SOCIETY 1ST FLOOR, OPP. SBM BANK MAIN ROAD, SRIRANGAPATNA MANDYA DI, KARNATAKA 14-3-2016
3963 RURAL DEVELOPMENT ASSOCIATION WAINEM VILLAGE, P.O. NAMBOL BPO. BUNGTE, MANIPUR 4-10-2013
3964 RURAL DEVELOPMENT FOR EDUCATION AND SOCIAL SERVICE SOCIETY RURAL DEVELOPMENT FOR EDUCATION AND SOCIAL SERVICE SOCIETY,22 PALLA STREET,UTHIRAVAGINIPET,VILLIANUR,PONDICHERRY 15-4-2015
3965 RURAL DEVELOPMENT SOCIETY AWANG WABAGAI, P.O. SEKMAI, IMPHAL WEST 22-12-2013
3966 RURAL DEVELOPMENT SOCIETY CHURCH ROAD, TAMENGLONG HEADQUARTER, MANIPUR 17-4-2014
3967 RURAL DEVELOPMENT WELFARE AND EDUCATION SOCIETY CITY HOSPITAL CAMPUS, PATEPUR, VAISHALI, BIHAR 3-4-2014
3968 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94, ROAD NO.6, JANAPRIYA GARDENS, SAROORNAGAR, HYDERABAD. RANGAREDDY, ANDHRA PRADESH-500035 13-9-2015
3969 RURAL EDUCATIONAL DEVELOPMENT SOCIETY 11-14-94,PLOT NO-55,JANAPRIYAGARDENS, HARIPURICOLONY, SAROOR NAGAR (MANDAL&POST), GREATER HYDERABAD , RANGAREDDY,500035.TELANGANASTATE 12-8-2016
3970 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT 5-4-2016
3971 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT 14-9-2015
3972 RURAL EDUCATIONAL TRUST SIRUNAGAR VILLAGE AND POST CHEYYUR TALUK KANCHIPURAM DISTRICT 16-3-2016
3973 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET THIRUVANNAMALAI DISTRICT, TAMIL NADU, 606801 21-12-2016
3974 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801, THIRUVANNAMALAI DISTRCIT, TAMIL NADU 29-12-2016
3975 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 23-11-2016
3976 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU 23-12-2016
3977 RURAL EDUCATION AND DEVELOPMENT SOCIETY 31,ALAGIRI STREET, CHETPET 606801 THIRUVANNAMALAI DISTRICT, TAMIL NADU 9-12-2016
3978 RURAL EDUCATION AND ENVIRONMENT DEVELOPMENT SERVICE DHARAPURAM COMMUNITY COLLEGE,POLLACHI MAIN ROAD, PANJAPATTY, THALAVAIPATTINAM, POST, DHARAPURAM TALUK, TIRUPUR DISTRICT 13-9-2015
3979 RURAL EDUCATION AND ENVIRONMENT PROTECTION TRUST 117A, KSPT TOWERS, THURAIYUR ROAD, NAMAKKAL 25-11-2014
3980 RURAL EDUCATION AND WELFARE SOCIETY 455B MAHAVIR ENCLAVE, STREET 30 NEW DELHI 18-7-2014
3981 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS HYDERABAD TELANGANA 6-10-2016
3982 RURAL INSTITUTE FOR SKILL EMPOWERMENT PRIVATE LIMITED #8-2-596/7, ROAD NO 10, BANJARA HILLS, HYDERABAD 27-9-2016
3983 RURALSHORES SKILLS ACADEMY PVT LTD MR NEERAJ AGARWAL (CEO) RURALSHORES SKILLS ACADEMY PVT LTD 135/2, MARUTHI INDUSTRIAL ESTATE, ITPL ROAD, RAJAPALYA HOODI, MAHADEVAPURA PO. 24-12-2013
3984 RURAL UPLIFTMENT AND DEVELOPMENT REACTIVE AGENCY LAMJAO MAYAI LEIKAI, P.O. KAKCHING, P.S. WAIKHONG, THOUBAL DISTRICT, MANIPUR 19-5-2014
3985 RURAL VOLUNTARY ORGANIZATION P.O.CRPF LANGJING,PATSOI PART-II,N.C ROAD,IMPHAL,MANIPUR 17-12-2013
3986 RURAL WOMEN AND CHILD WELFARE SOCIETY 1/2315, A.P. HOUSING BOARD COLONY OPP. GANDHI NAGAR SCHOOL, KADAPA. 16-3-2016
3987 RURAL WOMEN EDUCATIONAL ENVIRONMENTAL DEVELOPMENT SOCIETY METTU STREET, SOKKALINGAPURAM SOKKALINGAPURAM(PO) MELURTK, MADURAIDT. 10-2-2015
3988 RUSTOMJEE ACADEMY FOR GLOBAL CAREERS PVT LTD RUSTOM IRANI MARG, RUSTOMJEE ACRES, DAHISAR (W) 13-7-2016
3989 RVS EDUCATIONAL TRUST REG OFF:242-B,TRICHY ROAD,SULUR,COIMBATORE-641402 CORP OFF:221,GROUND FLOOR,OKHLA PHASE-3,NEW DELHI 28-10-2016
3990 RVS RISE SKILLS SOLUTIONS PVT LIMITED 242,B,TRICHY ROAD ,SULUR,COIMBATORE 26-10-2013
3991 RYANPARAMEDICALSCIENCES VEERASAMINAGAR,PERIYAOBULAPURAM(POST),ELAVOOR,GUMMIDIPOONDI,THIRUVALLUR-DISTRICT,TAMILNADU, 18-9-2015
3992 SAAR IT RESOURCES PRIVATE LIMITED 5TH FLOOR, BUSINESS CLASSIC BUILDING, CHINCHOLI BUNDER ROAD, S.V. ROAD, BEHIND HP PERTOL PUMP, MALAD (WEST), MUMBAI. 8-12-2013
3993 SAATH CHARITABLE TRUST O/102,NANDANVAN V,NEAR PRERNATIRATH DERASAR,JODHPUR TIKRA,AHMEDABAD-GUJARAT 19-5-2014
3994 SABARMATHI SOCIAL SEVA SAGAM B 29 KUMARAN COLONY AMMAPALAYAM , ANUPARPALAYAM POST TIRUPUR , TAMILNADU 15-9-2015
3995 SABARMATHI SOCIAL SEVA SANGAM B.29-KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR 28-12-2015
3996 SABARMATHI SOCIAL SEVA SANGAM B 29 - KUMARAN COLONY, AMMAPALAYAM, ANUPARPALAYAM POST TIRUPUR 4-1-2016
3997 SABARMATHI SOCIAL SEVA SANGAM B.29 KUMARAN COLONY , AMMAPALAYAM , ANUPARPALAYAM POST - TIRUPUR 28-9-2015
3998 SACEWD TRUST SACEWD TRUST, PLOT NO:127, FIRST FLOOR, ARUMUGAM RAKKAMMAL COMPLEX, ALANGDI ROAD, METTUPPATTI, PUDUKKOTTAI DISTRICT. PHONE:9159997997, 26-7-2016
3999 SACHTEK EDUCATIONAL SOCIETY SACHTEK EDUCATIONAL SOCIETY SIKH MISSIONARY COLLEGE PLOT NO 14, PHASE XI MOHALI PUNJAB 24-6-2015
4000 SADAYANODAI ILAIGNAR NARAPANI MANDRAM SINAM VALARAGHAM, SINAM DEVELOPMENT CENTRE, ANBU NAGAR, AVALURPET ROAD, TIRUVANNAMALAI, TAMIL NADU 7-1-2015
4001 SADBA TECHNOLOGICAL SOCIETY 3RD FLOOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM 14-10-2016
4002 SADBA TECHNOLOGICAL SOCIETY 3RD FLLOR, LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM 30-9-2016
4003 SADBA TECHNOLOGICAL SOCIETY SADBA INSTITUTE OF TECHNOLOGY AND MANAGEMENT 3RD FLOOR,LAKSHMI SERVICE STATION COMPLEX,ABOVE LICI,SILPUKHURI,GUWAHATI,ASSAM 22-9-2016
4004 SADGUNA TECHNOLOGIES NAIMNAGAR 27-6-2016
4005 SADGUNA TECHNOLOGIES # 2-2-9,MAIN ROAD, NAIM NAGAR, HANMAKONDA, DIST: WARANGAL, TELANGANA STATE,506 009 17-5-2016
4006 SADGURU EDUCATIONAL TRUST 3RD STREET, SHUKLA COLONY , HINOO, RANCHI, JHARKHAND. 12-9-2015
4007 SADHANA AT-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI 26-4-2016
4008 SADHANA AT/PO - BANKOI, DIST - KHORDHA 12-9-2015
4009 S A D H A N A AT:-GROUND FLOOR,SHANTI APARTMENT,NEAR LAXMI CINEMA HALL,PURI 6-4-2016
4010 SADHNA MEDIA PVT LTD 38 RANI JHANSI ROAD, JHANDEWALAN, DELHI 26-6-2015
4011 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY C-15, GALI NO-3, KOTLA VILLAGE, MAYUR VIHAR PHASE-1, DELHI-91 23-12-2016
4012 SADIK MASIH MEDICAL SOCIAL SERVANT SOCIETY 110, B-4, PARYATAN VIAHAR, VASHUNDHARA ENCLAVE, DELHI 29-12-2016
4013 SAFAL SOLUTIONS PVT LTD 30E, ROAD NUMBER-2 FIRST FLOOR, PATLIPUTRA COLONY PATNA 3-1-2014
4014 SAFDSF SADFASD 15-9-2015
4015 SAFEDUCATE LEARNING PRIVATE LIMITED SAFEDUCATE CORPORATE OFFICE, NATIONAL HIGHWAY NO. 8, MAHIPALPUR EXTENSION, NEW DELHI 22-12-2013
4016 SAFEXPRESS PRIVATE LIMITED SAFEXPRESS CARGO COMPLEX, MAHIPALPUR EXTENSION, NATIONAL HIGHWAY NO 8, NEW DELHI 22-12-2013
4017 SAFIRE INTERNATIONAL PRIVATE LIMITED A-94/3, WAZIRPUR INDUSTRIAL AREA, DELHI 6-9-2015
4018 SAHAJ E VILLAGE LTD STELLAR IT PARK,TOWER 2,OFFICE SPACE 2&3,PLOT NO.C-25,SECTOR-62,NOIDA 1-10-2013
4019 SAHA KNOWLEDGE AND SKILLS PARK PRIVATE LIMITED VILL- SOMASPUR , P.O – DHANIAKHALI, DIST. HOOGHLY, DHANIAKHALI BLOCK, WEST BENGAL, 26-9-2016
4020 SAHARA COMPUTER EDUCATION H NO 8-91 GHOURI COMPLEX OPP: CAFE ETHINIC HOTEL MAIN ROAD ZAHEERABAD DIST MEDAK TELANGANA STATE. 17-3-2015
4021 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMOND TEXTILES COMPLEX MAIN ROAD ZAHEERABAD. DIST MEDAK TELANGANA.502220 7-9-2016
4022 SAHARA COMPUTER EDUCATIONAL SOCIETY H NO 1-5-129 DAIMAOND TEXTILEX COMPLEX 2ND FLOOR MAIN ROAD ZAHEERANAD DIST MEDAK, TELANGANA STATE 502220 18-8-2016
4023 SAHARA MANCH B-6 VIDHYA NAGAR, HOSHANGABAD ROAD, BHOPAL (M.P.) 30-1-2014
4024 SAHARA UTSARGA WELFARE SOCIETY 10/9, CHINAR PARK, PO: HATIARA, PS: BAGUIATI, NEW TOWN, KOLKATA - 700157 17-9-2015
4025 SAHAYA AT/PANCHUMU P/O/BHALIADIHI DIST/NAYAGARH LIASION OFFICE/ AT/PO/GODIPADA 17-9-2015
4026 SAHAYA AT- PANCHUMU;PO-BHALIADIHI, DT NAYAGARH;ODISHA 9-2-2016
4027 SAHAYOG SEVABHAVI SANSTHA VISHNUPURI, NANDED 29-12-2016
4028 SAHITHI SYSTEMS PRIVATE LIMITED 103, 7-1-455/2 & 3-8, SWATHI MANORS, ADJ LANE TO SWATHI ANUKAR BUILDING, HUDA MAITRIVANAM ROAD, AMEERPET, HYDERABAD, ANDHRA PRADESH 8-11-2013
4029 SAHITHYA SOCIAL WELFARE TRUST NO. 395 SCHOOL ROAD ANNANAGAR WEST EXTRN 13-7-2016
4030 SAHITYA BIT EDUCATIONAL ACADEMY H.NO. 11-4-3/5, 1ST FLOOR, BHADRADRI BANK COMPLEX, NEHRUNAGAR, KHAMMAM (TOWN & DIST.), ANDHRA PRADESH - PIN: 507002 31-3-2014
4031 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY MAHAL JAGATPURA JAIPUR 7-1-2016
4032 SAHITYA SADAWART SAMITI D BLOCK MALVIYA NAGAR, JAIPUR. 17-9-2015
4033 SAHITYA SADAWART SAMITI SURESH GYAN VIHAR UNIVERSITY, MAHAL JAGATPURA, JAIPUR 28-9-2015
4034 SAH SAHAYOG SEWA SAMITI SALARPUR RASULGARH SARNATH VARANASI UTTAR PRADESH 17-2-2015
4035 SAHYADRI PRATISHTHAN AP NERI BK TAL JAMNER DIST JALGAON MAHARASHTRA 425114 4-1-2016
4036 SAHYOG ASSURANCE CONSULTANTS PRIVATE LIMITED KHASRA NO. 346, SULTANPUR, M.G. ROAD,NEW DELHI 13-9-2015
4037 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR 17-10-2016
4038 SAHYOG BUSINESS SERVICES PRIVATE LIMITED F. NO. 22, MEHAR KUNJ APTT, ROAD NO. 3E, BESIDE PENSINOR BHAWAN,NEW PATLIPUTRA COLONY, PATNA-800013, BIHAR 26-9-2016
4039 SAHYOG CARE FOR YOU 2, BASEMENT BHERA ENCLAVE, PASCHIM VIHAR , NEW DELHI 18-8-2016
4040 SAHYOG JANKALYAN SAMITI 117/H-1/243 MODEL TOWN,PANDU NAGAR KANPUR UP 24-6-2015
4041 SAHYOG PRAGATI MANDAL JASALI AT AND POST JASALI BLOCK DEODAR DISTRICT BANASKANTHA 18-9-2015
4042 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, TELANGANA, INDIA 13-1-2017
4043 SAI BABUJI INFRA PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA,, BALANAGAR, HYDERABAD - 500037, ANDHRA PRADESH, INDIA 5-2-2016
4044 SAI BABUJI PROJECTS PRIVATE LIMITED NO. 16, INDUSTRIAL DEVELOPMENT AREA, BALANAGAR HYDERABAD TELANGANA 12-8-2016
4045 SAICHAYA GRAMIN SWAYAMSEVI BAHUDESHIYA VIKAS SANST C/O-FORTUNE COMPUTER EDUCATION,BEHIND SARDA PETROL PUMP,K.G.ROAD,AKOLE,TAL-AKOLE,DIST-AHMEDNAGAR,MAHARASHTRA 15-3-2016
4046 SAI DEVELOPMENT FOUNDATION NC COLLEGE ROAD, JAJPUR TOWN, JAJPUR 5-1-2016
4047 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI DISTT RAJAURI STATE J&K-185153 6-1-2016
4048 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA SUNDERBANI DISTRICT RAJOURI STATE JAMMU AND KASHMIR 24-2-2016
4049 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI 5-2-2016
4050 SAI INSTITUTE OF IT AND MANAGEMENT 2ND FLOOR,JANDYAL PLAZA,SUNDERBANI (NEAR NEW BUS STAND) DISTT RAJOURI ,JAMMU AND KASHMIR 5-8-2016
4051 SAI KIRUBAA TEXTILES 382/1 CHETTIPALAYAM ROAD PALLADAM 17-3-2015
4052 SAI NARAYANA EDUCATION AND TECHNOLOGIES 12-2-825/7&8 ANSAR COMPLEX, MEHDIPATNAM, HYDERABAD 17-3-2015
4053 SAINTHIA VIVEKANANDA SARANI IDEA COMPUTER ACADEMY SAINTHIA NEAR RAILWAY STATION,P.O+P.S-SAINTHIA,DIST- BIRBHUM, 22-7-2016
4054 SAI SHAKTHI INFRATECH PVT LIMITED PLOT NO. 107, PRASHANTI NAGAR, NEAR INDUSTRIAL ESTATE, KUKATPALLY, HYDERABAD 20-11-2013
4055 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR.FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T. STAND, ALIBAG RAIGAD. 11-5-2016
4056 SAI SHRADDHA FOUNDATION OFFICE ADD- MADHUKUNJ BLDG., GR. FLOOR, NEAR BY GOVT. LIBRARY, OPP. S.T.STAND, ALIBAG- RAIGAD 26-4-2016
4057 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI-110062 5-9-2016
4058 SAI SKILL TECHNOLOGY PRIVATE LIMITED 27-B, MAIN DEVLI ROAD, KHANPUR, NEW DELHI 12-8-2016
4059 SAI TRIPURA TECHNO PROJECTS PRIVATE LIMITED FLAT NO: 1 - 32,D.NO:2-49C, LALITHA NAGAR, KAKINADA 5-2-2015
4060 SAIVARSHAATECHNOLOGY EDUCATIONAL CHARITABLETRUST SAI VARSHAA INDUSTRIAL SCHOOL, 14 / 3026, V. O. C NAGAR, FIRST STREET, THANJAVUR 15-9-2015
4061 SAI VARSHA EDUCATIONAL SOCITY 2-2-116,NAIMNAGAR HANAMKONDA,WARANGAL. 2-3-2016
4062 SAI VENKATA NARAYANA SOCIETY NEAR OLD BUS STAND RAJEEV MARG OPP MUNICIPAL SHOPPING COMPLEX PARVATHIPURAM VIZIANAGARAM DISTRICT AP 5-5-2016
4063 SAI VOCATIONAL TRAINING INSTITUTE RUN BY SCGMKS 10/1 KALIDAS MARG FREEGANJ 6-1-2016
4064 SAJAG NAGARIK ADHIKAR SEVA SAMITI B-2 EXTENSION/2, STREET NO. 7, KRISHNA NAGAR, SAFDARJUNG ENCLAVE, DELHI 25-7-2016
4065 SAKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW 27-4-2016
4066 SAKHI SOCIAL ENTERPRISE NETWORK SAKHI SOCIAL ENTERPRISE NETWORK 3595 CHANDRODAY COLONY,ROAD NO.2, PRAKASH NAGAR, LATUR PH:+91 2382 224767 (MOB) 9423774727 EMAIL:SSENINDIA@GMAIL.COM 15-2-2014
4067 SAKSHAM TRAINING AND FACILITY MANAGEMENT PVT LTD NO 9 &10, DASARAHALLI MAIN ROAD, BHUWANESHWARINAGARA, (NEAR ANUGRAHA TILES) BANGALORE-560024 17-3-2016
4068 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA 26-2-2016
4069 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA 6-4-2016
4070 SALAM EDUCATIONAL AND OTHER WELFARE SOCIETY ANWARY HOUSE, AZIZ PURA BEED-43112 26-4-2016
4071 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT ASHRAM BUILDING, GROUND FLOOR, GN34/2, SECTOR V, SALT LAKE ELECTRONICS COMPLEX, KOLKATA - 700091 17-3-2016
4072 SALT LAKE INSTITUTE OF ENGINEERING AND MANAGEMENT GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091 8-12-2015
4073 SALTLAKE INSTITUTE OF ENGINEERING MANAGEMENT LTD GN-34/2, SALT LAKE ELECTRONICS COMPLEX, SECTOR-V, KOLKATA - 700091 9-9-2015
4074 SALUA VILLAGE WELFARE SOCIETY VILL-NAZARNAGAR (SEULI BHAWAN) PO-HAROA, PS-HAROA, NORTH 24 PARGANAS, WEST BENGAL. 1-9-2016
4075 SALVO INC 329/E, DABHOLKAR CORNER, NEAR HOTEL KOHINOOR, KOLHAPUR 20-1-2015
4076 SAMADHAN SAMAJ SEVA SANGATHAN REGD. OFF- INDIRA GANDHI WARD, TEHSIL COLONY, PACHMARI ROAD, PIPAIRYA DIST, HOSHANGABAD PIN -461775 – MADHYA PRADESH INDIA 15-9-2015
4077 SAMADHAN SAMAJ SEWA SANAGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PARCHMARI ROAD PIPAIRYA DISTT HOSHANGABAD MADHYA PRADESH 30-6-2016
4078 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD THESIL COLONY PACHMARI ROAD PIPAIRYA 12-5-2016
4079 SAMADHAN SAMAJ SEWA SANGATHAN 254 INDIRA GANDHI WARD TEHSIL COLONY PACHMARI ROAD DISTT HOSHANGABAD PIPARIYA 461775 26-4-2016
4080 SAMADHAN SEVA SAMITI 1D/206, G.D MISHRA PATH, NEW PATLIPUTRA COLONY,PATNA-800013 BIHAR 14-9-2015
4081 SAMAJ KALYANKARI SARASWATI SABHA 756, INDRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR (U.P.) 16-3-2016
4082 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR 3-3-2016
4083 SAMAJ KALYANKARI SARASWATI SABHA 756, INDIRA COLONY NEAR SAHARANPUR BUS STAND MUZAFFARNAGAR 10-2-2016
4084 SAMAJ PRAGATI SAHAYOG VILLAGE JATASHANKAR, TEHSIL BAGLI, DISTRICT DEWAS, MADHYA PRADESH 22-1-2014
4085 SAMAJ SUDHAR YUVA SANGHARSH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL 11-9-2015
4086 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH. NISSING DISTT.KARNAL 16-3-2016
4087 SAMAJ SUDHAR YUVA SANGHRASH SAMITI VPO. AMUPUR TEH.NISSING DISTT.KARNAL 6-4-2016
4088 SAMANWAY SOCIAL SERVICE ORGANISATION AAROHI ARCADE FLAT NO 4 FIRST FLORE MUNSIPULIA INDRANAGAR LUCKNOW 26-3-2014
4089 SAMARPAN CARE AWARENESS AND REHABILITATION CENTER 8, NARAYAN BAGH, INDORE 31-3-2014
4090 SAMARPAN JAN VIKAS JAN JAGRAN SEWA SAMITI SAGAR BRINDAVAN MARKET BUS STAND ROAD GOPAL GANJ SAGAR M. P. 21-6-2016
4091 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.-2, BILASPUR (CHHATTISGARH) 11-1-2016
4092 SAMARPIT 37,GEETANJALI ENCLAVE, RING ROAD NO.2, BILASPUR (CHHATTISGARH) 23-5-2016
4093 SAMARPIT FOUNDATION SAMARPIT FOUNDATION SATYANARAYAN COMPLEX GAUSHALA MASZID CHOWK BELA ROAD MITHANPURA MUZAFFARPUR 12-9-2015
4094 SAMARTHANAM TRUST FOR THE DISABLED NO.11, VILLA SUCHITHA, 1ST CROSS, 17TH MAIN, J P NAGAR 2ND PHASE, BENGALURU 12-10-2013
4095 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEN AVENUE CHUNNA BHATTI BHOPAL 6-10-2016
4096 SAMARTHAN CENTRE FOR DEVELOPMENT SUPPORT 36, GREEEN AVENUE CHUNNABHATTI BHOPAL 26-9-2016
4097 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI 29-9-2016
4098 SAMARTH EDUSKILLS PVT LTD 1405, 14TH FLOOR, NIRMAL TOWER 26, BARAHKHAMBA, NEW DELHI 9-9-2016
4099 SAMARTH EDUSKILLS PVT LTD 1405,14TH FLOOR NIRMAL TOWER, 26 BARAHKHAMBA ROAD, NEW DELHI 28-10-2016
4100 SAMARTH IN PARTICIPATOR ACTION SOCIETY SAMARTH-IN PARTICIPATORY ACTION (SIPA) MOTIBABA MANDIR ROAD VIVEKANAND COLONY SEHORE 28-9-2016
4101 SAMARTH ORGANISATION TRUST FF.56 SANSKRUT COMPLEX, T.B.ROAD, VIJAPUR, TA-VIJAPUR, DIST-MEHSANA 26-4-2016
4102 SAMAZIK VIKASH EVAM PRABAND SAMITI HILTRON CALC OPP GRAMIN BANK, TAKANA ROAD PITHORGARH 9-2-2016
4103 SAMAZIK VIKASH EVAM PRABAND SAMITI OPP GRAMIN BANK , TAKANA ROAD, PITHORAGARH 26-4-2016
4104 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA-751003 11-3-2016
4105 SAMBAD AMA ODISHA CHARITABLE TRUST KMBB COLLEGE OF ENGINEERING & TECHNOLOGY, DALLEIPUT, KHURDA, ODISHA 16-12-2016
4106 SAMBAD AMA ODISHA CHARITABLE TRUST A/62, OLD SAMBAD OFFICE, NEAR CRP SQUARE, BHUBANESWAR, ODISHA. 9-2-2016
4107 SAMBAD AMAODISHA CHARITABLE TRUST A/62, NAYAPALLI BHUBANESWAR, ODISHA-751003 5-1-2016
4108 SAMBANDH FINSERVE PVT LTD JUBILEE VILLA, PLOT NO-07 SINDHI COLONY, MISSION HATA RAJGANGPUR. 14-9-2015
4109 SAMBE ELECTRONICS PRIVATE LIMITED 507, SHAH & NAHAR INDUSTRIAL ESTATE , WORLI NAKA , MUMBAI PIN - 400018 MAHARASHTRA 23-9-2016
4110 SAMBHAWANA H.NO.-821, SRI KRISHNA ROAD, WARD NO-29, MUNGER, BIHAR 6-1-2016
4111 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI 5-4-2016
4112 SAMBHAWANA HOUSE NO. 137, DDA SFS FLATS, POCKET-1, SECTOR- 5, DWARKA, NEW DELHI 27-4-2016
4113 SAMBHAWANA HOUSE NO. 821, WARD-29 SRI KRISHNA ROAD, BELAN BAZAR MUNGER, BIHAR 16-3-2016
4114 SAMKIT SHAIKSHNIK AND ANUSANDHAN ACADEMY 311, USHA NAGAR (EXT.) RANJEET HANUMAN MAIN ROAD NEAR ICICI BANK, INDORE 25-11-2014
4115 SAMPATH CONSTRUCTIONS D. NO. 58-22-28/1, SUSARLA COLONY, BUTCHIRAJUPALEM, VISAKHAPATNAM PROJECT JOINT OFFICE: SREE FOUNDATION, 133/2, NEW CIVIC CENTRE, BHILAI, 490006, CG 7-11-2013
4116 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR 9-12-2016
4117 SAMPOORNA SAMITI 83, TAIGORE NAGE, GWARIGHAT ROAD, JABALPUR, M.P.. 15-11-2016
4118 SAMPOORNA SAMITI 83, TAIGORE NAGAR, GWARIGHAT ROAD, OPPOSITE OF MODI HOUSING SOCIETY, JABLAPUR 16-12-2016
4119 SAMRIDDHI EDUCATIONAL TRUST 4A, GITANJALI PALACE BOMIKHAL, RASULGARH BHUBANESWAR 11-5-2016
4120 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST -VADUTH TALUKA - SATARA DIST - SATARA 30-11-2016
4121 SAMRUDDHI SAMAJIK VIKAS SANSTHA SATARA AT-ARPHAL POST-VADUTH TAL-KOREGAON DIST -SATARA 5-1-2017
4122 SAMRUDHI EDUCATIONAL TRUST RAAJDHANI ENGINEERING COLLEGE PO- MANCHESWAR RAILWAY COLONY BHUBANESWAR-17 8-4-2016
4123 SAM TRAINING CENTRE 2, MSK BUILDING, MADURAI ROAD, PILLAIYAR KOIL STREET, RAMANATHAPURAM, TAMILNADU. 20-8-2014
4124 SAMVEDNA DEVELOPMENT SOCIETY 322, ROAD NO.- 11A, PATLIPUTRA COLONY PATNA, BIHAR, INDIA 31-10-2013
4125 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE 18-4-2016
4126 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE 14-3-2016
4127 SAMVIT EDUCATION TRUST 3RD FLOOR, GHS CENTENARY BUILDING, GHS ROAD, HAMPANNAKATTA, MANGALORE 17-2-2016
4128 SANATAN HINDU SAMAJ SEVA TRUST SANATAN HINDU SAMAJ SEVA TRUST A/2 ASHISH SOCIETY,C.P.PATEL HIGHSCHOOL ROAD BEHIND STATE BANK OF INDIA AT & PO - SEVALIYA TA - GHALTESHWAR DI - KHEDA GUJARAT 14-10-2015
4129 SANATAN HINDU SAMAJ SEVA TRUST A2,ASHISH SOCIETY BEHIND STATE BANK OF INDIA,C.P.PATEL HIGH SCHOOL ROAD SEVALIYA BAZAR TA-GALTESHWAR, DI-KHEDA 28-9-2015
4130 SANCKET VILL-PURANODAPADA, POST-PURANODAPADA, DIST-JAGATSINGHPUR, ODISHA 15-3-2016
4131 SANCKET S 1/ 163, HIG, NILADRI VIHAR, SAILASHREEBIHAR, BHUBANESWAR 15-9-2015
4132 SANCKET ITI AT/PO-PURANODAPADA VIA/PS-RAGHUNATHPUR DIST-JAGATSINGHPUR 8-1-2016
4133 SANCTUM TECHNOLOGIES PRIVATE LIMITED 56-57 CMH ROAD ABOVE MANDOVI MOTORS INDIRA NAGAR KARNATAKA BANGALORE 9-9-2016
4134 SANCTUM TECHNOLOGIES PVT LTD #114,3RD FLOOR, AL-AZEEM CENTER, OPP.RAHEJA ARCADE, 7TH BLOCK, KORAMANGALA, BANGALORE 15-9-2015
4135 SANDEEP DATA PROCESS INDUSTRIAL TRAINING CENTER SO B 16, INDRAPURI, JUBLI GATE RAISEN ROAD BHOPAL 14-9-2015
4136 SANDEEP TEST ASDASDASD 18-6-2015
4137 SANDESH MNGO INDIA INDIA 1 INDORE 4-1-2016
4138 SANDIPANI ACADEMY BILASPUR-JANJGIR ROAD, PENDRI ( MASTURI ) 25-11-2014
4139 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT 21-9-2015
4140 SANGAMIRDHAM SOCIAL TRUST 67 MADURAI MAIN ROAD CRAWFORD TRICHIRAPPALLI-12 TRICHIRAPPALLI DISTRICT 12-9-2015
4141 SANGLI MISSION SOCIETY SANT THOMA BHAVAN, RAMAN MALA, KASABA BAVDA ROAD,PB NO.306,KOLHAPUR. 29-2-2016
4142 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY, SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH. 14-3-2016
4143 SANGLI MISSION SOCIETY SANGLI MISSION SOCIETY,SANT THOMA BHAVAN RAMAN MALA, KASBA BAVDA ROAD, KOLHAPUR, MH. 6-5-2016
4144 SAN IT SOLUTIONS PRIVATE LIMITED 76/3, C.M.TOWER, 30TH CROSS, TILAKNAGAR MAIN ROAD, JAYANAGAR, BANGALORE 5-12-2014
4145 SANJAY MAINTENANCE SERVICES PVT LTD SMS HOUSE, PLOT NO. 41/13, SECTOR NO 30,VASHI,NEAR SANPADA RAILWAY STATION, NAVI MUMBAI-400703 17-11-2016
4146 SANJEEVNI PARIVAR VILLAGE-KHERIA,PO-AYODHYA GUNJ BAZAR, KURSELA,DISTT-KATHIHAR,BIHAR-854101 9-9-2016
4147 SANJEEVNI PARIVAR VILLAGE-KHERIA, PO- AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101 23-6-2016
4148 SANJEEVNI PARIVAR VILLAGE-KHERIA PO-AYODHYA GUNJ BAZAR, KURSELA, DISTT-KATHIHAR, BIHAR-854101 26-9-2016
4149 SANJEEVNI PARIVAR VILLAGE-KHERIA POST-AYODHYA GANG BAZAR KURSELA DISTRICT -KATIHAR BIHAR 6-10-2016
4150 SANKALP EDUCATION SOCIETY OFFICE NO. 13, 1ST FLOOR,SAWANT PLAZA BLDG., PUNE- SATARA ROAD, BALAJINAGAR, PUNE 2-9-2016
4151 SANKALP JAN SEVA SAMITI SR-4, SHRI RAMKUNJ, E-8, BHARAT NAGAR, SHAHPURA 12-1-2016
4152 SANKALP VIKAS SAMITI 125 MARUTIPURAM INDRA NAGAR FAIZABAD ROAD LUCKNOW 11-8-2016
4153 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST 41B, TM NAGAR, NEAR MATTUTHAVANI BUS STAND, MADURAI 26-7-2016
4154 SANKARS EDUCATIONAL AND PUBLIC CHARITABLE TRUST #41-B T.M.NAGAR NEAR MATTUTHAVANI BUS STAND MADURAI 10-2-2016
4155 SANKET INFO SYS 261, 10 TH CROSS, IST N BLOCK, RAJAJINAGAR, BANGALORE 13-1-2017
4156 SANKET INFO SYS 261, 10TH CROSS , IST N BLOCK, RAJAJINAGAR, BANGALORE 19-1-2017
4157 SANSKAR EDUCATION SOCIETY REGISTERED OFFICE- BANK COLONY, GAUTAM NAGAR, KASHIPUR, DISTT- U.S NAGAR, UTTARAKHAND (INDIA 29-12-2016
4158 SANSKRITI INSTITUTIONS A-6, FLAT NO. 6, NARAINA VIHAR, NEW DELHI 8-9-2014
4159 SANSKRITI MAHILA MANDAL AZAD CHOWK, PURANI BASTI, DIST KATNI (M.P.) 9-9-2016
4160 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANIN BASTI DISTRICT KATNI (M.P.) 22-9-2016
4161 SANSKRITI MAHILA MANDAL AZAD CHOWK PURANI BASTI DIST. KATNI (M.P.) 28-9-2016
4162 SANSKRITI MAHILA UTKARSH TRUST 207,PANCHAM MALL, JEEVANWADI,NIKOLGAM ROAD,NIKOL,AHMEDABAD 14-7-2014
4163 SANSKRITI SOCIETY FOR EDU RESEARCH AND DEVELOPMENT 28 KM STONE, MATHURA DELHI HIGHWAY, NH-2, VILL. CHHATA, DISTT. MATHURA, UTTAR PRADESH 24-6-2015
4164 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL KOSAMTONDI, SADAK ARJUNI, GONDIA, MAHARSHTRA 17-5-2016
4165 SANT BANGLUBABA ADIVASI SAIKSHANIK SUDHARNA MANDAL MALUTOLA,SAKOLI,BHANDARA 9-6-2016
4166 SANT DNYANESHWAR SHIKSHAN SANSTHA ISLAMPUR TAL. WALWA DIST. SANGALI 30-1-2014
4167 SANTHIGIRI ASHRAM PLOT NUMBER 23 & 24 SECTOR 6 PUSHP VIHAR SAKET NEAR FAMILY COURT SAKET NEW DELHI 28-9-2016
4168 SANTOSH EDUCATION AND HEALTHCARE PRIVATE LIMITED 1 AMBEDKAR ROAD, 2ND FLOOR OPP BUS STAND GHAZIABAD UTTAR PRADESH 15-9-2016
4169 SANTOSH WELFARE TRUST 226/13 K P ROAD BULANDSHAHR 4-7-2016
4170 SANTUKA ASSOCIATES PRIVATE LIMITED DOLAMUNDAI, TELENGA BAZAR, CUTTACK, ODISHA 23-11-2016
4171 SANWALIYA RSE SYSTEMS PRIVATE LIMITED JINDAL COMPLEX 72, GAUTAM BUDH MARG LATOUCHE ROAD LUCKNOW UTTAR PRADESH 3-1-2014
4172 SAPPHIRE SOLUTIONS 9-NEXT TO ANJANA PRINTING PRESS BESIDE RAMBHA CINEMA JINSI JEHANGIRABAD BHOPAL M.P. 9-9-2015
4173 SARANALAYAM 22 DHARMASALAI ROAD, PARVATHIPURAM VADALUR 5-2-2015
4174 SARANYA FASHION AND COMPUTER INSTITUTE 8/113 I,SELVALAKSHMI NAGAR,ANGERIPALAYAM MAIN ROAD,TIRUPPUR 1-7-2014
4175 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE 324, JUNCTION MAIN RD, STATE BANK COLONY, MEYYANUR, SALEM. 15-9-2015
4176 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280 AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT. 21-9-2015
4177 SARASWATHI AMMAL EDUCATIONAL SOCIAL WELFARE TRUST 6/280, AARUMUGA IYER NAGAR, UNION OFFICE, THALAIVASAL PO, ATTUR TK, SALEM DT. 28-9-2015
4178 SARASWATHI VIDYA PEETAM 9-278, TIRUVURU ROAD, VISSANNAPET - 521215 ANDHRA PRADESH 16-3-2015
4179 SARASWATHY WOMENS SOCIAL DEVELOPMENT TRUST 20,21 GANAPATHI NAGAR,GABIREAL PURAM,KEELA VALADY,LALGUDI 15-9-2015
4180 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI 14-9-2015
4181 SARASWATI ACCOUNTANTS SOFTWARE PVT LTD 807, 8TH FLOOR, VIKRANT TOWER, RAJENDER PLACE, NEW DELHI -110008 18-9-2015
4182 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL, CHHINDWARA CHOWK SEONI 5-1-2016
4183 SARASWATI DRASHTI SHIKSHA SAMITI BHARGAV BHAVAN INFRONT OF TILAK SCHOOL CHHINDWARA CHOWK SEONI DIST. SEONI MP 480661 1-10-2015
4184 SARASWATI DUKHIBANDHAB PEOPLES FOUNDATION HIG - 173, K- VI, KALINGA VIHAR, BHUBANESWAR, DIST - KHORDHA, ODISHA 24-11-2015
4185 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT.BHATWADGAON TQ.POST.MAJALGAON DIST.BEED 17-5-2016
4186 SARASWATI SEVABHAVI SANSTHA BHATWADGAON AT-BHATWADGAON TQ.&POST-MAJALGAON DIST-BEED MAHARASTRA 22-7-2016
4187 SARASWATI SHIKSHA PRASAR SAMITI D-105, PANKI KANPUR 28-9-2015
4188 SARASWATI SHIKSHA PRASAR SAMITI VILLAGE PO. GARAH KASADA, TAH, CHAKARNAHAR, DISTT. ETAWAH, UTTAR PRADESH 12-1-2016
4189 SARAVANA COLLEGE OF PARAMEDICAL SCIENCE VIVEKANANDHA STREET, SELVARAJ NAGAR, VRIDDHACHALAM, CUDDALORE DT. 15-9-2015
4190 SARDAR PATEL TRUST VISNAGAR ARJANBARI, AT&POST- VADNAGAR, TALUKO- VADNAGAR, DIST-MEHSANA 23-6-2016
4191 SARDAR SOHAN SINGH EDUCATION AND SOCIAL WELFARE 1228 LAXMI BHAG NEAR HOME SCIENCE COLLAGE BEHIND PNB REGIONAL BRANCH NAPIER TOWN JABALPUR (M.P) 25-7-2016
4192 SARITHA VIDYA NIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI – 507303, KHAMMAM DIST, TELANGANA 9-8-2016
4193 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY # 7-5, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISCTRICT 6-10-2016
4194 SARITHA VIDYANIKETAN EDUCATIONAL SOCIETY H.NO 75, RAJEEV NAGAR, SATHUPALLI, KHAMMAM DISTRICT 27-10-2016
4195 SARJU PRASAD HIRALAL SAISHIK AVAM GRAMIN UTHAN SAM VILLAGE - SIKANDARPUR, AMOLYA, POST-MOHARI, KHURD 14-9-2015
4196 SAROJADEVI NARASIMHAN CHARITABLE TRUST NO:3, VALLI JAYAM NAGAR, MOTTUR, VIRUTHAMPET, VELLORE, VELLORE DISTRICT 5-1-2017
4197 SAROJADEVI NARASIMHAN CHARITABLE TRUST REGISTERED OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST, NO:16, 1ST CROSS STREET, TTK ROAD, APN BUILDING THIRD FLOOR, ALWARPET, CHENNAI - 600018. PHONE:04442038677 MOBILE:9942911592 MAIN OFFICE: SAROJADEVI NARASIMHAN CHARITABLE TRUST NO: 3, VALLI JAYAM NAGAR, KATPADI ROAD, MOTTUR VELLORE. TAMILNADU MOBILE: 9942911592 PHONE: 04162249516 14-9-2015
4198 SARPANCH SAMAJ L-21, STREET NO. -7 NEW MAHAVIR NAGAR 29-12-2016
4199 SARRV SOCIETY APTECH COMPUTER EDUCATION LINK ROAD PITHORAGARH UTTRAKHAND 15-9-2015
4200 SARSWATI EDUCATION SOCIETY PLOT NO 100 , "SARSWAT", MOHINI NAGAR ,NEAR DATTA MANDIR ,KEDGAON ,AHMEDNAGAR 26-9-2016
4201 SARSWATI EDUCATION SOCIETY PLOT NO.99, MOHININAGAR NEAR DATTA MANDIR ,KEDGAON DEVI , AHMEDNAGAR 6-1-2016
4202 SARSWATI EDUCATION SOCIETY PLOT NO.99 NEAR DATTA MANDIR , MOHININAGAR ,KEDGAON DEVI , AHMEDNAGAR 12-1-2016
4203 SARSWATI VIDHYALAYA SHIKSHAN SANSTHAN BEHIND OF POLICE STATION, WARD NO. 17, SARDARSHAHAR, DISTT.- CHURU 15-9-2015
4204 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR,NEAR BHIKAJI CAMA PLACE NEW DELHI 28-12-2016
4205 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI 5-1-2017
4206 SARTHAK EDUCATIONAL TRUST BUILDING NO.1,MOHAMMADPUR, NEAR BHIKAJI CAMA PLACE NEW DELHI 16-1-2017
4207 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR,OPP. JAIPUR DAIRY,JLN,JAIPUR 29-12-2016
4208 SARTHAK SOCIETY FOR HUMAN DEVELOPMENT B-3, VIVEK VIHAR, OPPOSITE TO JAIPUR DAIRY, AACHARYA HASTIMAL MARG, JAIPUR 6-1-2017
4209 SARVA COMPUTER SAKSHARTA EDUCATION SOC W SOCIETY SARVA COMPUTER SAKSHARTA MISSION, 101, ANJANI PLAZA, 2 ND FLOOR, ABOVE ICICI BANK, 3 ASHOK NAGAR, BHANWAR KUAN MAIN ROAD, INDORE (MP) 18-9-2015
4210 SARVAJANIK JAN KALYAN PARMARTHIK NYAS PEOPLE PUBLIC SCHOOL BUILDING ,PEOPLE CAMPUS,BHANPURA,BHOPAL 14-9-2015
4211 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001 5-9-2016
4212 SARVAJANIK SHIKSHONNAYAN SANSTHAN VILLAGE & POST ALLIPUR, DISTRICT HARDOI, UTTAR PRADESH, INDIA 241001 6-5-2016
4213 SARVA SHIKSHA VIKAS SAMITI SARVA SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY 7-12-2016
4214 SARVA SIDDDHANTA TRUST PLOT NO-107,KESORA,PO-BANKUAL,BHUBANESWAR,KHORDHA-751002 14-7-2016
4215 SARVA SIDDDHANTA TRUST PLOT NO 107,KESORA,BANKUAL,BHUBANESWAR,KHORDHA,ODISHA-751002 5-8-2016
4216 SARV JAN GRAMEEN VIKAS SANSTHAN ADDRESS- 322/11, PREM NAGAR, GURDASPUR, PANJAB 26-4-2016
4217 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER- 112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA 24-8-2016
4218 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA 7-9-2016
4219 SARVODAYA CONSTRUCTION AND DEVELOPMENT PVT LTD CHAMBER-112, HOTEL SARVODAYA, OM NANDA, RAJENDRA PATH, PATNA, BIHAR 16-9-2016
4220 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJRNDRA NAGAR, PATNA, BIHAR 8-8-2016
4221 SARVODAYA FITNESS AND HEALTHCARE PRIVATE LIMITED GROUND FLOOR, OM NIRDAM, R.K.AVENUE PATH, RAJENDRA NAGAR, PATNA 8-8-2016
4222 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA, BIHAR 16-9-2016
4223 SARVODAYA GRIH NIRMAN PVT LTD L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA 24-8-2016
4224 SARVODAYA GRIH NIRMAN PVT LTD L/001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA 7-9-2016
4225 SARVODAYA MARKETING PRIVATE LIMITED L/001, BLOCK- B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA 7-9-2016
4226 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALAYA APARTMENT, NAGESHWAR COLONY,BORING ROAD, PATNA,BIHAR 16-9-2016
4227 SARVODAYA MARKETING PRIVATE LIMITED L-001, BLOCK-B, OM NIRMALYA APARTMENT, NAGESHWAR COLONY, BORING ROAD, PATNA 24-8-2016
4228 SARVODAYA SAMITI AT - GANDHINAGAR, POST - KORAPUT, PS - KORAPUT, DIST - KORAPUT 17-4-2015
4229 SARV SAKSHARTA COMPUTER SHIKSHA NEAR ANANT RAM HOSPITAL, CHC ROAD, BARWALA 6-1-2016
4230 SARV SHIKSHA VIKAS SAMITI SARV SHIKSHA VIKAS SAMITI, 73, KELABAGH, NEAR KRISHNA HOSPITAL, BAREILLY 23-11-2016
4231 SARV SHRI MAA NARMADA SHIKSHA AVAM JAN KALYAN SAMI BAZAR WARD DEORI KALAN SAGAR 11-1-2016
4232 SAT CHIKITSA PRASARAK MANDAL YAVATMAL DIST YAVATMAL DR. BHAUSAHEB NANDURKAR COLLEGE OF ENGINEERING & TECHNOLOGY, SRI SATYA SAI KRIDA NAGARI, WAGHAPUR ROAD, YAVATMAL 29-3-2014
4233 SATCO CAPITAL MARKETS LTD 17, NOBLE CHAMBERS, GROUND FLOOR, JANMABHOOMI MARG, FORT, MUMBAI–400001 4-8-2016
4234 SATNAM MEMORIAL SOCIETY NH-6, AT POST- RIDHORA, TALUKA-BALAPUR 30-5-2016
4235 SATNAM MEMORIAL SOCIETY NH-6, RIDHORA, TALUKA BALAPUR, DISTRICT AKOLA 21-6-2016
4236 SATNAM MEMORIAL TRUST NAVJEEVAN TERRACE, JATHERPETH 2-3-2016
4237 SATPUDA HUMAN WELFARE FOUNDATION HOUSE NO 110 BHUJGAON TALUKA AKRANI DIST NANDURBAR 42514 20-7-2016
4238 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE, E-8, GULMOHAR COLONY, BHOPAL (M.P.) ADMINISTRATIVE OFFICE- E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.) 30-11-2016
4239 SATPURA VIGYAN SABHA REGD.OFFICE: 128/8, SAUTH AVENUE E-8 GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIV OFFICE: E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP)BHOPAL (M.P.) 5-10-2016
4240 SATPURA VIGYAN SABHA E-3/298, ARERA COLONY, ARYA SAMAJ MANDIR (10 NO. BUS STOP) 462016 BHOPAL (M.P.) 21-9-2016
4241 SATPURA VIGYAN SABHA REGD.OFFICE:128/8, SOUTH AVENUE,E-8, GULMOHAR COLONY, BHOPAL-462039 (M.P.) ADMINISTRATIVE OFFICE:E-3/298, ARERA COLONY, NEAR ARYA SAMAJ MANDIR (10 NO. BUS STOP) BHOPAL (M.P.) 9-9-2016
4242 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR 5-8-2016
4243 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR 16-11-2016
4244 SATWIK MINI INDIA EDUCATION SOCIETY 10, KHANDAGIRI SQURE, BHUBANESWAR 21-9-2016
4245 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQUARE BHUBANESWAR 12-9-2015
4246 SATWIK MINI INDIA EDUCATION SOCIETY KHANDAGIRI SQURARE, BHUABNESWAR, ODISHA 6-1-2016
4247 SATYA BAHUUDESHIYA PRASARAK MANDAL WADGAON ROAD,YAVATMAL 5-12-2016
4248 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI 11-5-2016
4249 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI 16-3-2016
4250 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ,VARANASI 26-4-2016
4251 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI 24-5-2016
4252 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI 24-5-2016
4253 SATYAM FOUNDATION B 38/266 KH-3 TULSIPUR MAHMOORGANJ, VARANASI 15-6-2016
4254 SATYAM SKILL DEVELOPMENT PRIVATE LIMITED #8-9-144, JPN ROAD, WARANGAL, TELANGANA STATE 10-2-2015
4255 SATYAM SKILLS CENTER VISHAKAPATNAM 16-11-2016
4256 SATYAM TECHNICAL AND EDUCATIONAL SOCIETY 2-5-620,MAINROAD,SUBEDARI,HANAMKONDA 13-1-2014
4257 SATYA SALUJA LITERACY FOUNDATION 20/6, NEUCHEM COMPOUND, MATHURA ROAD, FARIDABAD 22-2-2016
4258 SATYA SALUJA LITERACY FOUNDATION 20/6 NEUCHEM COMPOUND,MATHURA ROAD, FARIDABAD 6-1-2016
4259 SATYA SALUJA LITERACY FOUNDATION VIROHAN INSTITUTE OF ALLIED HEALTH AND MANAGEMENT SCIENCES,PLOT NO 63,NEELAM BATA ROAD,FARIDABAD 14-10-2015
4260 SATYA SEWA SANSTHAN S 1/4-26, RAJ RAJESHWARI NAGAR, GILLET BAZAR, VARANASI 6-11-2013
4261 SATYA SKILL EDUCATION AND CONSULTANCY PVT LTD 610, INDRAPRAKASH BUILDING, BARAKHAMBA ROAD, CONNAUGHT PLACE, NEW DELHI 7-10-2016
4262 SATYA SRI SAI SOCIAL WELFARE TRUST BAL GOPAL, RAM JAIPAL ROAD, ARPANA BANK COLONY, BAILEY ROAD, DANAPUR, PATNA 16-9-2016
4263 SAURASHTRA MEDICAL AND EDUCATIONAL CHARITABLE TRUS 'LIFE', RACECOURSE RING ROAD, RAJKOT -360001. GUJARAT, INDIA. TEL : (91-281) 2479133, FAX : (91-281) 2479122, E-MAIL : SAVELIFE@999LIFE.ORG, WEBSITE : WWW.999LIFE.ORG 4-1-2016
4264 SAURYA EDUNEXT GEN PVT LTD Z-55 WZ BLOCK, DAYALSAR ROAD, UTTAM NAGAR, NEW DELHI 3-1-2014
4265 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA JAMBHRUN ROAD, BULDANA TQ & DIST. BULDANA 18-1-2016
4266 SAVATA MALI SAMAJ VIKAS SHAIKSHANIK V BAHUDDESHIYA DNYANDEEP BUILDING, INFRONT OF GURUDWARA, JAMBHRUN ROAD, BULDANA, DIST. BULDANA 11-1-2016
4267 SAVE OUR SOUL INDIA WZ-980, PALAM EXTN. PALAM VILLAGE, NEW DELHI 26-2-2016
4268 SAVE OUR SOUL INDIA E-4/60 SULTANPURI NANGLOI NEW DELHI 15-3-2016
4269 SAVE OUR SOUL INDIA E-4/60, SULTANPURI, NANGLOI, NEW DELHI 14-3-2016
4270 SAWAN GRAMIN NIYOJAN EVAM SHODH SANSTHAN VILL NONEYA PATTI POST NONEYA PATTI BLOCK SISWAN 23-2-2016
4271 SAWJAN C/O PANDURANG KARBARI, 216, NORTH AVENUE, NEW DELHI 6-4-2015
4272 SAWRAJ MINORITY FOUNDATION C/O HASAN AMODI AT POST SATAMBA, TQ. DIST HINGOLI 5-8-2016
4273 SAYODHYA HOME FOR WOMEN IN NEED PLOT NO 95, UMABHAVAN, PRAKASHNAGAR HYDERGUDA VILLAGE RAJENDRANAGAR MANDAL HYDERABAD 16-5-2016
4274 SBA EDUCATION SOCIETY NEAR VIDHAN SABHA VILLAGE NARDAHA 28-9-2015
4275 SBC EXPORTS LIMITED PLOT NO.20, LOHIYA TALAB, CHHOTI BASAHI,VINDHAYACHAL 15-9-2015
4276 SBDA AT-GVBBGFHGFBFGB 25-11-2014
4277 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMUR,NADIA 13-5-2016
4278 SB EDUCATIONAL TRUST JAMTALAMORE,KARIMPUR,NADIA 16-6-2016
4279 SB EDUCATIONAL TRUST JAMTALA MORE,NEAR ALLAHABAD BANK,KARIMPUR 14-7-2016
4280 S B EDUCATION SOCIETY VPO PARBHUWALA TEHSIL BARWALA DISTT HISAR 125121 7-1-2016
4281 S B EDUCATION SOCIETY VPO PARBHUWALA TEH UKLANA MANDI DISTT HISAR HARYANA 22-7-2016
4282 SB GLOBAL EDUCATIONAL RESOURCES PVT LTD 836/89 ARACKAL BUILDING, JANATHA ROAD VYTILA KOCHI KERALA 3-4-2014
4283 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA 10-9-2015
4284 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA 11-1-2016
4285 SBJ CENTRE OF EXCELLENCE PRIVATE LIMITED 30/23-24, KNOWLEDGE PARK 3, GAUTAM BUDH NAGAR, GREATER NOIDA 7-1-2016
4286 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK 14-9-2015
4287 SBSQUARE CONSULTANCY SERVICES PRIVATE LIMITED IMCA, 6A, FIRST FLOOR, GOPAL COMPLEX, NEAR CHOTU RAM CHOWK, ROHTAK 2-11-2015
4288 SCAMPER TECHNOLOGIES AND SERVICES PRIVATE LIMITED OLD CORNAL HOUSE(SINGH PARA), OPP. OF SARKAR NURSING HOME, 45, H.G.B ROAD, AGARTALA-799001, 4-8-2016
4289 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT. 5-8-2016
4290 SCHELLA FOUNDATION SKILL DEVELOPMENT INSTITUTS 34B17/A2 MELA AGRAHARAM STREET, TRICHY MAIN ROAD, STATE BANK BACKSIDE, ARIYALUR PO-TK-DT. 7-9-2016
4291 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM 23-12-2016
4292 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM 21-12-2016
4293 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI 18-1-2017
4294 SCHOLARS ACADEMY EDUCATION TRUST SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT. GAROGHULI,GOG, GARCHUK. GUWAHATI 18-10-2016
4295 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO. 202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM 4-11-2016
4296 SCHOLARS ACADEMY EDUCATION TRUST FLAT NO.202B, PRASANTI PRIDE, TARUN NAGAR, GUWAHATI, ASSAM 22-11-2016
4297 SCHOLARS ACADEMY EDUCATION TRUST CHAIRMAN, SCHOLARS INSTITUTE OF TECHNOLOGY & MANAGEMENT, UNIT OF SCHOLARS ACADEMY EDUCATION TRUST, VILL.: GAROGHULI (GOG), GARCHUK, GUWAHATI, ASSAM 15-9-2015
4298 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO. 903, 9TH FLOOR, WESTERN EDGE - II, WESTERN EXPRESS HIGHWAY, BORIVALI (EAST), MUMBAI 400066 14-3-2016
4299 SCHOOLGURU EDUSERVE PRIVATE LIMITED UNIT NO.903, WESTERN HEIGHTS, WESTERN EXPRESS HIGHWAY, BORIVALI EAST, MUMBAI, MAHARASHTRA 400066 23-2-2016
4300 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST ,UJJAIN (MP) 23-10-2015
4301 SCIENCE FORUM FOR RURAL DEVELOPMENT AND RESEARCH TAKSHSHELA JUNIOR COLLEGE, GRAM MINDIA, NAVAKHEDA POST, UJJAIN 456010 (MP) 5-1-2016
4302 SCIENTIA EDUCATION AND TRAINING PRIVATE LIMITED E-1, MANSAROVAR GARDEN, NEW DELHI-110015 3-4-2014
4303 SCIENTIFIC SECURITY MANAGEMENT SERVICES PVT LTD E-1, MANSAROVER GARDEN, NEW DELHI 15-11-2013
4304 SCODWES SAVINILAYA BUILDING MARATIKOPPA MAIN ROAD SIRSI 14-10-2015
4305 SCOPE TRAINING AND CONSULTING PRIVATE LIMITED 105, PUSHPANJALI VENKATESH APARTMENT, BUDH MARG, PATNA 26-3-2014
4306 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WEL NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI 30-10-2015
4307 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI 28-9-2015
4308 S DHARAM SINGH MEMORIAL EDUCATIONAL AND SOCIAL WELFARE TRUST NEAR ANAJ MANDI, DADUPUR ROAD, CHHACHHRAULI 14-10-2015
4309 S D S SREE SREE MAHASIDDHYA NILAPADMA ASHRAM AT:-RATAGARH(BHALUNKA),PO-GODISAHI,PS:-BARANG 29-2-2016
4310 SD TECHNO SERVICES # 503, 4TH FLOOR, SGM MALL, ABOVE HDFC BANK, OPP TO BUS STOP, MEHDIPATNAM, HYDERABAD, A.P - 500028 17-4-2014
4311 SEARCHLIGHT HR SERVICES PVT LTD 312,ORION BUSINESS PARK, GHODBUNDER ROAD,THANE WEST 15-1-2016
4312 SEBIZ INFOTECH LTD SEBIZ SQUARE, IT C-6, SECTOR 67, MOHALI, PUNJAB 28-10-2013
4313 SECOND INNING HOUSE H. NO. C-72, FIRST FLOOR, GALI NO. 3, HARDEV NAGAR, JHARODA, BURARI, DELHI - 110084 19-1-2017
4314 SECURITY SKILLS COUNCIL INDIA LIMITED A-28&29, OKHLA INDUSTRIAL AREA, PHASE-I NEW DELHI 31-10-2013
4315 SECURITY SOLUTION SERVICES S2-83, GREEN PARK EXTN. BISALPUR ROAD, BAREILLY 15-9-2015
4316 SEDOTS INFO TECHNOLOGIES PRIVATE LIMITED 303, LAKE MELODY APARTMENT, NEAR HOTEL KATRIYA, RAJ BHAVAN ROAD, SOMAJIGUDA, HYDERABAD 6-4-2015
4317 SEEDAP EGM AP 0 -0, MAILURAI CENTER, GOLLAPUDI, IBRAHIMPATNAM, VIJAYAWADA, KRISHNA DISTRICT ANDHRA PRADESH. 5-2-2016
4318 SEED INFOTECH LTD 42/16, PANCHSHEEL, INCOME TAX OFFICE LANE, ERANDWANE 11-11-2014
4319 SEG EDUCATIONAL GROUP P LTD 36B/1 FIRST FLOOR GOVINDPURI KALKAJI NEW DELHI 17-4-2014
4320 SEKAR EDUCATIONAL TRUST 3/1 NEW STREET, KEELAKUDIERUPPU, JAYANKONDAM POST, UDAYARPALAYAM TALUK ,ARIYALUR 8-9-2016
4321 SEKAR EDUCATIONAL TRUST 2/388 PERIYAR NAGAR, SENDURAI POST,ARIYALUR 14-10-2016
4322 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA 14-9-2015
4323 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO - 1180/3184, AHAMEDPUR, PO - SAKHIGOPAL, BLOCK - SATYABADI, DIST- PURI, ODISHA 6-5-2016
4324 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, PO-SAKHIGOPAL, DIST-PURI, ODISHA 14-3-2016
4325 SEKH ALLAUDDIN MEMORIAL TRUST PLOT NO. 1180/3184, ISBE TOWER, AT- AHMEDPUR, POSAKHIGOPAL, DIST-PURI, ODISHA 8-4-2016
4326 SELF DEVELOPMENT INSTITUTE 30-SHIVPURI COLONY, NEW SANGANER ROAD,SODALA, JAIPUR -302006 1-12-2014
4327 SELF EMPLOYED WORKERS ASSOCIATION KENDRA SEWAK AT-RANGIAMUNDA,PO-TANGARPALI,VIA-UJALPUR 3-4-2014
4328 SELF RURAL EMPOWERMENT AND EDUCATIONAL SERVICES ORGANIZATION # 48-10-5A, 2nd FLOOR, SERVICE ROAD, RAMAVARAPADU RING CENTRE, VIJAYAWADA-521108. KRISHNA DIST, ANDHRA PRADESH, INDIA 10-2-2015
4329 SELVA EDUCATIONAL TRUST THETHAMPATTU,SRIMUSHNAM, K.M.KOIL,(T.K) CUDDALORE,(D.T) TAMILNADU. 21-10-2014
4330 SELVA EDUCATIONAL TRUST THETHAM PATTU, NAGARAPADI POST 21-8-2014
4331 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR ST, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPPURAM DT, 5-1-2017
4332 SELVA MANNANKATTI AMMAL EDUCATIONAL TRUST 72 K BAZZAR STREET, PNP COMPLEX, CHINNASALEM PO & TK, VILLUPURAM DT,TAMILNADU. 17-1-2017
4333 SELVAM DRIVING SCHOOL 23 JAISAKTHI NAGAR , KOVAI ROAD , POLLACHI 30-4-2015
4334 SENDHUR EDUCATIONAL TRUST SRI MEENAKSHI COLLEGE OF PARAMEDICAL SCIENCE GOWTHAM POLYCLINIC,SRI MEENAKSHI COLLEGE OF PARAMEDICAL SCIENCE, 12, MENGLES ROAD, NAGAL NAGAR, DINDIGUL, TAMILNADU 11-11-2014
4335 SENTIO ADVISORY INITIATIVE PRIVATE LIMITED B 604 UNITECH BUSINESS ZONE SECTOR 50 NIRVANA COUNTRY GOLF COURSE EXTENSION ROAD 11-3-2016
4336 SERVE INDIA 1/100 TEMPLE ROAD, WEST HILL, KOZHIKODE 15-4-2014
4337 SERVICE 6-10-73/17,JALADIWARI STREET REPALLE GUNTUR 4-1-2016
4338 SETH BIMAL PRASAD JAIN EDUCATIONAL TRUST VILL IMLIKHERA, DHARAMPUR, 12TH MILE STONE, BHAGWANPUR HARIDWAR HIGHWAY, ROORKEE 17-9-2015
4339 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA 9-5-2016
4340 SETH RAMJI DAS MODI VIDYA NIKETAN SOCIETY MODI HOUSE GUMANPURA KOTA 17-5-2016
4341 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK,OPP MARAMMA TEMPLE, HOLALKERE ROAD, CHITRADURGA-577501 18-9-2015
4342 SEVA INTEGRATED DEVELOPMENT SOCIETY NEAR HP PETROL BUNK, HOLALKERE ROAD,CHITRADURGA-577501 11-9-2015
4343 SEVAKIRAN CHARITABLE SOCIETY THRIKKARIYOOR P.O., KOTHAMANGALAM, ERNAKULAM DISTRIC 4-8-2016
4344 SEVA SANKALP SANSTHAN VPO-THIKARIA TH.-SIKARIA DISTT.-DAUSA RAJASTHAN 6-12-2016
4345 SEVA TRUST NO. 10 A, BETHANI STREET, BATLAGUNDU, NILAKOTTAI TALUK, DINDIGUL DIST, TAMILNADU 5-12-2014
4346 SEVENSEAS SHANTI EDUTECH PRIVATE LIMITED 1551/1, GWAL TOLI, CIVIL LINES, JHANSI 13-1-2015
4347 SEWADRISHTI SOCIETY SEWADRISHTI SOCIETY, VIKAS COLONY, NEAR BSNL OFFICE, GOL MARKET, RAJGARH, ALWAR DISTRICT 30-1-2014
4348 SEWAK SEWAK SOCIAL AND ENVIRONMENTAL WELFARE ASSOCIATION OF KHILCHIPUR, N H 12, NEAR BUS STAND, WARD NO 14, KHILCHIPUR 24-6-2015
4349 SEWA SANKALP SANSTHAN V.P.O-THIKARIA,TH.-SIKARIA ,DIST.DAUSA,RAJASTHAN 14-12-2016
4350 SGR EDUVENTURES PRIVATE LIMITED FRIENDSHIP CENTRE, NEAR AGRIPADA POLICE STATION, OPP YMCA GARDEN, MUMBAI CENTRAL, MUMBAI 22-12-2013
4351 SGRS ACADEMIC PRIVATE LIMITED 3RD FLOOR, SRI MOHAN BUILDING, SITA COMPOUND,5, NEAR OVER BRIDGE, MAIN ROAD, RANCHI 15-9-2015
4352 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, M.G.ROAD, BORIVALI(E), MUMBAI 9-12-2016
4353 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP.NATIONAL PARK, MG ROAD, BORIVALI-EAST, MUMBAI 1-11-2016
4354 SGR TECHNO SKILL PVT LTD 212, 2ND FLOOR, HARI OM PLAZA, OPP. NATIONAL PARK, M.G. ROAD, BORIVALI (E), MUMBAI 30-11-2016
4355 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075 6-1-2016
4356 SHADE INDIA SOCIETY FLAT NO 375, GANGOTARI APPARTMENT, POCKET – 1, SECTOR – 12, DAWARKA, NEW DELHI – 110075 15-1-2016
4357 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA) 5-7-2016
4358 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD MANDI KALANWALI TEH KALANWALI DISTRICT SIRSA (HARYANA) 26-7-2016
4359 SHAHEED BHAGAT SINGH SOCIAL WELFARE TRUST SBS COLLEGE ODHAN ROAD, MANDI KALANWALI TEHSIL KALANWALI DISTRICT SIRSA HARYANA 15-6-2016
4360 SHAHI EXPORTS PRIVATE LIMITED SHAHI EXPORTS PVT. LTD.INDL.PLOT NO-1, SECTOR 28, FARIDABAD 23-11-2013
4361 SHAH KANCHANBEN BABULAL KADIWALA CHARITABLE TRUST THE H B KAPADIA NEW HIGH SCHOOL, NEAR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD 12-8-2015
4362 SHAHU PHULE AMBEDKAR BAHUUDDESHIYA SEVA SANSTHA RASHTRIYA MAGASWARGIYA KHULE KRISHI VIDYALAYA [IT] NALDURG NEAR HIGHWAY POLICE STATION NH.9 NALDURG TQ. TULJAPUR DIST OSMANABAD MH 413602 12-9-2015
4363 SHAKTI INFOTECH PVT LTD 304. 3RD FLOOR , SAMARADDHI COMPLEX , S. P. Verma Road PATNA 4-12-2014
4364 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN 22-6-2016
4365 SHAKTIPADA BHATTACHARJEE TECHNICAL INSTITUTE DIGHIRKONE, UCHALAN, BURDWAN 20-7-2016
4366 SHALBY ACADEMY C/O KRISHNA SHALBY HOSPITAL , 319 - GREEN CITY , VIA BOPAL AHMEDABAD 13-9-2015
4367 SHALIVAHANA GREEN ENERGY LTD 7 TH FLOOR, MINERVA COMPLEX, 94 SAROJINI DEVI ROAD, SECUNDERABAD 23-4-2015
4368 SHANKER MADDHURYA FOUNDATION 101, 27A,ROWLAND ROAD, KOLKATA 19-8-2015
4369 SHANNO BUSINESS INDIA PRIVATE LIMITED 402 3RD FLOOR GANDHI COMPLEX BAL ASHRAM COMPOUND KUTCHERY CHOWK RAIPUR CHHATTISGARH 23-11-2016
4370 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING AND MANAGEMENT FATIHA HATAWALI ROAD FARAH MATHURA 30-10-2015
4371 SHANTI DEVI MEMORIAL CHARITABLE TRUST NIKHIL INSTITUTE OF ENGINEERING & MANAGEMENT FATIHA,NH-2,FARAH MATHURA 17-9-2015
4372 SHANTI EDUCATIONAL INITIATIVES LIMITED 283, NEW CLOTH MARKET, AHMADABAD, GUJARAT 14-7-2014
4373 SHANTI MAITRI GRAMIN VIKAS SANSTHAN 05 BANGLOW SCHOOL PARISAR CHARMUDIYA POST KURUD DISTRICT DHAMTARI (CHHATTISGARH) 3-3-2016
4374 SHANTI MAITRI GRAMIN VIKAS SANTHAN 05 BANGLA VILLAGE CHARMUDIYA, POST OFFICE KURUD DISTRICT DHAMTARI CHHATTISGARH 12-9-2015
4375 SHARANPRABHA BAHUDDESHIYA SANSTHA 287/1, SALESHWAR HSG. SOCIETY,VIJAPUR ROAD, SOLAPUR, MAHARASHTRA 15-9-2015
4376 SHARDA RURAL SHIKSHA VIKAS SAMITI SANSAKAR BHARTI PUBLIC SCHOOL NANGLI BALAHIR TEH.- BEHROR 29-12-2016
4377 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PRIVATE LTD GROUND FLOOR,KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS, NEAR AIRTEL EXCHANGE 14-9-2015
4378 SHARDEY INDIA INSTITUTE OF TECHNOLOGY PVT LTD GROUND FLOOR, KAHUDAG BARACHATTI, SHARDEY SAMRIDDH NIWAS , NEAR AIRTEL EXCHANGE 23-6-2016
4379 SHARON EXPORTS 10 TEACHER STREET AYAPPAKKAM CHENNAI 21-7-2014
4380 SHAR TECHNOLOGIES GROUP 204, PARK VIEW RESIDENCY, OPPOSITE COMMUNITY HALL, SIDDHARTHA NAGAR, HYDERABAD, TELANGANA 17-3-2015
4381 SHEEBA DRIVING SCHOOL P.A.JANARTHANAN, 0/1,SHEEBA DRIVING SCHOOL, CADAPPA TRUNK ROAD,THIRUTHANI, THIRUVALLUR. 10-11-2014
4382 SHELTON HOSPITALITY PRIVATE LIMITED D.NO:87-1-19/B, AYYAPPA NAGAR, APS RTC COMPLEX ROAD, RAJAMAHENDRAVARAM 12-8-2016
4383 SHETI VA SHETKARI VIKAS BHUUDESHIYA SANTHA JALNA M-15, CHOUDHARI NAGAR, MANTHA ROAD, JALNA 8-1-2016
4384 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W) 15-6-2016
4385 SHETKARI SHIKSHAN PRASARAK MANDAL MUMBAI S.S.P.M'S EDUCATIONAL COMPLEX, OPP. GAURIPADA TALAO, NEAR MILIND NAGAR, YOGIDHAM, KALYAN (W). 17-5-2016
4386 SHI KANDULA OBUL REDDY CHARITIES I-397-1,COURT ROAD,KADAPA,KADAPA 26-4-2016
4387 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR, SARAN, BIHAR 28-9-2015
4388 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR 2-3-2016
4389 SHIKSHA SHIKSHA AVENUE, DUDHAILL GACHHI, SONPUR, SARAN, BIHAR 23-5-2016
4390 SHIKSHA SHIKSHA AVENUE, DUDHAILLA GACHI, SONPUR 16-6-2016
4391 SHIKSHA EVAM KALYAN SAMITI RAJMAHAL ROAD PO- BARHARWA DIST - SAHEBGANJ 13-11-2014
4392 SHIKSHA PRASAR SAMITI VILLAGE POST GWALIKHERA, TEHSIL DISTT BAGHPAT U.P 23-5-2016
4393 SHIKSHA VISTAR SAMITI VILLAGE SARAYBIRU (SARKI ROAD) POST KERAKAT DISTT. JAUNPUR UP 222142 2-3-2016
4394 SHILPI FOUNDATION 1ST FLOOR,BHAVANI CHAMBERS, OPP. BATA SHOW ROOM, NEXT TO TIMES OF INDIA, ASHRAM ROAD, AHMEDABAD 17-5-2016
4395 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008 14-9-2015
4396 SHINE FOUNDATION 2-2-8,MAIN ROAD, NAIM NAGAR, HANMAKONDA, WARANGAL, TELANGANA STATE-506008 14-10-2015
4397 SHINE FOUNDATION # 5-11-283,NAIM NAGAR, HANMAKONDA, DIST:WARANGAL, TELANGANA STATE,PIN: 506001 13-5-2016
4398 SHINE INSTITUTE OF MANAGEMENT AND IT PVT LTD C/O-SHINE INSTITUTE OF MANAGEMENT AND INFORMATION TECHNOLOGY PVT. LTD. 1ST FLOOR , CHOUDHURY COMPLEX, NEAR GADAGADIA CHHAK , BALASORE- 756003,ODISHA , INDIA. 18-6-2015
4399 SHISHU SAROTHI SHISHU SAROTHI,CENTRE FOR REHABILITATION & TRAINING FOR MULTIPLE DISABILITY,OFF RAMAKRISHNA MISSION RD,BIRUBARI,GUWAHATI-781016,ASSAM 15-4-2014
4400 SHITAL EDUCATION AND CHERITABLE TRUST 2212/C, HILL DRIVE,SANSKAR MANDAL, TALAJA ROAD. BHAVNAGAR.364002 17-9-2015
4401 SHIVAGRAM EDUCATION SOCIETY SHIVAGRAM EDUCATION SOCIETY'S SHREE RAYESHWAR INSTITUTE OF ENGINEERING & INFORMATION TECHNOLOGY, SHIVSHAIL, KARAI, SHIRODA, GOA 27-11-2015
4402 SHIVA INDUSTRIAL SECURITY AGENCY GUJRAT PVT LTD R S NO 71, SAMEER COMPLEX, NAVSARJAN SOCIETY, PANDESARA, SURAT (GUJRAT) 25-11-2014
4403 SHIVAJI CANE PROCESSORS LIMITED D4, MIDC SHIRALA, TAL SHIRALA, DIST - SANGLI 2-3-2016
4404 SHIVAJI PHYSICALLY HANDICAP AUDHOGIK SAHKARI SANSHTA MARYADIT NAGPUR 28 DR SIDDIQUI COMPLEX KAMPTEE ROAD ASI NAGAR NAGPUR MAHARASHTRA 440017 6-4-2015
4405 SHIVALIK EDUCATION SOCIETY P.O. PISEGAON, BALOD ROAD, DURG. STATE - CHHATTISGARH 1-9-2014
4406 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY, BHOPAL (M.P) 18-10-2016
4407 SHIVAM FOUNDATION SAMITI E - 5/99, ARERA COLONY BHOPAL (M.P) 22-9-2016
4408 SHIVAM FOUNDATION SAMITI E -5/99, ARERA COLONY BHOPAL (M.P) 8-9-2016
4409 SHIVA MINERALS PLOT NO.69, SHIVAJI NAGAR, YAVATMAL, DISTRICT-YAVATMAL, MAHARASHTRA 7-2-2014
4410 SHIVANI EDUCATIONAL AND CHARITABLE TRUST SHIVANI EDUCATIONAL AND CHARITABLE TRUST C/O-SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET 11-1-2016
4411 SHIVANI EDUCATION AND CHARITABLE TRUST CAMPUS ADDRESS SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET 15-6-2016
4412 SHIVANI EDUCATION AND CHARITABLE TRUST AT:- SHAILASHREE, MAHANADI VIHAR, TULASIPUR. CUTTACK 5-8-2016
4413 SHIVANI EDUCATION AND CHARITABLE TRUST SYNERGY INSTITUTE OF ENGINEERING & TECHNOLOGY BANAMALIPRASAD, BY THE SIDE OF NH 55 DHENKANAL, ODISHA, INDIA - 759 001 TELEFAX: 91 6762 225905/226708 EMAIL: SIETDKL@SYNERGYINSTITUTE.NET 24-5-2016
4414 SHIVA PROTECTION FORCE PRIVATE LTD HO:FLAT NO-201,LAXMI TOWER,MAIN ROAD HINOO,RANCHI(JHARKHAND) BO:FLAT NO-002,SHREE SHYAM KUNJ APPT.BASANT VIHAR COLONY,BORING ROAD.PATNA. 6-9-2015
4415 SHIVASHAKTI BIOTECHNOLOGIES LIMITED # 7-1-621/98/621/34, OPP AXIS BANK, SANJEEVA REDDY NAGAR, HYDERABAD 14-1-2016
4416 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY KRN INSTITUTE OF TECHNOLOGY VILLAGE KHAIRI P.O. BODLA KURUKSHETRA 6-5-2016
4417 SHIV BABA EDU SOCIAL WELFARE AND CHARITABL SOCIETY K.R.N INSTITUTE OF TECHNOLOGY VILL. KHAIRI P.O. BODLA KURUKSHETRA 27-6-2016
4418 SHIVI MULTITECH PRIVATE LIMITED E-176, SECTOR - 63, NOIDA 11-11-2014
4419 SHIV PRATISTHAN PLOT NO.69,SHIVAJI NAGAR, NEAR SHIV NAGAR PLAY GROUND, YAVATMAL 7-10-2013
4420 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR (MAHARASHTRA) 24-11-2015
4421 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ TAL. MALSHIRAS, DIST. SOLAPUR 15-1-2016
4422 SHIVRATNA SHIKSHAN SANSTHA SHIVRATNA KNOWLEDGE CITY, SHIVAMRUT ROAD, SHANKARNAGAR - AKLUJ, TAL. MALSHIRAS, DIST. SOLAPUR 12-1-2016
4423 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT-PATNA BIHAR-801503 28-10-2016
4424 SHIV SEVA SANSTHAN MANER BHUDHARTOLA, VIA-VYAPUR, DISTT- PATNA BIHAR- 801503 13-10-2016
4425 SHIVTEJ AROGYA SEVA SANSTHA AT POST KHED, DISTRICT RATNAGIRI MAHARASHTRA 29-4-2016
4426 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G 5-1-2017
4427 SHIZA FOUNDATION SHIZA FOUNDATION, SKILL TRAINING CENTER, VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR 28-12-2016
4428 SHIZA FOUNDATION SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G 13-1-2017
4429 SHIZA FOUNDATION VIKAS NAGAR AMLIDIH ROAD DEOPURI RAIPUR C G 30-11-2016
4430 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI 16-3-2016
4431 SH MAHAVIR GROUP OF SOCIETY H.NO- 155,JINDPUR DELHI-110036 15-3-2016
4432 SH MAHAVIR GROUP OF SOCIETY 155, JINDPUR, P.O MUKHMELPUR, DELHI 8-4-2016
4433 SH MAHAVIR GROUP OF SOCIETY 155,JINDIPUR DELHI 110036 9-2-2016
4434 SHOBHIT UNIVERSITY CORPORATE OFFICE: SHOBHIT UNIVERSITY; UNIVERSITY TOWER; PLOT #7; INSTITUTIONAL AREA; POCKET B; MAYUR VIHAR PHASE 2; DELHI 12-10-2013
4435 SHODH 180/22 ZAKIR NAGAR, OKHLA NEW DELHI 26-4-2016
4436 SHODH 180/22, ZAKIR NAGAR, OKHLA 20-7-2016
4437 SHODH ANALYSISTS PRIVATE LIMITED REGD.OFFICE - 29, EDEN GARDEN, CHUNA BHATTI, BHOPAL WORKING OFFICE - A-115, PALACE ORCHARD, BHOPAL 6-10-2016
4438 SHOPPERS STOP LTD SHOPPERS STOP LTD EUREKA TOWERS, 9TH FLOOR, B WING, MINDSPACE,PLOT 504,LINK ROAD, MALAD WEST, MUMBAI, MAHARASHTRA 4-2-2015
4439 SHORYA AMAJ SEVI AVM SAW VAYAVSY PRASHIKASHAN SANS 25-C, KAJOD COLONY, ROOP NAGAR-II, TONK PHATAK, DISTRICT- JAIPUR, STATE RAJASTHAN 14-10-2015
4440 SHRADHA COMPUTERS CO OPERATIVE LIMITED RATLAM 151,SAI SAJJAN SHASTRI NAGAR RATLAM MP 24-8-2015
4441 SHRAM VIDYA PEETH FIRST FLOOR NEELGIRI COMPLEX(SAGAR BHAWAN)FAIZABAD ROAD, INDIRANAGAR,LUCKNOW-226016 23-6-2016
4442 SHREE AMRUTVAHINI GRAMVIKAS MANDAL SAI RO- BANGLOWS, B-4, ANANADNAGAR, SAYHADRI CHOWK, BEHIND WASAN AUTOMOBILE, NAVNAGAPUR MIDC, AHMEDNAGAR 22-11-2016
4443 SHREE ANAND EDUCATIONAL CHARITABLE TRUST NO.1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION, RAICHUR. 9-9-2016
4444 SHREE ANAND EDUCATIONAL CHARITABLE TRUST H NO 1-4-1493/11 IDSMT LAYOUT NEAR RADIO STATION RAICHUR 26-8-2016
4445 SHREE ANAND EDUCATIONAL CHARITABLE TRUST OPP RADIO STATION RAICHUR 20-7-2016
4446 SHREE BHAGWAN SINGH EDUCATIONAL SOCIETY INDRAPRASTH AEROSPACE & KNOWLEDGE PARK, SEC-77, DELHI-JAIPUR HIGHWAY (NH-8), GURGAON, HARYANA-122004 17-4-2014
4447 SHREE BHOLE BABA ICE AND COLD STORAGE PRIVATE LTD JALESAR ROAD, TERI BAGIA, AGRA (U.P.) 3-4-2014
4448 SHREE CHINTPURNI APPARELS PRIVATE LIMITED CN-24, TALAB ROAD, MANGOL PUR KHURD, NEW DELHI 8-12-2013
4449 SHREE DEEN NARAYAN MAURYA SIKSHA SEWA SAMITI ITI ROAD LEKHPAL COLONY PATEL NAGAR,CHATURI KA PURWA, NEAR ALKA HOSPITAL FATEHPUR 21-10-2016
4450 SHREE DEVLEELA SURANA FOUNDATION DEVLEELA KNOWLEDGE PARK, NEW DHAMTARI ROAD (NH-43), MANA RAIPUR, C.G. INDIA 17-5-2016
4451 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303 30-5-2016
4452 SHREEDHAR FOUNDATION KATHAUTA, GOPIGANJ, BHADOHI, SANT RAVIDAS NAGAR, DISTRICT, GYANPUR BLOCK UP-221303 30-5-2016
4453 SHREE DUTT CHARITABLE TRUST 311, LANDMARK, NEAR SAYAJI LIBRARY, NAVSARI, GUJARAT, INDIA 21-1-2015
4454 SHREE GANESH BUILDTECH CONSTRUCTION PVT LTD 1/1857-A, T/F P. NO-2 MOTI RAM ROAD, SHAHDARA NEW DELHI 22-2-2016
4455 SHREE GANESH SAMAJ KALYAN SAMITI DUG-33,1ST FLOOR,PUSHPA COMPLEX,HISAR HARYANA 21-9-2016
4456 SHREE GAYATRI EDUCATION TRUST OPP. VISHNU SALES NR. OM HOSPITAL JETPUR ROAD 14-10-2015
4457 SHREE GAYATRI EDUCATION TRUST SHREE RANDAL KRUPA NR. OM HOSPITAL OPP. VISHNU SALES JETPUR ROAD 27-11-2015
4458 SHREE GAYATRI EDUCATION TRUST NR. OM HOSPITAL JETPUR ROAD, GONDAL 7-1-2016
4459 SHREE GNANADEVI EDUCATIONAL AND CHARITABLE TRUST 4/74,THURAIYUR MAIN ROAD, REDDIPATTY(PO), NAMAKKAL. 6-10-2016
4460 SHREE GUJARAT EDUCATION TRUST SCIT COLLEGE OF IT & MANAGEMENT :Head Office @ RANDER :2ND FLOOR, SCIT BUILDING, OPP. BOB NAVYUG COLLAGE BRANCH, NEW RANDER ROAD , SURAT-9. 2-11-2013
4461 SHREE GURUDEV DATTA SEVA TRUST SR. NO. 206, DESHMUKH COLONY, TUKAI DARSHAN, PHURSUNGI, TAL-HAVELI, DIST-PUNE 24-8-2015
4462 SHREE JAGRUTI BAHUUDESHIYA VIKASH SHIKSHAN SANSTHA AT POST TALUKA SADAK ARJUNI C/O DHANWANTHRI MEDICAL BUILDING NO.988 15-9-2015
4463 SHREE KALKA DEVI EDUCATION TRUST 229-C, TRIVENI, SHEIKH SARAI-1, NEW DELHI, 13-1-2017
4464 SHREE LALJEE PRASHIKSHAN KENDRA SHREE LALJEE PRASHKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD, JHARKHAND 15-11-2016
4465 SHREE LALJEE PRASHIKSHAN KENDRA PUTKEE BAZAR, P.O:-KUSUNDA DIST:-DHANBAD 29-11-2016
4466 SHREE MAA SHARDA RASTRIYA SEWA SAMITI 51/3 OLD RAJENDRA NAGAR 25-11-2014
4467 SHREE MAN MANDIR EDUCATION TRUST RIVERA WAVE 9TH FLOOR, OFFICE NO.902, NR.KALAVAD ROAD, RAJKOT 13-1-2017
4468 SHREE MAN MANDIR EDUCATION TRUST RAJKOT "KRISHNA COMPLEX" 2ND FLOOR, AJI DEM CHOWKADI,RAJKOT 11-5-2016
4469 SHREE MAN MANDIR EDUCATION TRUST RAJKOT RIVERA WAVE, 9TH FLOOR OFFICE NO. 902 RAJKOT RD, NANA MAVA,RAJKOT, GUJARAT 360005 26-7-2016
4470 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILL- CHAURA, P.O- GADWARA, PRATAPGARH- 230502 (U.P) 6-1-2016
4471 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST GADWARA, DIST: PARATAPGARH 18-9-2015
4472 SHREENAGESHWARSINGHSHIKSHANPRASHIKSHANMAHAVIDYALAY VILLAGE: CHAURA, POST: GADWARA, DISTT: PRATAPGARH, UP 28-9-2015
4473 SHREE PALSIDDHE SWAMI BAHUUDESHIYA SEVABHAVI SANSTHA PUSEGAON AT-POST-PUSEGOAN TQ.SENGOAN DIST-HINGOLI 9-12-2016
4474 SHREE PANCHAMUKHI EDUCATIONAL AND CHARITABLE TRUST OFF: PLOT NO 389, BOMIKHAL, CUTTACK ROAD, HUBANESWAR CAMPUS:PLOT-261, ATALA, PANCHAMUKHI VIHAR, BHUBANESWAR 8-1-2016
4475 SHREE PANCHAMUKHI EDUCATIONAL CHARITIABLE TRUST 261 ATALA PANCHAMUKHI VIHAR BHUBANESWAR 14-9-2015
4476 SHREE PARANTAP INSTITUTE OF CNC PROGRAMMING 290/3,B/H BUNDY INDIA PVT. LTD,NR.SUSEN CIRCLE,G.I.D.C.ESTATE,MAKARPURA,VADODARA. 16-9-2015
4477 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029 19-1-2017
4478 SHREEPRASAD CONSULTANCY SERVICES PRIVATE LIMITED FLAT NO. 6 BUILDING I SHIVNAGARI S NO.70/1-17B, NEAR MAHATMA SOCIETY KOTHRUD, PUNE - 411029 13-1-2017
4479 SHREE RAJASTHAN SYNTEX LIMITED POST BOX NO.5, SIMALWARA ROAD , DUNGARPUR 31-1-2014
4480 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA 6-7-2016
4481 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA A/P-WING,TAL-KHANDALA,DIST-SATARA 17-5-2016
4482 SHREE RAMESHWARGURUKUL TATHA GOVIANYAN SANSTHA AT.POST WING TAL. KHANDALA DIST. SATARA 8-9-2016
4483 SHREE SADGURU AYURVEDIC EDU AND RES FOUNDATION 74, GIRIJASHANKAR SOCIETY, GULMOHAR LANE, SION CHUNABHATTI, MUMBAI 8-5-2014
4484 SHREE SAI EDUCATIONAL AND SOCIAL WELFARE SOCIETY E/2, 30 ARERA COLONY BHOPAL 14-9-2015
4485 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL, IIND FLOOR MAIN ROAD BELLARE 4-1-2016
4486 SHREE SHERA EDUCATIONAL TRUST COMMUNITY POLYTECHNIC BELLARE,SHAHIN MAAL,IIND FLOOR,MAIN ROAD BELLARE 1-10-2015
4487 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANLLUR CHENNAI TAMILNADU 5-1-2016
4488 SHREE VAASAVI EDUCATIONAL AND CHARITABLE TRUST NO.2/15, 17TH STREET, B.V. NAGAR, NANGANALLUR, CHENNAI 28-9-2016
4489 SHREE VAISHNO EDUCATIONAL SOCIETY BIULDING NO.12,DEEP CENTRAL MARKET ASHOK VIHAR-PHASE-1 NEW DELHI-110052 11-3-2015
4490 SHREE VINAYAK VIDHYALAYAA CHARITABLE TRUST ERRATTAIKARADU, PARUVACHI(PO), BHAVANI(TK), ERODE(DT), TAMILNADU, INDIA, PIN:638312. 20-1-2015
4491 SHREYAS S BATTERY P.B. NO. 77, SULTHAN BATHERY, WAYANAD, KERALA, INDIA 30-1-2014
4492 SHRI ANNAPURNA KHADI GRAMOTHAN VIKAS SANSTHAN C/0 SANJAY SINGH BAGHEL ADVOCATE PUSHPANJALI COLONY MUKHTIYAR GANJ SATNA 21-8-2015
4493 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON 14-7-2016
4494 SHRI ASHTAVINAYAK SHAIKSHNIK AND SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON 21-6-2016
4495 SHRI ASHTAVINAYAK SHAIKSHNIK SANSKRUTIK MANDAL 24, UNITY CHEMBER, GANESH COLONY ROAD, JALGAON 17-5-2016
4496 SHRI ASHTVINAYAK EDUCATIONAL TRUST VILLAGE-KHARKALI.P.O.-BAKALI VIA LADWA. DISTRICT-KURUKSHETRA 4-1-2016
4497 SHRI BAGAMPRIYAL EDUCATIONAL TRUST 218A NAMATHVAR PRAYER CENTRE NORTH CAR STREET THOOTHUKUDI 7-1-2015
4498 SHRI BAJRANG VIKAS MANDAL TRUST 548/4,BAHUCHAR MATA MANDIRSANKUL, 1ST FLOOR, MACHAKDI NAKA, BILIMORA, TA. GANDEVI. DIST-NAVSARI,GUJARAT 9-5-2016
4499 SHRI BALAJI MEDICAL FOUNDATION SHRI BALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHATTISGARH 7-12-2016
4500 SHRI BALAJI MEDICAL FOUNDATION SHRIBALAJI HOSPITAL, DUBEY COLONY, MOWA, RAIPUR, CHHATTISGARH 23-11-2016
4501 SHRI BALMAAN MEMORIAL FOUNDATION 17, MLA QUARTERS, JAWAHAR CHOWK BHOPAL (M.P.) 14-7-2014
4502 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199, GROUND FLOOR, NEW B.J.MARKET, JALGAON 23-6-2016
4503 SHRI CHHATRAPATI SHIVAJI PARYAVARAN VA SHETI VIKAS 199 GROUND FLOOR NEW B.J.MARKET JALGAON 30-5-2016
4504 SHRI CHINTAMANI PARASKRIPA SHAHARI VA GRAMIN VIKAS KESHAR HIRA,YOGEKSHAM COLONY,VISAVA NAKA ,PATHARI ROAD ,PARBHANI 16-9-2015
4505 SHRI GANESH SIKSHA SAMITI SHRI GANESH SIKSHA SAMITI AMAHA SIDHI MP 14-9-2015
4506 SHRI GURU NANAK DEV JI EDUCATIONAL SOCIETY DAMKORA ROAD TOHANA DISTT. FATEHABAD HARYANA 10-2-2015
4507 SHRI GURU RAM DASS EDUCATIONAL SOCIETY 367, PARTAP AVENUE, GAMLIA WALA BAZAR, OPP ALPHA ONE MALL, G. T. ROAD AMRITSAR 24-6-2016
4508 SHRI GURU RAMDAS SHIKSHA SAMITI 1 ASHOKA GARDEN, RAISEN ROAD, BHOPAL 19-8-2015
4509 SHRI GURU RAMDAS SHIKSHA SAMITI 01 ASHOKA GARDEN RAISEN ROAD BHOPAL 15-11-2016
4510 SHRI GURU RAMDAS SIKSHA SAMITI 1, ASHOKA GARDEN, RAISEN ROAD, BHOPAL 24-10-2016
4511 SHRI JI SHIKSHA FOUNDATION SAMITI 26,PURVANCHAL PHASE-II KHAJURI KALAN ROAD PIPLANI BHEL BHOPAL 5-4-2016
4512 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1 PREM PARISAR. OPP GOVT KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN 26-4-2016
4513 SHRIJI TAKNIKI EVAM VANIJYIK PRASHIKSHAN SANSTHAN 1, PREM PARISAR, OPP. GOVT. KALIDAS GIRLS COLLEGE, MOHAN TALKIES ROAD, UJJAIN 17-5-2016
4514 SHRI JUG MAHADEV EDUCATION SOCIETY MUKTA NAGAR, DURG 24-6-2016
4515 SHRI LAKSHMI COTSYN LIMITED 19/X-1 KRISHNAPURAM GT ROAD KANPUR 22-12-2013
4516 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW. 5-8-2016
4517 SHRI NARAIN EDUCATIONAL AND WELFARE TRUST 1/45 GOKHALE VIHAR MARG LUCKNOW 5-9-2016
4518 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH 5-2-2016
4519 SHRINATHJI WEBTECHNOLOGY PRIVATE LIMITED MIG-1749, SECTOR - I, LDA COLONY, ASHIANA, LUCKNOW, UTTAR PRADESH 3-3-2016
4520 SHRI NATIONAL COMPUTER EDUCATION FOUNDATION 200, SHANTI CHEMBERS, OPP. SBI BANK, STATION ROAD, BHUJ-KUTCH(GUJARAT 7-1-2015
4521 SHRI N H KAPADIA EDUCATION TRUST OPP TIRTHNAGAR 1, NR SUBHASH CHOWK, MEMNAGAR, AHMEDABAD 12-8-2015
4522 SHRI OM GURU ENTERPRISES PLOT NO 45, TEACHER'S COLONY, GUNROCK, TRIMULGHERRY, SECUNDERABAD 17-3-2015
4523 SHRI RAJEEV GANDHI COMPUTER SAKSHARTA SOCIETY RAJRANI TOWER, H-1-6, IT PARK, INDRAPRASTH INDUSTRIAL AREA, ROAD NO-4, JHALAWAR ROAD, KOTA(RAJASTHAN)-324005 9-12-2016
4524 SHRI RAMAJAYAM EDUCATIONAL TRUST 34, INDIRA NAGAR, EXTENSION, THURAIYUR(TK), TRICHY(DT) TAMILNADU, INDIA 8-1-2016
4525 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308 22-12-2016
4526 SHRIRAM EDUCATIONAL TRUST PLOT NO. 7,KNOWLEDGE PARK-2 GREATER NOIDA, GAUTAM BUDDH NAGAR-201308 17-1-2017
4527 SHRI RAMKRISHNA AROGYA SANSTHAN SHRI RAMKRISHNA AROGYA SANSTHAN, NASIK - TRIMBAKESHWAR, VILLAGE ANJANERI, TAL - TRIMBAKESHWAR, DIST - NASIK 22-7-2016
4528 SHRIRAM NEW HORIZONS LIMITED UGF, SOUTH WING, NBCC PLACE, BHISHMA PITAMAH MARG,NEW DELHI 4-10-2013
4529 SHRI RAM RAJA SARKAR LOK KALYAN TRUST SHANTI NIKETAN BUILDING SHIVAJI NAGAR KANPUR ROAD NEAR BPC PETROL PUMP 24-8-2015
4530 SHRIRAM SHIKSHAN SANSTHA PANIV A/P PANIV TAL MALSHIRAS DIST SOLAPUR 14-10-2015
4531